A0A077ZAZ2_TRITR Loading...

Mediator of RNA polymerase II transcription subunit 21

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

AlphaFold DB , UniProt , Accession A0A077ZAZ2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 130 aa.

						>A0A077ZAZ2_TRITR|A0A077ZAZ2
MSDRLTQLQDCINEMANHMCNSIGVLQQSSLPCKVASGEQDNAALFASLVARTAKDIDLLVESLPDEEPPRSAQREKYQRLGQLNAKAAQQLEETVAQGQLLLDRVSDVIDYIDQVQHQIAKMRAQEPLE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.2	Low	87.8	Confident	133 Å²	133	82.4 Å²	82.4	66%	0.655	43%	0.428	S	S	*	.				0	-52.9	0	-65.2	-166	-69.8	0	0	111.1	D3 R4 L5	M1-D3 VanDerWaalsContact C-N 3.32Å; M1-D3 PolarHBondContact O-N 2.92Å; M1-R4 PolarHBondContact O-N 3.19Å; M1-L5 PolarHBondContact O-N 3.4Å
2	S	69.8	Low	88.5	Confident	92 Å²	92	83.1 Å²	83.1	64%	0.643	43%	0.432	S	S	*	.	H	α-helix	trans	-54.6	-44.9	179.6	-160.7	0	0	0	0	113.5	R4 L5 T6	S2-R4 PolarHBondContact O-N 3.1Å; S2-L5 PolarHBondContact O-N 3.26Å; S2-T6 WeakPolarHBondContact O-CB 3.29Å; S2-T6 PolarHBondContact O-N 2.99Å; S2-T6 PolarHBondContact O-OG1 2.97Å
3	D	87.6	Confident	89.1	Confident	103 Å²	103	84.1 Å²	84.1	55%	0.551	44%	0.438	S	S	*	.	H	α-helix	trans	-60.5	-47.2	-174.5	-177.1	51.7	0	0	0	113.8	M1 T6 Q7	M1-D3 VanDerWaalsContact C-N 3.32Å; M1-D3 PolarHBondContact O-N 2.92Å; D3-T6 PolarHBondContact O-N 3.35Å; D3-Q7 WeakPolarHBondContact O-CB 3.3Å; D3-Q7 VanDerWaalsContact O-CG 3.28Å; D3-Q7 WeakPolarHBondContact O-CG 3.44Å; D3-Q7 PolarHBondContact O-N 3.4Å; D3-Q7 PolarHBondContact OD1-NE2 3.45Å; D3-Q7 PolarHBondContact OD2-NE2 3.07Å
4	R	90.5	Very high	89.6	Confident	116 Å²	116	84.3 Å²	84.3	44%	0.438	44%	0.436	S	S	.	.	H	α-helix	trans	-66.8	-38.3	176.9	-69.5	-61.1	-169.6	-166.4	5	112.8	M1 S2 Q7 L8 L64	M1-R4 PolarHBondContact O-N 3.19Å; S2-R4 PolarHBondContact O-N 3.1Å; R4-Q7 PolarHBondContact O-N 3.31Å; R4-L8 WeakPolarHBondContact O-CB 3.48Å; R4-L8 PolarHBondContact O-N 3.21Å; R4-L64 HydrophobicContact CB-CD2 4.03Å
5	L	89.8	Confident	90.1	Very high	91 Å²	91	80.2 Å²	80.2	48%	0.476	41%	0.414	S	S	.	.	H	α-helix	trans	-66.7	-40.2	176.4	-177.4	61.4	0	0	0	111.2	M1 S2 L8 Q9	M1-L5 PolarHBondContact O-N 3.4Å; S2-L5 PolarHBondContact O-N 3.26Å; L5-L8 PolarHBondContact O-N 3.07Å; L5-Q9 WeakPolarHBondContact O-CG 3.47Å; L5-Q9 PolarHBondContact O-N 3.45Å
6	T	92.8	Very high	90.5	Very high	57 Å²	57	78 Å²	78	35%	0.35	41%	0.412	S	S	.	.	H	α-helix	trans	-63.4	-47.1	174.2	-62	0	0	0	0	110.9	S2 D3 L8 Q9 D10	S2-T6 WeakPolarHBondContact O-CB 3.29Å; S2-T6 PolarHBondContact O-N 2.99Å; S2-T6 PolarHBondContact O-OG1 2.97Å; D3-T6 PolarHBondContact O-N 3.35Å; T6-L8 VanDerWaalsContact C-N 3.29Å; T6-L8 PolarHBondContact O-N 3.44Å; T6-Q9 WeakPolarHBondContact O-CB 3.4Å; T6-Q9 PolarHBondContact O-N 3.24Å; T6-Q9 VanDerWaalsContact O-N 3.08Å; T6-D10 PolarHBondContact O-N 2.92Å
7	Q	93.8	Very high	90.9	Very high	53 Å²	53	76.8 Å²	76.8	25%	0.248	41%	0.406	C	S	.	.	H	α-helix	trans	-58.1	-41.5	174.8	-73.2	165.3	27.8	0	0	112.3	D3 R4 Q9 D10 C11 L60	D3-Q7 WeakPolarHBondContact O-CB 3.3Å; D3-Q7 VanDerWaalsContact O-CG 3.28Å; D3-Q7 WeakPolarHBondContact O-CG 3.44Å; D3-Q7 PolarHBondContact O-N 3.4Å; D3-Q7 PolarHBondContact OD1-NE2 3.45Å; D3-Q7 PolarHBondContact OD2-NE2 3.07Å; R4-Q7 PolarHBondContact O-N 3.31Å; Q7-Q9 VanDerWaalsContact C-N 3.33Å; Q7-Q9 PolarHBondContact O-N 2.96Å; Q7-D10 PolarHBondContact O-N 3.46Å; Q7-C11 PolarHBondContact O-N 2.89Å; Q7-C11 PolarHBondContact O-SG 3.27Å; Q7-L60 HydrophobicContact CB-CD1 4.1Å; Q7-L60 HydrophobicContact CB-CD2 4.05Å
8	L	94.9	Very high	91.1	Very high	22 Å²	22	74 Å²	74	12%	0.115	39%	0.39	C	S	.	.	H	α-helix	trans	-62.5	-42.1	176	179.9	61.9	0	0	0	111.3	R4 L5 T6 C11 I12 I57 L60 V61 L64	R4-L8 WeakPolarHBondContact O-CB 3.48Å; R4-L8 PolarHBondContact O-N 3.21Å; L5-L8 PolarHBondContact O-N 3.07Å; T6-L8 VanDerWaalsContact C-N 3.29Å; T6-L8 PolarHBondContact O-N 3.44Å; L8-C11 PolarHBondContact O-N 3.3Å; L8-I12 HydrophobicContact CD1-CD1 4.17Å; L8-I12 HydrophobicContact CD1-CG1 4.45Å; L8-I12 HydrophobicContact CG-CD1 4Å; L8-I12 VanDerWaalsContact O-CG1 3.24Å; L8-I12 WeakPolarHBondContact O-CG1 3.47Å; L8-I12 PolarHBondContact O-N 2.96Å; L8-I57 HydrophobicContact CD1-CG1 4.48Å; L8-I57 HydrophobicContact CD1-CG2 3.91Å; L8-L60 HydrophobicContact CD1-CB 4.29Å; L8-V61 HydrophobicContact CD1-CG2 4.14Å; L8-V61 HydrophobicContact CD2-CG2 4.43Å; L8-L64 HydrophobicContact CD2-CD1 4.29Å
9	Q	94.7	Very high	91.3	Very high	117 Å²	117	75.1 Å²	75.1	55%	0.547	39%	0.394	S	S	.	.	H	α-helix	trans	-62.1	-42.7	174.6	-73.5	179.1	-12.9	0	0	112	L5 T6 Q7 I12 N13	L5-Q9 WeakPolarHBondContact O-CG 3.47Å; L5-Q9 PolarHBondContact O-N 3.45Å; T6-Q9 WeakPolarHBondContact O-CB 3.4Å; T6-Q9 PolarHBondContact O-N 3.24Å; T6-Q9 VanDerWaalsContact O-N 3.08Å; Q7-Q9 VanDerWaalsContact C-N 3.33Å; Q7-Q9 PolarHBondContact O-N 2.96Å; Q9-I12 PolarHBondContact O-N 3.33Å; Q9-N13 WeakPolarHBondContact O-CB 3.29Å; Q9-N13 PolarHBondContact O-N 3.1Å
10	D	96.3	Very high	91.5	Very high	95 Å²	95	75.6 Å²	75.6	51%	0.508	40%	0.403	S	S	.	.	H	α-helix	trans	-62.8	-45	177.8	-65.5	-28.4	0	0	0	111.2	T6 Q7 I12 N13 E14	T6-D10 PolarHBondContact O-N 2.92Å; Q7-D10 PolarHBondContact O-N 3.46Å; D10-I12 PolarHBondContact O-N 2.96Å; D10-N13 PolarHBondContact O-N 2.96Å; D10-E14 PolarHBondContact O-N 3.32Å
11	C	96	Very high	91.6	Very high	27 Å²	27	76.3 Å²	76.3	18%	0.182	41%	0.407	C	S	.	.	H	α-helix	trans	-63.8	-38.2	176.3	-71.8	0	0	0	0	112.8	Q7 L8 E14 M15 T53 I57 L60	Q7-C11 PolarHBondContact O-N 2.89Å; Q7-C11 PolarHBondContact O-SG 3.27Å; L8-C11 PolarHBondContact O-N 3.3Å; C11-E14 PolarHBondContact O-N 3.43Å; C11-M15 WeakPolarHBondContact O-CB 3.49Å; C11-M15 PolarHBondContact O-N 3.44Å; C11-T53 HydrophobicContact CB-CG2 4.41Å; C11-T53 VanDerWaalsContact O-CG2 3.26Å; C11-T53 WeakPolarHBondContact O-CG2 3.37Å; C11-I57 HydrophobicContact CB-CD1 4.4Å; C11-I57 HydrophobicContact CB-CG1 3.69Å; C11-L60 HydrophobicContact CB-CD1 4.25Å; C11-L60 VanDerWaalsContact SG-CD1 3.6Å
12	I	96.6	Very high	93.1	Very high	91 Å²	91	71 Å²	71	47%	0.467	38%	0.382	S	S	.	.	H	α-helix	trans	-65.2	-41	174.9	-70.7	167.3	0	0	0	110.7	L8 Q9 D10 M15 A16 I57	L8-I12 HydrophobicContact CD1-CD1 4.17Å; L8-I12 HydrophobicContact CD1-CG1 4.45Å; L8-I12 HydrophobicContact CG-CD1 4Å; L8-I12 VanDerWaalsContact O-CG1 3.24Å; L8-I12 WeakPolarHBondContact O-CG1 3.47Å; L8-I12 PolarHBondContact O-N 2.96Å; Q9-I12 PolarHBondContact O-N 3.33Å; D10-I12 PolarHBondContact O-N 2.96Å; I12-M15 WeakPolarHBondContact O-CB 3.25Å; I12-M15 PolarHBondContact O-N 2.99Å; I12-A16 PolarHBondContact O-N 3.32Å; I12-I57 HydrophobicContact CG1-CD1 4.21Å
13	N	96.6	Very high	94.2	Very high	96 Å²	96	70.9 Å²	70.9	51%	0.513	37%	0.374	S	S	.	.	H	α-helix	trans	-65.7	-43	176.9	-170.2	70	0	0	0	111.6	Q9 D10 M15 A16 N17	Q9-N13 WeakPolarHBondContact O-CB 3.29Å; Q9-N13 PolarHBondContact O-N 3.1Å; D10-N13 PolarHBondContact O-N 2.96Å; N13-M15 VanDerWaalsContact C-N 3.34Å; N13-M15 PolarHBondContact O-N 2.9Å; N13-A16 WeakPolarHBondContact O-CB 3.45Å; N13-A16 PolarHBondContact O-N 3.09Å; N13-N17 PolarHBondContact ND2-ND2 3.13Å; N13-N17 VanDerWaalsContact O-CG 3.32Å; N13-N17 PolarHBondContact O-N 3.41Å; N13-N17 PolarHBondContact O-ND2 2.86Å
14	E	96.5	Very high	94.2	Very high	87 Å²	87	67.1 Å²	67.1	41%	0.407	36%	0.36	S	S	.	.	H	α-helix	trans	-63.3	-38.5	174.4	-76.8	-57.8	104.6	0	0	112.5	D10 C11 A16 N17 H18 T53	D10-E14 PolarHBondContact O-N 3.32Å; C11-E14 PolarHBondContact O-N 3.43Å; E14-A16 VanDerWaalsContact C-N 3.33Å; E14-A16 PolarHBondContact O-N 2.92Å; E14-N17 WeakPolarHBondContact O-CB 3.39Å; E14-N17 PolarHBondContact O-N 3.47Å; E14-N17 PolarHBondContact OE1-ND2 2.94Å; E14-H18 PolarHBondContact O-CD2 2.99Å; E14-H18 PolarHBondContact O-N 3.46Å; E14-H18 IonicContact OE2-CE1 3.99Å; E14-T53 HydrophobicContact CB-CG2 4.42Å
15	M	96.4	Very high	94.1	Very high	23 Å²	23	63.5 Å²	63.5	11%	0.113	35%	0.35	C	S	.	.	H	α-helix	trans	-58.1	-47.2	172.7	-178.3	64.8	80.2	0	0	111.2	C11 I12 N13 N17 H18 M19 V50 T53 A54 I57	C11-M15 WeakPolarHBondContact O-CB 3.49Å; C11-M15 PolarHBondContact O-N 3.44Å; I12-M15 WeakPolarHBondContact O-CB 3.25Å; I12-M15 PolarHBondContact O-N 2.99Å; N13-M15 VanDerWaalsContact C-N 3.34Å; N13-M15 PolarHBondContact O-N 2.9Å; M15-N17 VanDerWaalsContact C-N 3.32Å; M15-N17 PolarHBondContact O-N 3Å; M15-H18 PolarHBondContact O-N 3.28Å; M15-M19 HydrophobicContact CG-CE 3.95Å; M15-M19 HydrophobicContact CG-SD 4.38Å; M15-M19 WeakPolarHBondContact O-CG 3.47Å; M15-M19 PolarHBondContact O-N 3.41Å; M15-M19 HydrophobicContact SD-CE 3.79Å; M15-V50 HydrophobicContact CE-CG1 4.45Å; M15-V50 WeakPolarHBondContact CE-O 3.4Å; M15-V50 HydrophobicContact SD-CB 4.27Å; M15-V50 HydrophobicContact SD-CG1 3.79Å; M15-V50 HydrophobicContact SD-CG2 4.29Å; M15-T53 HydrophobicContact CB-CG2 4.02Å; M15-T53 HydrophobicContact CE-CG2 4.06Å; M15-A54 VanDerWaalsContact CE-CA 3.43Å; M15-A54 HydrophobicContact CE-CB 3.64Å; M15-I57 HydrophobicContact CB-CD1 4.27Å; M15-I57 HydrophobicContact CE-CD1 3.99Å
16	A	97.3	Very high	93.9	Very high	45 Å²	45	62.5 Å²	62.5	37%	0.372	35%	0.345	S	S	.	.	H	α-helix	trans	-61.5	-41.2	176.7	0	0	0	0	0	111.5	I12 N13 E14 M19 C20	I12-A16 PolarHBondContact O-N 3.32Å; N13-A16 WeakPolarHBondContact O-CB 3.45Å; N13-A16 PolarHBondContact O-N 3.09Å; E14-A16 VanDerWaalsContact C-N 3.33Å; E14-A16 PolarHBondContact O-N 2.92Å; A16-M19 PolarHBondContact O-N 3.24Å; A16-C20 WeakPolarHBondContact O-CB 3.4Å; A16-C20 PolarHBondContact O-N 2.92Å; A16-C20 PolarHBondContact O-SG 3.03Å; A16-C20 VanDerWaalsContact O-SG 3.34Å
17	N	96.3	Very high	93.6	Very high	58 Å²	58	66 Å²	66	31%	0.31	36%	0.357	S	S	.	.	H	α-helix	trans	-60.9	-47.4	175.1	-71.2	-27.8	0	0	0	111.8	N13 E14 M15 M19 C20 N21	N13-N17 PolarHBondContact ND2-ND2 3.13Å; N13-N17 VanDerWaalsContact O-CG 3.32Å; N13-N17 PolarHBondContact O-N 3.41Å; N13-N17 PolarHBondContact O-ND2 2.86Å; E14-N17 WeakPolarHBondContact O-CB 3.39Å; E14-N17 PolarHBondContact O-N 3.47Å; E14-N17 PolarHBondContact OE1-ND2 2.94Å; M15-N17 VanDerWaalsContact C-N 3.32Å; M15-N17 PolarHBondContact O-N 3Å; N17-M19 PolarHBondContact O-N 3.28Å; N17-C20 PolarHBondContact O-N 3.37Å; N17-N21 WeakPolarHBondContact O-CB 3.34Å; N17-N21 PolarHBondContact O-N 2.99Å; N17-N21 PolarHBondContact O-ND2 3.15Å; N17-N21 VanDerWaalsContact O-ND2 3.17Å
18	H	94.9	Very high	93.1	Very high	26 Å²	26	70.7 Å²	70.7	12%	0.12	38%	0.379	C	S	.	.	H	α-helix	trans	-60.3	-44.4	177.1	-66.6	-22.5	0	0	0	111.9	E14 M15 S22 V50 T53	E14-H18 PolarHBondContact O-CD2 2.99Å; E14-H18 PolarHBondContact O-N 3.46Å; E14-H18 IonicContact OE2-CE1 3.99Å; M15-H18 PolarHBondContact O-N 3.28Å; H18-S22 WeakPolarHBondContact O-CB 3.37Å; H18-S22 PolarHBondContact O-N 3.16Å; H18-S22 PolarHBondContact O-OG 2.87Å; H18-V50 HydrophobicContact CB-CG2 3.87Å; H18-T53 PolarHBondContact CD2-OG1 2.93Å; H18-T53 PolarHBondContact NE2-OG1 3.4Å
19	M	94.7	Very high	92	Very high	94 Å²	94	71.5 Å²	71.5	46%	0.463	39%	0.387	S	S	.	.	H	α-helix	trans	-63	-50.8	177.6	-71.4	-178.5	176.5	0	0	111.5	M15 A16 N17 N21 S22 I23 V50	M15-M19 HydrophobicContact CG-CE 3.95Å; M15-M19 HydrophobicContact CG-SD 4.38Å; M15-M19 WeakPolarHBondContact O-CG 3.47Å; M15-M19 PolarHBondContact O-N 3.41Å; M15-M19 HydrophobicContact SD-CE 3.79Å; A16-M19 PolarHBondContact O-N 3.24Å; N17-M19 PolarHBondContact O-N 3.28Å; M19-N21 PolarHBondContact O-N 3.13Å; M19-S22 PolarHBondContact O-N 3.29Å; M19-S22 PolarHBondContact O-OG 3.09Å; M19-I23 WeakPolarHBondContact O-CG1 3.05Å; M19-I23 PolarHBondContact O-N 3.34Å; M19-I23 VanDerWaalsContact O-N 3.11Å; M19-V50 HydrophobicContact CE-CG1 4.34Å; M19-V50 HydrophobicContact CG-CG2 4.44Å
20	C	95.1	Very high	90.7	Very high	85 Å²	85	69.6 Å²	69.6	57%	0.574	39%	0.386	S	S	*	.	H	α-helix	trans	-61.6	-45.7	179	-72.6	0	0	0	0	112.5	A16 N17 I23 G24	A16-C20 WeakPolarHBondContact O-CB 3.4Å; A16-C20 PolarHBondContact O-N 2.92Å; A16-C20 PolarHBondContact O-SG 3.03Å; A16-C20 VanDerWaalsContact O-SG 3.34Å; N17-C20 PolarHBondContact O-N 3.37Å; C20-I23 PolarHBondContact O-N 3.45Å; C20-G24 PolarHBondContact O-N 2.92Å
21	N	93.1	Very high	89	Confident	92 Å²	92	71.5 Å²	71.5	49%	0.492	40%	0.396	S	S	.	.	H	α-helix	trans	-66.4	-39.4	179.2	-69	-22.3	0	0	0	111.5	N17 M19 I23 G24 V25 F46	N17-N21 WeakPolarHBondContact O-CB 3.34Å; N17-N21 PolarHBondContact O-N 2.99Å; N17-N21 PolarHBondContact O-ND2 3.15Å; N17-N21 VanDerWaalsContact O-ND2 3.17Å; M19-N21 PolarHBondContact O-N 3.13Å; N21-I23 PolarHBondContact O-N 3.43Å; N21-G24 PolarHBondContact O-N 3.41Å; N21-V25 WeakPolarHBondContact O-CG2 3.38Å; N21-V25 PolarHBondContact O-N 3.36Å; N21-F46 HydrophobicContact CB-CE1 3.85Å; N21-F46 HydrophobicContact CB-CZ 4.13Å
22	S	92.5	Very high	87.2	Confident	20 Å²	20	76.2 Å²	76.2	14%	0.14	43%	0.426	C	S	.	.	H	α-helix	trans	-60.3	-45.1	176.5	74.5	0	0	0	0	111.6	H18 M19 G24 V25 L26	H18-S22 WeakPolarHBondContact O-CB 3.37Å; H18-S22 PolarHBondContact O-N 3.16Å; H18-S22 PolarHBondContact O-OG 2.87Å; M19-S22 PolarHBondContact O-N 3.29Å; M19-S22 PolarHBondContact O-OG 3.09Å; S22-G24 PolarHBondContact O-N 2.99Å; S22-V25 PolarHBondContact O-N 2.87Å; S22-L26 VanDerWaalsContact O-CB 3.29Å; S22-L26 WeakPolarHBondContact O-CB 3.37Å; S22-L26 WeakPolarHBondContact O-CD1 3.36Å; S22-L26 WeakPolarHBondContact O-CG 3.27Å; S22-L26 PolarHBondContact O-N 3.22Å
23	I	91	Very high	84.9	Confident	90 Å²	90	77.9 Å²	77.9	46%	0.462	44%	0.444	S	S	.	.	H	α-helix	trans	-61.7	-47.1	177.2	-66.8	166.6	0	0	0	110	M19 C20 N21 V25 L26 Q27	M19-I23 WeakPolarHBondContact O-CG1 3.05Å; M19-I23 PolarHBondContact O-N 3.34Å; M19-I23 VanDerWaalsContact O-N 3.11Å; C20-I23 PolarHBondContact O-N 3.45Å; N21-I23 PolarHBondContact O-N 3.43Å; I23-V25 PolarHBondContact O-N 2.86Å; I23-L26 PolarHBondContact O-N 3.13Å; I23-Q27 HydrophobicContact CG2-CG 4.29Å; I23-Q27 WeakPolarHBondContact O-CB 3.33Å; I23-Q27 VanDerWaalsContact O-CG 3.23Å; I23-Q27 WeakPolarHBondContact O-CG 3.29Å; I23-Q27 PolarHBondContact O-N 2.86Å
24	G	89.3	Confident	82.9	Confident	25 Å²	25	81.9 Å²	81.9	26%	0.258	46%	0.457	S	S	.	.	H	α-helix	trans	-58.9	-47.6	178.9	0	0	0	0	0	113.1	C20 N21 S22 Q28	C20-G24 PolarHBondContact O-N 2.92Å; N21-G24 PolarHBondContact O-N 3.41Å; S22-G24 PolarHBondContact O-N 2.99Å; G24-Q28 VanDerWaalsContact O-CG 3.27Å; G24-Q28 WeakPolarHBondContact O-CG 3.5Å; G24-Q28 PolarHBondContact O-N 3.34Å
25	V	87.8	Confident	80.7	Confident	39 Å²	39	84.7 Å²	84.7	24%	0.236	48%	0.48	C	S	.	.	H	α-helix	trans	-67.6	-42.3	-179.6	171.9	0	0	0	0	111.7	N21 S22 I23 Q28 S29 N42 F46	N21-V25 WeakPolarHBondContact O-CG2 3.38Å; N21-V25 PolarHBondContact O-N 3.36Å; S22-V25 PolarHBondContact O-N 2.87Å; I23-V25 PolarHBondContact O-N 2.86Å; V25-Q28 PolarHBondContact O-N 3.49Å; V25-S29 WeakPolarHBondContact O-CB 3.41Å; V25-S29 PolarHBondContact O-N 2.77Å; V25-S29 PolarHBondContact O-OG 3.49Å; V25-N42 HydrophobicContact CG1-CB 4.1Å; V25-F46 HydrophobicContact CB-CE2 3.81Å; V25-F46 HydrophobicContact CB-CZ 4.31Å; V25-F46 HydrophobicContact CG1-CE2 4.04Å; V25-F46 HydrophobicContact CG2-CE2 3.91Å; V25-F46 HydrophobicContact CG2-CZ 3.93Å
26	L	85.7	Confident	78.7	Confident	70 Å²	70	85.9 Å²	85.9	37%	0.366	49%	0.494	S	S	.	.	H	α-helix	trans	-66.4	-39.2	179.1	-68.1	172.1	0	0	0	111.5	S22 I23 S29 S30 A43	S22-L26 VanDerWaalsContact O-CB 3.29Å; S22-L26 WeakPolarHBondContact O-CB 3.37Å; S22-L26 WeakPolarHBondContact O-CD1 3.36Å; S22-L26 WeakPolarHBondContact O-CG 3.27Å; S22-L26 PolarHBondContact O-N 3.22Å; I23-L26 PolarHBondContact O-N 3.13Å; L26-S29 PolarHBondContact O-N 3.02Å; L26-S30 WeakPolarHBondContact O-CB 3.46Å; L26-S30 PolarHBondContact O-N 3.46Å; L26-S30 PolarHBondContact O-OG 2.98Å; L26-A43 HydrophobicContact CD2-CB 4.07Å
27	Q	86	Confident	76.9	Confident	131 Å²	131	89 Å²	89	61%	0.612	51%	0.512	S	S	*	.	H	α-helix	trans	-67.7	-35.9	175.4	-74.9	178.2	-8.1	0	0	113.3	I23 S29 S30	I23-Q27 HydrophobicContact CG2-CG 4.29Å; I23-Q27 WeakPolarHBondContact O-CB 3.33Å; I23-Q27 VanDerWaalsContact O-CG 3.23Å; I23-Q27 WeakPolarHBondContact O-CG 3.29Å; I23-Q27 PolarHBondContact O-N 2.86Å; Q27-S29 VanDerWaalsContact C-N 3.3Å; Q27-S30 WeakPolarHBondContact CA-OG 3.43Å; Q27-S30 PolarHBondContact O-OG 2.99Å
28	Q	82.4	Confident	75.2	Confident	151 Å²	151	87.9 Å²	87.9	71%	0.706	52%	0.515	S	S	*	.	H	α-helix	trans	-69.3	-32.1	175.2	-74.3	174.4	6	0	0	112.3	G24 V25	G24-Q28 VanDerWaalsContact O-CG 3.27Å; G24-Q28 WeakPolarHBondContact O-CG 3.5Å; G24-Q28 PolarHBondContact O-N 3.34Å; V25-Q28 PolarHBondContact O-N 3.49Å
29	S	72.4	Confident	73.6	Confident	40 Å²	40	89.2 Å²	89.2	28%	0.28	52%	0.521	S	S	.	.	H	α-helix	trans	-81.3	-25.3	-179.3	-51.3	0	0	0	0	112.2	V25 L26 Q27 L31 E39	V25-S29 WeakPolarHBondContact O-CB 3.41Å; V25-S29 PolarHBondContact O-N 2.77Å; V25-S29 PolarHBondContact O-OG 3.49Å; L26-S29 PolarHBondContact O-N 3.02Å; Q27-S29 VanDerWaalsContact C-N 3.3Å; S29-L31 PolarHBondContact O-N 3.25Å; S29-E39 WeakPolarHBondContact CB-OE1 3.27Å
30	S	67	Low	72.3	Confident	76 Å²	76	92.2 Å²	92.2	53%	0.531	53%	0.534	S	S	.	.			trans	-71.5	61.8	178.2	67.7	0	0	0	0	113.4	L26 Q27	L26-S30 WeakPolarHBondContact O-CB 3.46Å; L26-S30 PolarHBondContact O-N 3.46Å; L26-S30 PolarHBondContact O-OG 2.98Å; Q27-S30 WeakPolarHBondContact CA-OG 3.43Å; Q27-S30 PolarHBondContact O-OG 2.99Å
31	L	61.1	Low	71.7	Confident	136 Å²	136	93.8 Å²	93.8	71%	0.712	54%	0.537	S	S	*	.			trans	-81.6	136.6	157	-92.1	92.3	0	0	0	108.9	S29 C33	S29-L31 PolarHBondContact O-N 3.25Å; L31-C33 PolarHBondContact O-N 3.31Å; L31-C33 VanDerWaalsContact O-N 3.11Å
32	P	57.9	Low	71.4	Confident	125 Å²	125	92 Å²	92	81%	0.812	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	118.7	175.2	27.6	-29.3	0	0	0	107.8
33	C	49.9	Very low	71.2	Confident	126 Å²	126	93 Å²	93	85%	0.851	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	122	13.4	157.4	-146.7	0	0	0	0	118.5	L31	L31-C33 PolarHBondContact O-N 3.31Å; L31-C33 VanDerWaalsContact O-N 3.11Å
34	K	53.2	Low	71.2	Confident	180 Å²	180	91.6 Å²	91.6	78%	0.783	54%	0.539	S	S	*	.			trans	-140	119.5	162.6	-69	-177.5	-179.3	174.4	0	111	A36	K34-A36 PolarHBondContact O-N 2.89Å
35	V	50.8	Low	71.3	Confident	146 Å²	146	94.5 Å²	94.5	89%	0.885	55%	0.548	S	S	*	.			trans	-59.2	82.2	158.4	-105.5	0	0	0	0	107.1	S37	V35-S37 PolarHBondContact O-N 2.87Å
36	A	54.8	Low	71.6	Confident	49 Å²	49	94 Å²	94	41%	0.405	54%	0.542	S	S	.	.			trans	-77.2	112.4	175.1	0	0	0	0	0	106	K34 G38 E39	K34-A36 PolarHBondContact O-N 2.89Å; A36-G38 PolarHBondContact O-N 3.47Å; A36-E39 HydrophobicContact CB-CG 4.33Å; A36-E39 WeakPolarHBondContact O-CB 3.41Å; A36-E39 PolarHBondContact O-N 3.32Å
37	S	58.2	Low	72.1	Confident	109 Å²	109	93.5 Å²	93.5	76%	0.762	55%	0.548	S	S	*	.	H	α-helix	trans	-50.9	-21.7	177.9	43.6	0	0	0	0	113.9	V35	V35-S37 PolarHBondContact O-N 2.87Å
38	G	61.3	Low	72.5	Confident	35 Å²	35	90.4 Å²	90.4	36%	0.361	54%	0.541	S	S	.	.	H	α-helix	trans	-71.5	-20.5	174.4	0	0	0	0	0	115.5	A36 D41 N42	A36-G38 PolarHBondContact O-N 3.47Å; G38-D41 PolarHBondContact O-N 2.95Å; G38-N42 PolarHBondContact O-N 3.39Å; G38-N42 VanDerWaalsContact O-N 3.08Å; G38-N42 PolarHBondContact O-ND2 3.37Å
39	E	60.9	Low	73.2	Confident	54 Å²	54	85.8 Å²	85.8	25%	0.252	52%	0.521	S	S	.	.	H	α-helix	trans	-67.4	-40.9	176.8	-72	-176.7	146	0	0	111.8	S29 A36 D41 A43	S29-E39 WeakPolarHBondContact CB-OE1 3.27Å; A36-E39 HydrophobicContact CB-CG 4.33Å; A36-E39 WeakPolarHBondContact O-CB 3.41Å; A36-E39 PolarHBondContact O-N 3.32Å; E39-D41 VanDerWaalsContact C-N 3.33Å; E39-A43 VanDerWaalsContact O-CB 3.23Å; E39-A43 WeakPolarHBondContact O-CB 3.39Å; E39-A43 PolarHBondContact O-N 3.26Å
40	Q	67.8	Low	74.3	Confident	158 Å²	158	85.6 Å²	85.6	74%	0.738	52%	0.518	S	S	*	.	H	α-helix	trans	-66.9	-37	178	-72.5	-174.5	-5.1	0	0	111.6	A44	Q40-A44 WeakPolarHBondContact O-CB 3.46Å; Q40-A44 PolarHBondContact O-N 3.18Å
41	D	83.3	Confident	75.7	Confident	117 Å²	117	85 Å²	85	63%	0.626	52%	0.518	S	S	*	.	H	α-helix	trans	-68.2	-46.4	178.9	-162.2	18.1	0	0	0	111.1	G38 E39 A44 L45	G38-D41 PolarHBondContact O-N 2.95Å; E39-D41 VanDerWaalsContact C-N 3.33Å; D41-A44 PolarHBondContact O-N 2.86Å; D41-L45 VanDerWaalsContact O-CB 3.25Å; D41-L45 WeakPolarHBondContact O-CB 3.4Å; D41-L45 PolarHBondContact O-N 2.9Å
42	N	86.1	Confident	77.4	Confident	56 Å²	56	86.9 Å²	86.9	30%	0.299	52%	0.515	S	S	.	.	H	α-helix	trans	-64.9	-43.6	176.1	-73.5	-26.9	0	0	0	112.3	V25 G38 L45 F46	V25-N42 HydrophobicContact CG1-CB 4.1Å; G38-N42 PolarHBondContact O-N 3.39Å; G38-N42 VanDerWaalsContact O-N 3.08Å; G38-N42 PolarHBondContact O-ND2 3.37Å; N42-L45 PolarHBondContact O-N 3.03Å; N42-F46 WeakPolarHBondContact O-CD2 3.36Å; N42-F46 PolarHBondContact O-N 3.33Å
43	A	88.3	Confident	79.3	Confident	40 Å²	40	81.5 Å²	81.5	33%	0.331	48%	0.481	S	S	.	.	H	α-helix	trans	-60.9	-45.7	177.1	0	0	0	0	0	111.5	L26 E39 A47	L26-A43 HydrophobicContact CD2-CB 4.07Å; E39-A43 VanDerWaalsContact O-CB 3.23Å; E39-A43 WeakPolarHBondContact O-CB 3.39Å; E39-A43 PolarHBondContact O-N 3.26Å; A43-A47 VanDerWaalsContact O-CB 3.26Å; A43-A47 WeakPolarHBondContact O-CB 3.41Å; A43-A47 PolarHBondContact O-N 3Å
44	A	91.1	Very high	81.5	Confident	61 Å²	61	77.1 Å²	77.1	50%	0.504	45%	0.453	S	S	.	.	H	α-helix	trans	-64.4	-40.8	176.6	0	0	0	0	0	111.9	Q40 D41 A47 S48	Q40-A44 WeakPolarHBondContact O-CB 3.46Å; Q40-A44 PolarHBondContact O-N 3.18Å; D41-A44 PolarHBondContact O-N 2.86Å; A44-A47 PolarHBondContact O-N 3.37Å; A44-S48 WeakPolarHBondContact O-CB 3.31Å; A44-S48 PolarHBondContact O-N 3.4Å
45	L	91.9	Very high	83.6	Confident	85 Å²	85	75 Å²	75	45%	0.445	44%	0.444	S	S	.	.	H	α-helix	trans	-60.4	-53.7	175.7	178.1	62.7	0	0	0	111.1	D41 N42 A47 S48 L49	D41-L45 VanDerWaalsContact O-CB 3.25Å; D41-L45 WeakPolarHBondContact O-CB 3.4Å; D41-L45 PolarHBondContact O-N 2.9Å; N42-L45 PolarHBondContact O-N 3.03Å; L45-A47 VanDerWaalsContact C-N 3.32Å; L45-A47 PolarHBondContact O-N 3Å; L45-S48 WeakPolarHBondContact O-CB 3.42Å; L45-S48 PolarHBondContact O-N 3.45Å; L45-S48 VanDerWaalsContact O-N 3.12Å; L45-S48 PolarHBondContact O-OG 3.37Å; L45-L49 HydrophobicContact CD1-CD1 4.43Å; L45-L49 HydrophobicContact CD1-CG 4.47Å; L45-L49 HydrophobicContact CG-CD1 4.27Å; L45-L49 WeakPolarHBondContact O-CG 3.46Å; L45-L49 PolarHBondContact O-N 2.96Å
46	F	94.1	Very high	85.8	Confident	29 Å²	29	70.9 Å²	70.9	13%	0.127	42%	0.417	C	S	.	.	H	α-helix	trans	-62.6	-39	178.6	-76.9	-65.3	0	0	0	112.2	N21 V25 N42 S48 L49 V50	N21-F46 HydrophobicContact CB-CE1 3.85Å; N21-F46 HydrophobicContact CB-CZ 4.13Å; V25-F46 HydrophobicContact CB-CE2 3.81Å; V25-F46 HydrophobicContact CB-CZ 4.31Å; V25-F46 HydrophobicContact CG1-CE2 4.04Å; V25-F46 HydrophobicContact CG2-CE2 3.91Å; V25-F46 HydrophobicContact CG2-CZ 3.93Å; N42-F46 WeakPolarHBondContact O-CD2 3.36Å; N42-F46 PolarHBondContact O-N 3.33Å; F46-S48 VanDerWaalsContact C-N 3.31Å; F46-S48 PolarHBondContact O-N 2.86Å; F46-L49 HydrophobicContact CD1-CD1 4.41Å; F46-L49 PolarHBondContact O-N 2.86Å; F46-V50 WeakPolarHBondContact O-CB 3.41Å; F46-V50 VanDerWaalsContact O-CG2 3.32Å; F46-V50 WeakPolarHBondContact O-CG2 3.45Å; F46-V50 PolarHBondContact O-N 3.44Å
47	A	94.4	Very high	87.8	Confident	59 Å²	59	70 Å²	70	49%	0.488	41%	0.405	S	S	.	.	H	α-helix	trans	-60.2	-41.5	173.9	0	0	0	0	0	111.7	A43 A44 L45 A51	A43-A47 VanDerWaalsContact O-CB 3.26Å; A43-A47 WeakPolarHBondContact O-CB 3.41Å; A43-A47 PolarHBondContact O-N 3Å; A44-A47 PolarHBondContact O-N 3.37Å; L45-A47 VanDerWaalsContact C-N 3.32Å; L45-A47 PolarHBondContact O-N 3Å; A47-A51 VanDerWaalsContact O-CB 3.25Å; A47-A51 WeakPolarHBondContact O-CB 3.42Å; A47-A51 PolarHBondContact O-N 3.39Å
48	S	95.5	Very high	89.6	Confident	66 Å²	66	69.6 Å²	69.6	46%	0.462	39%	0.394	S	S	.	.	H	α-helix	trans	-65.5	-40	176.3	80.3	0	0	0	0	112.6	A44 L45 F46 R52	A44-S48 WeakPolarHBondContact O-CB 3.31Å; A44-S48 PolarHBondContact O-N 3.4Å; L45-S48 WeakPolarHBondContact O-CB 3.42Å; L45-S48 PolarHBondContact O-N 3.45Å; L45-S48 VanDerWaalsContact O-N 3.12Å; L45-S48 PolarHBondContact O-OG 3.37Å; F46-S48 VanDerWaalsContact C-N 3.31Å; F46-S48 PolarHBondContact O-N 2.86Å; S48-R52 VanDerWaalsContact O-CB 3.28Å; S48-R52 WeakPolarHBondContact O-CB 3.45Å; S48-R52 PolarHBondContact O-N 3.37Å
49	L	96	Very high	91.2	Very high	54 Å²	54	72.2 Å²	72.2	28%	0.283	40%	0.4	S	S	.	.	H	α-helix	trans	-66.8	-48.1	178	-70.2	173.8	0	0	0	111	L45 F46 A51 R52 T53	L45-L49 HydrophobicContact CD1-CD1 4.43Å; L45-L49 HydrophobicContact CD1-CG 4.47Å; L45-L49 HydrophobicContact CG-CD1 4.27Å; L45-L49 WeakPolarHBondContact O-CG 3.46Å; L45-L49 PolarHBondContact O-N 2.96Å; F46-L49 HydrophobicContact CD1-CD1 4.41Å; F46-L49 PolarHBondContact O-N 2.86Å; L49-A51 PolarHBondContact O-N 3.47Å; L49-R52 PolarHBondContact O-N 2.9Å; L49-T53 WeakPolarHBondContact O-CB 3.09Å; L49-T53 PolarHBondContact O-N 2.87Å; L49-T53 PolarHBondContact O-OG1 2.98Å
50	V	96.4	Very high	92.7	Very high	37 Å²	37	70.5 Å²	70.5	22%	0.224	39%	0.392	C	S	.	.	H	α-helix	trans	-59.3	-47.8	175.4	168.4	0	0	0	0	110.8	M15 H18 M19 F46 R52 T53 A54	M15-V50 HydrophobicContact CE-CG1 4.45Å; M15-V50 WeakPolarHBondContact CE-O 3.4Å; M15-V50 HydrophobicContact SD-CB 4.27Å; M15-V50 HydrophobicContact SD-CG1 3.79Å; M15-V50 HydrophobicContact SD-CG2 4.29Å; H18-V50 HydrophobicContact CB-CG2 3.87Å; M19-V50 HydrophobicContact CE-CG1 4.34Å; M19-V50 HydrophobicContact CG-CG2 4.44Å; F46-V50 WeakPolarHBondContact O-CB 3.41Å; F46-V50 VanDerWaalsContact O-CG2 3.32Å; F46-V50 WeakPolarHBondContact O-CG2 3.45Å; F46-V50 PolarHBondContact O-N 3.44Å; V50-R52 VanDerWaalsContact C-N 3.32Å; V50-R52 PolarHBondContact O-N 3.31Å; V50-T53 PolarHBondContact O-N 3.48Å; V50-A54 VanDerWaalsContact O-CB 3.29Å; V50-A54 WeakPolarHBondContact O-CB 3.32Å; V50-A54 PolarHBondContact O-N 3.2Å
51	A	96.9	Very high	93.9	Very high	64 Å²	64	66.5 Å²	66.5	53%	0.529	38%	0.378	S	S	.	.	H	α-helix	trans	-62.8	-38.8	179.7	0	0	0	0	0	112.4	A47 L49 K55	A47-A51 VanDerWaalsContact O-CB 3.25Å; A47-A51 WeakPolarHBondContact O-CB 3.42Å; A47-A51 PolarHBondContact O-N 3.39Å; L49-A51 PolarHBondContact O-N 3.47Å; A51-K55 PolarHBondContact O-N 2.89Å; A51-K55 VanDerWaalsContact O-N 3.14Å
52	R	96.8	Very high	94.4	Very high	174 Å²	174	68.4 Å²	68.4	66%	0.657	38%	0.383	S	S	*	.	H	α-helix	trans	-66	-51.8	175.9	-178.6	178.7	178.7	170.2	0.5	111.5	S48 L49 V50 A54 K55 D56	S48-R52 VanDerWaalsContact O-CB 3.28Å; S48-R52 WeakPolarHBondContact O-CB 3.45Å; S48-R52 PolarHBondContact O-N 3.37Å; L49-R52 PolarHBondContact O-N 2.9Å; V50-R52 VanDerWaalsContact C-N 3.32Å; V50-R52 PolarHBondContact O-N 3.31Å; R52-A54 PolarHBondContact O-N 3.27Å; R52-K55 WeakPolarHBondContact O-CB 3.48Å; R52-K55 PolarHBondContact O-N 3.48Å; R52-K55 VanDerWaalsContact O-N 3.11Å; R52-D56 PolarHBondContact O-N 3.33Å
53	T	96.7	Very high	94.6	Very high	13 Å²	13	68.1 Å²	68.1	8%	0.08	39%	0.386	C	S	.	.	H	α-helix	trans	-62.6	-34	-179.9	-53.7	0	0	0	0	111.4	C11 E14 M15 H18 L49 V50 D56 I57	C11-T53 HydrophobicContact CB-CG2 4.41Å; C11-T53 VanDerWaalsContact O-CG2 3.26Å; C11-T53 WeakPolarHBondContact O-CG2 3.37Å; E14-T53 HydrophobicContact CB-CG2 4.42Å; M15-T53 HydrophobicContact CB-CG2 4.02Å; M15-T53 HydrophobicContact CE-CG2 4.06Å; H18-T53 PolarHBondContact CD2-OG1 2.93Å; H18-T53 PolarHBondContact NE2-OG1 3.4Å; L49-T53 WeakPolarHBondContact O-CB 3.09Å; L49-T53 PolarHBondContact O-N 2.87Å; L49-T53 PolarHBondContact O-OG1 2.98Å; V50-T53 PolarHBondContact O-N 3.48Å; T53-D56 PolarHBondContact O-N 2.94Å; T53-I57 HydrophobicContact CG2-CD1 4.4Å; T53-I57 VanDerWaalsContact O-CG1 3.29Å; T53-I57 WeakPolarHBondContact O-CG1 3.43Å; T53-I57 PolarHBondContact O-N 2.89Å
54	A	97.4	Very high	94.7	Very high	33 Å²	33	69 Å²	69	27%	0.273	39%	0.385	S	S	.	.	H	α-helix	trans	-62.4	-46.6	174.1	0	0	0	0	0	111.2	M15 V50 R52 D56 I57 D58	M15-A54 VanDerWaalsContact CE-CA 3.43Å; M15-A54 HydrophobicContact CE-CB 3.64Å; V50-A54 VanDerWaalsContact O-CB 3.29Å; V50-A54 WeakPolarHBondContact O-CB 3.32Å; V50-A54 PolarHBondContact O-N 3.2Å; R52-A54 PolarHBondContact O-N 3.27Å; A54-D56 VanDerWaalsContact C-N 3.32Å; A54-D56 PolarHBondContact O-N 3.19Å; A54-I57 WeakPolarHBondContact O-CB 3.5Å; A54-I57 PolarHBondContact O-N 2.85Å; A54-D58 PolarHBondContact O-N 2.93Å
55	K	97	Very high	94.4	Very high	135 Å²	135	70 Å²	70	59%	0.587	39%	0.386	S	S	*	.	H	α-helix	trans	-62.9	-39.3	176.2	-176.5	174.1	-178	174	0	112.2	A51 R52 I57 D58 L59	A51-K55 PolarHBondContact O-N 2.89Å; A51-K55 VanDerWaalsContact O-N 3.14Å; R52-K55 WeakPolarHBondContact O-CB 3.48Å; R52-K55 PolarHBondContact O-N 3.48Å; R52-K55 VanDerWaalsContact O-N 3.11Å; K55-I57 VanDerWaalsContact C-N 3.31Å; K55-D58 PolarHBondContact O-N 3.21Å; K55-L59 HydrophobicContact CG-CD1 4.47Å; K55-L59 WeakPolarHBondContact O-CG 3.41Å; K55-L59 PolarHBondContact O-N 3.44Å
56	D	96.3	Very high	93.6	Very high	61 Å²	61	74.3 Å²	74.3	33%	0.326	41%	0.41	S	S	.	.	H	α-helix	trans	-64.6	-38.2	176.6	-67	-22	0	0	0	110.9	R52 T53 A54 L60	R52-D56 PolarHBondContact O-N 3.33Å; T53-D56 PolarHBondContact O-N 2.94Å; A54-D56 VanDerWaalsContact C-N 3.32Å; A54-D56 PolarHBondContact O-N 3.19Å; D56-L60 WeakPolarHBondContact O-CB 3.41Å; D56-L60 VanDerWaalsContact O-CG 3.28Å; D56-L60 WeakPolarHBondContact O-CG 3.34Å; D56-L60 PolarHBondContact O-N 2.93Å
57	I	96.6	Very high	92.8	Very high	30 Å²	30	80.7 Å²	80.7	15%	0.154	44%	0.44	C	S	.	.	H	α-helix	trans	-61.1	-48.8	171.8	-70.5	166.2	0	0	0	110.9	L8 C11 I12 M15 T53 A54 K55 L59 L60 V61	L8-I57 HydrophobicContact CD1-CG1 4.48Å; L8-I57 HydrophobicContact CD1-CG2 3.91Å; C11-I57 HydrophobicContact CB-CD1 4.4Å; C11-I57 HydrophobicContact CB-CG1 3.69Å; I12-I57 HydrophobicContact CG1-CD1 4.21Å; M15-I57 HydrophobicContact CB-CD1 4.27Å; M15-I57 HydrophobicContact CE-CD1 3.99Å; T53-I57 HydrophobicContact CG2-CD1 4.4Å; T53-I57 VanDerWaalsContact O-CG1 3.29Å; T53-I57 WeakPolarHBondContact O-CG1 3.43Å; T53-I57 PolarHBondContact O-N 2.89Å; A54-I57 WeakPolarHBondContact O-CB 3.5Å; A54-I57 PolarHBondContact O-N 2.85Å; K55-I57 VanDerWaalsContact C-N 3.31Å; I57-L59 VanDerWaalsContact C-N 3.34Å; I57-L59 PolarHBondContact O-N 3.04Å; I57-L60 PolarHBondContact O-N 3Å; I57-L60 VanDerWaalsContact O-N 3.14Å; I57-V61 HydrophobicContact CG2-CG2 4.32Å; I57-V61 WeakPolarHBondContact O-CG2 3.37Å; I57-V61 PolarHBondContact O-N 3.43Å
58	D	96.2	Very high	92	Very high	100 Å²	100	84.2 Å²	84.2	54%	0.535	45%	0.446	S	S	.	.	H	α-helix	trans	-58.1	-46.4	179.7	-71.3	-28.4	0	0	0	111.3	A54 K55 L60 V61 E62	A54-D58 PolarHBondContact O-N 2.93Å; K55-D58 PolarHBondContact O-N 3.21Å; D58-L60 VanDerWaalsContact C-N 3.32Å; D58-L60 PolarHBondContact O-N 3.41Å; D58-V61 PolarHBondContact O-N 3.45Å; D58-E62 WeakPolarHBondContact O-CG 3.45Å; D58-E62 PolarHBondContact O-N 3.02Å
59	L	94.6	Very high	91.2	Very high	90 Å²	90	84 Å²	84	47%	0.471	44%	0.443	S	S	.	.	H	α-helix	trans	-62.6	-38.4	176.7	-70.6	174.6	0	0	0	112.6	K55 I57 S63	K55-L59 HydrophobicContact CG-CD1 4.47Å; K55-L59 WeakPolarHBondContact O-CG 3.41Å; K55-L59 PolarHBondContact O-N 3.44Å; I57-L59 VanDerWaalsContact C-N 3.34Å; I57-L59 PolarHBondContact O-N 3.04Å; L59-S63 WeakPolarHBondContact O-CB 3.33Å; L59-S63 PolarHBondContact O-N 3.38Å; L59-S63 VanDerWaalsContact O-N 3.1Å
60	L	94.1	Very high	90.8	Very high	18 Å²	18	85.3 Å²	85.3	9%	0.094	46%	0.455	C	S	.	.	H	α-helix	trans	-66.7	-41.2	176.5	-76.7	171.3	0	0	0	111.3	Q7 L8 C11 D56 I57 D58 S63 L64	Q7-L60 HydrophobicContact CB-CD1 4.1Å; Q7-L60 HydrophobicContact CB-CD2 4.05Å; L8-L60 HydrophobicContact CD1-CB 4.29Å; C11-L60 HydrophobicContact CB-CD1 4.25Å; C11-L60 VanDerWaalsContact SG-CD1 3.6Å; D56-L60 WeakPolarHBondContact O-CB 3.41Å; D56-L60 VanDerWaalsContact O-CG 3.28Å; D56-L60 WeakPolarHBondContact O-CG 3.34Å; D56-L60 PolarHBondContact O-N 2.93Å; I57-L60 PolarHBondContact O-N 3Å; I57-L60 VanDerWaalsContact O-N 3.14Å; D58-L60 VanDerWaalsContact C-N 3.32Å; D58-L60 PolarHBondContact O-N 3.41Å; L60-S63 PolarHBondContact O-N 2.7Å; L60-S63 VanDerWaalsContact O-N 3.15Å; L60-S63 PolarHBondContact O-OG 2.99Å; L60-L64 PolarHBondContact O-N 3.41Å
61	V	92.6	Very high	90.4	Very high	75 Å²	75	94.2 Å²	94.2	46%	0.455	48%	0.484	S	S	.	.	H	α-helix	trans	-62.8	-46.1	176.1	171.6	0	0	0	0	110.9	L8 I57 D58 S63 L64	L8-V61 HydrophobicContact CD1-CG2 4.14Å; L8-V61 HydrophobicContact CD2-CG2 4.43Å; I57-V61 HydrophobicContact CG2-CG2 4.32Å; I57-V61 WeakPolarHBondContact O-CG2 3.37Å; I57-V61 PolarHBondContact O-N 3.43Å; D58-V61 PolarHBondContact O-N 3.45Å; V61-S63 PolarHBondContact O-N 3.14Å; V61-L64 WeakPolarHBondContact O-CB 3.4Å; V61-L64 PolarHBondContact O-N 3.1Å; V61-L64 VanDerWaalsContact O-N 3.11Å
62	E	92.4	Very high	90.1	Very high	156 Å²	156	95.4 Å²	95.4	73%	0.729	49%	0.489	S	S	*	.	H	α-helix	trans	-62	-23	174.9	-71.9	178.8	175	0	0	113.1	D58	D58-E62 WeakPolarHBondContact O-CG 3.45Å; D58-E62 PolarHBondContact O-N 3.02Å
63	S	91.7	Very high	89.7	Confident	51 Å²	51	88.9 Å²	88.9	36%	0.357	47%	0.472	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87	-6.6	178.1	82.3	0	0	0	0	114.4	L59 L60 V61	L59-S63 WeakPolarHBondContact O-CB 3.33Å; L59-S63 PolarHBondContact O-N 3.38Å; L59-S63 VanDerWaalsContact O-N 3.1Å; L60-S63 PolarHBondContact O-N 2.7Å; L60-S63 VanDerWaalsContact O-N 3.15Å; L60-S63 PolarHBondContact O-OG 2.99Å; V61-S63 PolarHBondContact O-N 3.14Å
64	L	89	Confident	89.3	Confident	58 Å²	58	90.3 Å²	90.3	30%	0.304	48%	0.478	S	S	.	.	S	Bend	trans	-72	146.9	176.7	-66.6	177.8	0	0	0	110.3	R4 L8 L60 V61 D66	R4-L64 HydrophobicContact CB-CD2 4.03Å; L8-L64 HydrophobicContact CD2-CD1 4.29Å; L60-L64 PolarHBondContact O-N 3.41Å; V61-L64 WeakPolarHBondContact O-CB 3.4Å; V61-L64 PolarHBondContact O-N 3.1Å; V61-L64 VanDerWaalsContact O-N 3.11Å; L64-D66 PolarHBondContact O-N 2.92Å
65	P	85	Confident	89.1	Confident	83 Å²	83	97.1 Å²	97.1	54%	0.539	50%	0.497	S	S	.	.			trans	-64.2	133.3	174.9	27.2	-33.1	0	0	0	110.6	E67	P65-E67 VanDerWaalsContact C-N 3.32Å; P65-E67 PolarHBondContact O-N 2.79Å
66	D	76.7	Confident	88.9	Confident	174 Å²	174	97.1 Å²	97.1	93%	0.93	50%	0.499	S	S	*	.	S	Bend	trans	-58.2	-39.9	-174.8	-64.6	-51.8	0	0	0	113.8	L64	L64-D66 PolarHBondContact O-N 2.92Å
67	E	76.7	Confident	88.7	Confident	163 Å²	163	101.8 Å²	101.8	76%	0.762	52%	0.516	S	S	*	.	S	Bend	trans	-142.3	125.8	-177.3	-164.2	176.8	175.6	0	0	109.6	P65 P69	P65-E67 VanDerWaalsContact C-N 3.32Å; P65-E67 PolarHBondContact O-N 2.79Å; E67-P69 WeakPolarHBondContact O-CD 3.28Å
68	E	77	Confident	88.5	Confident	134 Å²	134	107.3 Å²	107.3	63%	0.626	54%	0.536	S	S	*	.	P	Polyproline II helix	trans	-70.2	118.3	170.5	-163.9	174.1	-160.2	0	0	107.6
69	P	79.6	Confident	88.5	Confident	60 Å²	60	107.9 Å²	107.9	39%	0.39	54%	0.536	S	S	.	.	P	Polyproline II helix	trans	-59.5	147.9	-178.9	24.9	-33.5	0	0	0	109.3	E67 R71 A73 Q74	E67-P69 WeakPolarHBondContact O-CD 3.28Å; P69-R71 PolarHBondContact O-N 3.11Å; P69-A73 HydrophobicContact CB-CB 4.37Å; P69-Q74 HydrophobicContact CG-CB 4.31Å
70	P	86.8	Confident	88.6	Confident	82 Å²	82	111.8 Å²	111.8	53%	0.532	54%	0.544	S	S	.	.	P	Polyproline II helix	trans	-53.9	142.1	177.4	21.7	-31.6	0	0	0	109.6	S72 A73 Q74	P70-S72 CarbonylContact O-C 3.58Å; P70-S72 PolarHBondContact O-N 3.23Å; P70-A73 HydrophobicContact CG-CB 3.85Å; P70-A73 WeakPolarHBondContact O-CB 3.4Å; P70-A73 PolarHBondContact O-N 3.15Å; P70-Q74 PolarHBondContact O-N 3.44Å
71	R	87.6	Confident	88.7	Confident	224 Å²	224	116 Å²	116	85%	0.845	57%	0.566	S	S	*	*	H	α-helix	trans	-51.3	-31	-174.4	-65.9	-176.4	-177	-173.5	0.7	113.1	P69 R75	P69-R71 PolarHBondContact O-N 3.11Å; R71-R75 WeakPolarHBondContact O-CB 3.5Å; R71-R75 PolarHBondContact O-N 3.49Å
72	S	90.7	Very high	88.9	Confident	89 Å²	89	114.3 Å²	114.3	62%	0.622	56%	0.563	S	S	*	*	H	α-helix	trans	-62.9	-51.5	173.1	49.4	0	0	0	0	112.8	P70 Q74 R75 E76	P70-S72 CarbonylContact O-C 3.58Å; P70-S72 PolarHBondContact O-N 3.23Å; S72-Q74 VanDerWaalsContact C-N 3.32Å; S72-Q74 PolarHBondContact O-N 3.36Å; S72-R75 WeakPolarHBondContact O-CB 3.45Å; S72-R75 PolarHBondContact O-N 3.2Å; S72-E76 PolarHBondContact O-N 3.29Å
73	A	89.7	Confident	89.2	Confident	37 Å²	37	113.4 Å²	113.4	31%	0.306	56%	0.559	S	S	.	*	H	α-helix	trans	-64	-37.8	177.8	0	0	0	0	0	111.7	P69 P70 E76 K77	P69-A73 HydrophobicContact CB-CB 4.37Å; P70-A73 HydrophobicContact CG-CB 3.85Å; P70-A73 WeakPolarHBondContact O-CB 3.4Å; P70-A73 PolarHBondContact O-N 3.15Å; A73-E76 PolarHBondContact O-N 3.29Å; A73-K77 WeakPolarHBondContact O-CB 3.4Å; A73-K77 PolarHBondContact O-N 2.93Å
74	Q	88.1	Confident	89.5	Confident	43 Å²	43	115.8 Å²	115.8	20%	0.201	57%	0.567	C	S	.	*	H	α-helix	trans	-62.9	-44.2	174.4	-164.1	-174.8	17.8	0	0	111.2	P69 P70 S72 K77 Y78	P69-Q74 HydrophobicContact CG-CB 4.31Å; P70-Q74 PolarHBondContact O-N 3.44Å; S72-Q74 VanDerWaalsContact C-N 3.32Å; S72-Q74 PolarHBondContact O-N 3.36Å; Q74-K77 PolarHBondContact O-N 3.34Å; Q74-Y78 HydrophobicContact CG-CD2 3.96Å; Q74-Y78 HydrophobicContact CG-CE2 3.53Å; Q74-Y78 WeakPolarHBondContact O-CD2 3.28Å; Q74-Y78 PolarHBondContact O-N 3.45Å
75	R	92.3	Very high	89.9	Confident	177 Å²	177	118.4 Å²	118.4	67%	0.668	58%	0.582	S	S	*	*	H	α-helix	trans	-63	-43.1	176.9	-167.6	178.8	-161.1	168.6	4.6	112.1	R71 S72 Y78 Q79	R71-R75 WeakPolarHBondContact O-CB 3.5Å; R71-R75 PolarHBondContact O-N 3.49Å; S72-R75 WeakPolarHBondContact O-CB 3.45Å; S72-R75 PolarHBondContact O-N 3.2Å; R75-Y78 PolarHBondContact O-N 3.32Å; R75-Q79 WeakPolarHBondContact O-CG 3.39Å; R75-Q79 PolarHBondContact O-N 2.9Å
76	E	93.1	Very high	90.5	Very high	134 Å²	134	117.4 Å²	117.4	63%	0.626	58%	0.58	S	S	*	*	H	α-helix	trans	-61.2	-44.9	175.7	-173.1	-176	168.9	0	0	111.2	S72 A73 Y78 Q79 R80	S72-E76 PolarHBondContact O-N 3.29Å; A73-E76 PolarHBondContact O-N 3.29Å; E76-Y78 VanDerWaalsContact C-N 3.33Å; E76-Y78 PolarHBondContact O-N 2.97Å; E76-Q79 PolarHBondContact O-N 3.32Å; E76-R80 WeakPolarHBondContact O-CB 3.49Å; E76-R80 PolarHBondContact O-N 2.95Å
77	K	91.7	Very high	91.5	Very high	159 Å²	159	115 Å²	115	69%	0.691	56%	0.562	S	S	*	*	H	α-helix	trans	-58	-44.6	174.7	-173.8	179.7	180	178.6	0	111.6	A73 Q74 R80 L81	A73-K77 WeakPolarHBondContact O-CB 3.4Å; A73-K77 PolarHBondContact O-N 2.93Å; Q74-K77 PolarHBondContact O-N 3.34Å; K77-R80 PolarHBondContact O-N 3.33Å; K77-L81 WeakPolarHBondContact O-CB 3.44Å; K77-L81 PolarHBondContact O-N 2.92Å
78	Y	93.4	Very high	92.5	Very high	146 Å²	146	109.6 Å²	109.6	57%	0.573	55%	0.545	S	S	*	.	H	α-helix	trans	-65.1	-40.1	176.1	-77.2	-59.9	0	0	0	112.7	Q74 R75 E76 L81 G82	Q74-Y78 HydrophobicContact CG-CD2 3.96Å; Q74-Y78 HydrophobicContact CG-CE2 3.53Å; Q74-Y78 WeakPolarHBondContact O-CD2 3.28Å; Q74-Y78 PolarHBondContact O-N 3.45Å; R75-Y78 PolarHBondContact O-N 3.32Å; E76-Y78 VanDerWaalsContact C-N 3.33Å; E76-Y78 PolarHBondContact O-N 2.97Å; Y78-L81 PolarHBondContact O-N 3.03Å; Y78-G82 PolarHBondContact O-N 2.88Å
79	Q	95.7	Very high	93.5	Very high	113 Å²	113	105.2 Å²	105.2	53%	0.528	53%	0.532	S	S	.	.	H	α-helix	trans	-63.1	-46.9	175.8	-75.3	176.9	-11.1	0	0	111.5	R75 E76 L81 G82 Q83	R75-Q79 WeakPolarHBondContact O-CG 3.39Å; R75-Q79 PolarHBondContact O-N 2.9Å; E76-Q79 PolarHBondContact O-N 3.32Å; Q79-L81 VanDerWaalsContact C-N 3.34Å; Q79-L81 PolarHBondContact O-N 3.45Å; Q79-G82 PolarHBondContact O-N 3.35Å; Q79-Q83 WeakPolarHBondContact O-CG 3.28Å; Q79-Q83 PolarHBondContact O-N 3.21Å
80	R	96.5	Very high	94.4	Very high	172 Å²	172	108.6 Å²	108.6	65%	0.649	54%	0.542	S	S	*	.	H	α-helix	trans	-60.9	-43.5	175.8	-175.2	176.1	178.9	175.5	-0.5	111.5	E76 K77 G82 Q83 L84	E76-R80 WeakPolarHBondContact O-CB 3.49Å; E76-R80 PolarHBondContact O-N 2.95Å; K77-R80 PolarHBondContact O-N 3.33Å; R80-G82 VanDerWaalsContact C-N 3.32Å; R80-G82 PolarHBondContact O-N 3.26Å; R80-Q83 PolarHBondContact O-N 3.37Å; R80-L84 HydrophobicContact CG-CD1 4.38Å; R80-L84 WeakPolarHBondContact O-CG 3.29Å; R80-L84 PolarHBondContact O-N 2.83Å
81	L	97	Very high	95	Very high	107 Å²	107	109.8 Å²	109.8	56%	0.56	54%	0.54	S	S	*	.	H	α-helix	trans	-62	-41.3	175.7	-173.7	64.5	0	0	0	111.4	K77 Y78 Q79 L84 N85	K77-L81 WeakPolarHBondContact O-CB 3.44Å; K77-L81 PolarHBondContact O-N 2.92Å; Y78-L81 PolarHBondContact O-N 3.03Å; Q79-L81 VanDerWaalsContact C-N 3.34Å; Q79-L81 PolarHBondContact O-N 3.45Å; L81-L84 PolarHBondContact O-N 2.95Å; L81-N85 VanDerWaalsContact O-CB 3.31Å; L81-N85 WeakPolarHBondContact O-CB 3.25Å; L81-N85 PolarHBondContact O-N 3.4Å
82	G	97.1	Very high	95.5	Very high	38 Å²	38	104.5 Å²	104.5	39%	0.392	53%	0.528	S	S	.	.	H	α-helix	trans	-61.3	-43.4	174.7	0	0	0	0	0	112.9	Y78 Q79 R80 N85 A86	Y78-G82 PolarHBondContact O-N 2.88Å; Q79-G82 PolarHBondContact O-N 3.35Å; R80-G82 VanDerWaalsContact C-N 3.32Å; R80-G82 PolarHBondContact O-N 3.26Å; G82-N85 PolarHBondContact O-N 3.3Å; G82-A86 WeakPolarHBondContact O-CB 3.26Å; G82-A86 PolarHBondContact O-N 2.93Å
83	Q	97.4	Very high	95.8	Very high	137 Å²	137	106.8 Å²	106.8	64%	0.64	53%	0.529	S	S	*	.	H	α-helix	trans	-63.5	-44.1	175.5	-70.5	172.1	2.3	0	0	112.2	Q79 R80 N85 A86 K87	Q79-Q83 WeakPolarHBondContact O-CG 3.28Å; Q79-Q83 PolarHBondContact O-N 3.21Å; R80-Q83 PolarHBondContact O-N 3.37Å; Q83-N85 VanDerWaalsContact C-N 3.34Å; Q83-A86 PolarHBondContact O-N 2.98Å; Q83-K87 PolarHBondContact O-N 3.49Å
84	L	97.9	Very high	96.2	Very high	101 Å²	101	110.5 Å²	110.5	53%	0.529	54%	0.54	S	S	.	.	H	α-helix	trans	-63.4	-41.4	176.2	-71.1	174.6	0	0	0	111.6	R80 L81 K87 A88	R80-L84 HydrophobicContact CG-CD1 4.38Å; R80-L84 WeakPolarHBondContact O-CG 3.29Å; R80-L84 PolarHBondContact O-N 2.83Å; L81-L84 PolarHBondContact O-N 2.95Å; L84-K87 PolarHBondContact O-N 2.88Å; L84-A88 WeakPolarHBondContact O-CB 3.49Å; L84-A88 PolarHBondContact O-N 3.01Å
85	N	97.9	Very high	96.7	Very high	114 Å²	114	112.7 Å²	112.7	61%	0.61	56%	0.557	S	S	*	*	H	α-helix	trans	-64.5	-43.3	177	-169	37.1	0	0	0	111.6	L81 G82 Q83 K87 A88 A89	L81-N85 VanDerWaalsContact O-CB 3.31Å; L81-N85 WeakPolarHBondContact O-CB 3.25Å; L81-N85 PolarHBondContact O-N 3.4Å; G82-N85 PolarHBondContact O-N 3.3Å; Q83-N85 VanDerWaalsContact C-N 3.34Å; N85-K87 VanDerWaalsContact C-N 3.34Å; N85-K87 PolarHBondContact O-N 3.14Å; N85-A88 PolarHBondContact O-N 3.39Å; N85-A89 WeakPolarHBondContact O-CB 3.38Å; N85-A89 PolarHBondContact O-N 2.89Å
86	A	97.9	Very high	96.9	Very high	61 Å²	61	108.6 Å²	108.6	50%	0.504	55%	0.551	S	S	.	*	H	α-helix	trans	-61	-42.6	175.6	0	0	0	0	0	111.9	G82 Q83 A89 Q90	G82-A86 WeakPolarHBondContact O-CB 3.26Å; G82-A86 PolarHBondContact O-N 2.93Å; Q83-A86 PolarHBondContact O-N 2.98Å; A86-A89 PolarHBondContact O-N 3.11Å; A86-Q90 PolarHBondContact O-N 2.99Å
87	K	98	Very high	97.2	Very high	125 Å²	125	105 Å²	105	54%	0.543	55%	0.545	S	S	.	.	H	α-helix	trans	-64.1	-43.3	175	-176.4	176.6	179.5	179.2	0	112.1	Q83 L84 N85 A89 Q90 Q91	Q83-K87 PolarHBondContact O-N 3.49Å; L84-K87 PolarHBondContact O-N 2.88Å; N85-K87 VanDerWaalsContact C-N 3.34Å; N85-K87 PolarHBondContact O-N 3.14Å; K87-A89 VanDerWaalsContact C-N 3.33Å; K87-Q90 PolarHBondContact O-N 3.4Å; K87-Q91 WeakPolarHBondContact O-CG 3.39Å; K87-Q91 PolarHBondContact O-N 3.31Å
88	A	97.8	Very high	97.5	Very high	49 Å²	49	103 Å²	103	41%	0.405	54%	0.538	S	S	.	.	H	α-helix	trans	-63.4	-40.1	177.2	0	0	0	0	0	111.6	L84 N85 Q91 L92	L84-A88 WeakPolarHBondContact O-CB 3.49Å; L84-A88 PolarHBondContact O-N 3.01Å; N85-A88 PolarHBondContact O-N 3.39Å; A88-Q91 PolarHBondContact O-N 3.4Å; A88-L92 WeakPolarHBondContact O-CB 3.24Å; A88-L92 PolarHBondContact O-N 3.32Å
89	A	98.3	Very high	97.7	Very high	42 Å²	42	97.6 Å²	97.6	35%	0.347	53%	0.526	S	S	.	.	H	α-helix	trans	-62.2	-44.1	174.4	0	0	0	0	0	111.9	N85 A86 K87 Q91 L92 E93	N85-A89 WeakPolarHBondContact O-CB 3.38Å; N85-A89 PolarHBondContact O-N 2.89Å; A86-A89 PolarHBondContact O-N 3.11Å; K87-A89 VanDerWaalsContact C-N 3.33Å; A89-Q91 PolarHBondContact O-N 3.46Å; A89-L92 WeakPolarHBondContact O-CB 3.39Å; A89-L92 PolarHBondContact O-N 3.44Å; A89-E93 WeakPolarHBondContact O-CG 3.29Å; A89-E93 PolarHBondContact O-N 3.45Å
90	Q	98.1	Very high	97.8	Very high	130 Å²	130	97 Å²	97	61%	0.607	52%	0.523	S	S	*	.	H	α-helix	trans	-61.2	-42.5	175.9	-174	-176.3	-2.2	0	0	112.3	A86 K87 L92 E93 E94	A86-Q90 PolarHBondContact O-N 2.99Å; K87-Q90 PolarHBondContact O-N 3.4Å; Q90-L92 VanDerWaalsContact C-N 3.3Å; Q90-L92 PolarHBondContact O-N 2.88Å; Q90-E93 PolarHBondContact O-N 3.44Å; Q90-E94 PolarHBondContact O-N 2.93Å
91	Q	97.9	Very high	97.8	Very high	107 Å²	107	94.7 Å²	94.7	50%	0.5	52%	0.523	S	S	.	.	H	α-helix	trans	-64.2	-37.7	176	-72	178.3	-31.2	0	0	111.9	K87 A88 A89 T95	K87-Q91 WeakPolarHBondContact O-CG 3.39Å; K87-Q91 PolarHBondContact O-N 3.31Å; A88-Q91 PolarHBondContact O-N 3.4Å; A89-Q91 PolarHBondContact O-N 3.46Å; Q91-T95 WeakPolarHBondContact O-CB 3.38Å; Q91-T95 PolarHBondContact O-N 2.9Å; Q91-T95 PolarHBondContact O-OG1 3.32Å
92	L	98.1	Very high	97.9	Very high	113 Å²	113	94.8 Å²	94.8	59%	0.592	52%	0.524	S	S	*	.	H	α-helix	trans	-64.3	-46.3	174.5	179.8	62.8	0	0	0	111	A88 A89 Q90 E94 T95 V96	A88-L92 WeakPolarHBondContact O-CB 3.24Å; A88-L92 PolarHBondContact O-N 3.32Å; A89-L92 WeakPolarHBondContact O-CB 3.39Å; A89-L92 PolarHBondContact O-N 3.44Å; Q90-L92 VanDerWaalsContact C-N 3.3Å; Q90-L92 PolarHBondContact O-N 2.88Å; L92-E94 PolarHBondContact O-N 3.27Å; L92-T95 PolarHBondContact O-N 3.49Å; L92-V96 HydrophobicContact CD1-CG2 4.22Å; L92-V96 HydrophobicContact CG-CG2 4.44Å; L92-V96 WeakPolarHBondContact O-CB 3.21Å; L92-V96 VanDerWaalsContact O-CG2 3.27Å; L92-V96 WeakPolarHBondContact O-CG2 3.25Å; L92-V96 PolarHBondContact O-N 3.26Å
93	E	98.1	Very high	97.9	Very high	137 Å²	137	98.2 Å²	98.2	64%	0.64	53%	0.533	S	S	*	.	H	α-helix	trans	-58.7	-44.9	176.6	-75.3	174.3	-172.1	0	0	112	A89 Q90 T95 V96 A97	A89-E93 WeakPolarHBondContact O-CG 3.29Å; A89-E93 PolarHBondContact O-N 3.45Å; Q90-E93 PolarHBondContact O-N 3.44Å; E93-T95 PolarHBondContact O-N 3.08Å; E93-V96 PolarHBondContact O-N 2.96Å; E93-A97 WeakPolarHBondContact O-CB 3.26Å; E93-A97 PolarHBondContact O-N 3.43Å
94	E	97.9	Very high	97.9	Very high	115 Å²	115	95.6 Å²	95.6	54%	0.537	52%	0.523	S	S	.	.	H	α-helix	trans	-61.8	-44.5	176.8	-174	179.1	179	0	0	111.6	Q90 L92 V96 A97 Q98	Q90-E94 PolarHBondContact O-N 2.93Å; L92-E94 PolarHBondContact O-N 3.27Å; E94-V96 PolarHBondContact O-N 2.67Å; E94-A97 PolarHBondContact O-N 3.12Å; E94-Q98 WeakPolarHBondContact O-CG 3.32Å; E94-Q98 PolarHBondContact O-N 3.41Å
95	T	97.9	Very high	97.9	Very high	90 Å²	90	99.1 Å²	99.1	55%	0.552	53%	0.529	S	S	*	.	H	α-helix	trans	-64.2	-41.3	178.2	-54.7	0	0	0	0	111.3	Q91 L92 E93 Q98 G99	Q91-T95 WeakPolarHBondContact O-CB 3.38Å; Q91-T95 PolarHBondContact O-N 2.9Å; Q91-T95 PolarHBondContact O-OG1 3.32Å; L92-T95 PolarHBondContact O-N 3.49Å; E93-T95 PolarHBondContact O-N 3.08Å; T95-Q98 PolarHBondContact O-N 2.99Å; T95-G99 PolarHBondContact O-N 2.84Å
96	V	98.2	Very high	97.9	Very high	90 Å²	90	97.2 Å²	97.2	55%	0.545	52%	0.521	S	S	.	.	H	α-helix	trans	-64.8	-42	176.3	169.4	0	0	0	0	110.9	L92 E93 E94 G99 Q100	L92-V96 HydrophobicContact CD1-CG2 4.22Å; L92-V96 HydrophobicContact CG-CG2 4.44Å; L92-V96 WeakPolarHBondContact O-CB 3.21Å; L92-V96 VanDerWaalsContact O-CG2 3.27Å; L92-V96 WeakPolarHBondContact O-CG2 3.25Å; L92-V96 PolarHBondContact O-N 3.26Å; E93-V96 PolarHBondContact O-N 2.96Å; E94-V96 PolarHBondContact O-N 2.67Å; V96-G99 PolarHBondContact O-N 2.88Å; V96-Q100 PolarHBondContact O-N 3.45Å
97	A	98	Very high	97.9	Very high	60 Å²	60	97 Å²	97	50%	0.496	52%	0.517	S	S	.	.	H	α-helix	trans	-63.2	-42.5	177.2	0	0	0	0	0	112.2	E93 E94 G99 Q100 L101	E93-A97 WeakPolarHBondContact O-CB 3.26Å; E93-A97 PolarHBondContact O-N 3.43Å; E94-A97 PolarHBondContact O-N 3.12Å; A97-G99 VanDerWaalsContact C-N 3.34Å; A97-Q100 PolarHBondContact O-N 2.86Å; A97-L101 PolarHBondContact O-N 2.9Å; A97-L101 VanDerWaalsContact O-N 3.13Å
98	Q	97.9	Very high	97.8	Very high	117 Å²	117	96.3 Å²	96.3	55%	0.547	52%	0.519	S	S	.	.	H	α-helix	trans	-63.1	-41.6	173.5	-69.6	174.6	13	0	0	111.6	E94 T95 L101 L102	E94-Q98 WeakPolarHBondContact O-CG 3.32Å; E94-Q98 PolarHBondContact O-N 3.41Å; T95-Q98 PolarHBondContact O-N 2.99Å; Q98-L101 PolarHBondContact O-N 3.43Å; Q98-L102 PolarHBondContact O-N 2.92Å; Q98-L102 VanDerWaalsContact O-N 3.15Å
99	G	98.1	Very high	97.8	Very high	32 Å²	32	97.7 Å²	97.7	33%	0.33	52%	0.522	S	S	.	.	H	α-helix	trans	-60.4	-43.6	175	0	0	0	0	0	112.7	T95 V96 A97 L102 L103	T95-G99 PolarHBondContact O-N 2.84Å; V96-G99 PolarHBondContact O-N 2.88Å; A97-G99 VanDerWaalsContact C-N 3.34Å; G99-L102 PolarHBondContact O-N 3.48Å; G99-L103 WeakPolarHBondContact O-CG 3.41Å; G99-L103 PolarHBondContact O-N 3.2Å
100	Q	97.7	Very high	97.8	Very high	99 Å²	99	99.8 Å²	99.8	46%	0.463	53%	0.526	S	S	.	.	H	α-helix	trans	-62.8	-44	178	-172.4	60.3	46	0	0	111.8	V96 A97 L102 L103 D104	V96-Q100 PolarHBondContact O-N 3.45Å; A97-Q100 PolarHBondContact O-N 2.86Å; Q100-L102 VanDerWaalsContact C-N 3.27Å; Q100-L102 PolarHBondContact O-N 2.95Å; Q100-L103 WeakPolarHBondContact O-CB 3.44Å; Q100-L103 PolarHBondContact O-N 3.22Å; Q100-L103 VanDerWaalsContact O-N 3.09Å; Q100-D104 PolarHBondContact NE2-OD1 3.47Å; Q100-D104 VanDerWaalsContact O-CG 3.26Å; Q100-D104 PolarHBondContact O-N 3.05Å
101	L	97.6	Very high	97.7	Very high	124 Å²	124	97.3 Å²	97.3	65%	0.649	52%	0.518	S	S	*	.	H	α-helix	trans	-61.9	-37.8	178.4	-157.9	159.3	0	0	0	111.6	A97 Q98 R105	A97-L101 PolarHBondContact O-N 2.9Å; A97-L101 VanDerWaalsContact O-N 3.13Å; Q98-L101 PolarHBondContact O-N 3.43Å; L101-R105 PolarHBondContact O-N 3.37Å; L101-R105 VanDerWaalsContact O-N 3.13Å
102	L	97.7	Very high	97.7	Very high	109 Å²	109	99.4 Å²	99.4	57%	0.571	52%	0.522	S	S	*	.	H	α-helix	trans	-66.8	-40.8	174.3	-174.3	63.5	0	0	0	111.9	Q98 G99 Q100 R105 V106	Q98-L102 PolarHBondContact O-N 2.92Å; Q98-L102 VanDerWaalsContact O-N 3.15Å; G99-L102 PolarHBondContact O-N 3.48Å; Q100-L102 VanDerWaalsContact C-N 3.27Å; Q100-L102 PolarHBondContact O-N 2.95Å; L102-R105 PolarHBondContact O-N 2.88Å; L102-V106 WeakPolarHBondContact O-CG2 3.44Å; L102-V106 PolarHBondContact O-N 3.47Å
103	L	97.7	Very high	97.7	Very high	110 Å²	110	97.6 Å²	97.6	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-63.5	-42.3	176	-72.7	173.5	0	0	0	111.9	G99 Q100 R105 V106 S107	G99-L103 WeakPolarHBondContact O-CG 3.41Å; G99-L103 PolarHBondContact O-N 3.2Å; Q100-L103 WeakPolarHBondContact O-CB 3.44Å; Q100-L103 PolarHBondContact O-N 3.22Å; Q100-L103 VanDerWaalsContact O-N 3.09Å; L103-R105 VanDerWaalsContact C-N 3.31Å; L103-R105 PolarHBondContact O-N 3.23Å; L103-V106 PolarHBondContact O-N 2.96Å; L103-V106 VanDerWaalsContact O-N 3.16Å; L103-S107 PolarHBondContact O-N 3.41Å
104	D	97.7	Very high	97.6	Very high	82 Å²	82	95.4 Å²	95.4	44%	0.439	51%	0.505	S	S	.	.	H	α-helix	trans	-60.2	-44	176.5	-64.3	-14.7	0	0	0	110.4	Q100 V106 S107 D108	Q100-D104 PolarHBondContact NE2-OD1 3.47Å; Q100-D104 VanDerWaalsContact O-CG 3.26Å; Q100-D104 PolarHBondContact O-N 3.05Å; D104-V106 VanDerWaalsContact C-N 3.35Å; D104-V106 PolarHBondContact O-N 2.92Å; D104-S107 WeakPolarHBondContact O-CA 3.4Å; D104-S107 VanDerWaalsContact O-CB 3.29Å; D104-S107 WeakPolarHBondContact O-CB 3.44Å; D104-S107 PolarHBondContact O-N 2.89Å; D104-S107 VanDerWaalsContact O-N 3.13Å; D104-D108 PolarHBondContact O-N 3.17Å
105	R	97.5	Very high	97.5	Very high	176 Å²	176	95.6 Å²	95.6	66%	0.664	51%	0.506	S	S	*	.	H	α-helix	trans	-63.7	-37.7	175.6	-176.1	176.9	180	179.8	1	113	L101 L102 L103 S107 V109	L101-R105 PolarHBondContact O-N 3.37Å; L101-R105 VanDerWaalsContact O-N 3.13Å; L102-R105 PolarHBondContact O-N 2.88Å; L103-R105 VanDerWaalsContact C-N 3.31Å; L103-R105 PolarHBondContact O-N 3.23Å; R105-S107 VanDerWaalsContact C-N 3.33Å; R105-V109 WeakPolarHBondContact O-CG2 3.47Å; R105-V109 PolarHBondContact O-N 2.94Å
106	V	97.7	Very high	97.4	Very high	73 Å²	73	93.4 Å²	93.4	44%	0.442	49%	0.492	S	S	.	.	H	α-helix	trans	-66	-40.1	174.4	170.5	0	0	0	0	110.1	L102 L103 D104 V109 I110	L102-V106 WeakPolarHBondContact O-CG2 3.44Å; L102-V106 PolarHBondContact O-N 3.47Å; L103-V106 PolarHBondContact O-N 2.96Å; L103-V106 VanDerWaalsContact O-N 3.16Å; D104-V106 VanDerWaalsContact C-N 3.35Å; D104-V106 PolarHBondContact O-N 2.92Å; V106-V109 PolarHBondContact O-N 3.08Å; V106-I110 HydrophobicContact CG1-CD1 3.97Å; V106-I110 WeakPolarHBondContact O-CG1 3.48Å; V106-I110 PolarHBondContact O-N 2.9Å
107	S	97	Very high	97.3	Very high	58 Å²	58	94.8 Å²	94.8	41%	0.406	49%	0.492	S	S	.	.	H	α-helix	trans	-59.6	-47.2	174.9	-161.5	0	0	0	0	111.6	L103 D104 R105 V109 I110 D111	L103-S107 PolarHBondContact O-N 3.41Å; D104-S107 WeakPolarHBondContact O-CA 3.4Å; D104-S107 VanDerWaalsContact O-CB 3.29Å; D104-S107 WeakPolarHBondContact O-CB 3.44Å; D104-S107 PolarHBondContact O-N 2.89Å; D104-S107 VanDerWaalsContact O-N 3.13Å; R105-S107 VanDerWaalsContact C-N 3.33Å; S107-V109 VanDerWaalsContact C-N 3.26Å; S107-V109 PolarHBondContact O-N 2.73Å; S107-I110 PolarHBondContact O-N 3.44Å; S107-I110 VanDerWaalsContact O-N 3.09Å; S107-D111 PolarHBondContact O-N 3.38Å
108	D	97.6	Very high	97.1	Very high	109 Å²	109	97.1 Å²	97.1	58%	0.583	49%	0.493	S	S	*	.	H	α-helix	trans	-57.9	-39.2	177.5	-69.8	-23.3	0	0	0	112.3	D104 Y112	D104-D108 PolarHBondContact O-N 3.17Å; D108-Y112 WeakPolarHBondContact O-CB 3.13Å; D108-Y112 PolarHBondContact O-N 3.46Å
109	V	97.6	Very high	96.9	Very high	79 Å²	79	97.2 Å²	97.2	48%	0.479	49%	0.493	S	S	.	.	H	α-helix	trans	-68.4	-40.4	177.5	172.2	0	0	0	0	111.1	R105 V106 S107 Y112 I113	R105-V109 WeakPolarHBondContact O-CG2 3.47Å; R105-V109 PolarHBondContact O-N 2.94Å; V106-V109 PolarHBondContact O-N 3.08Å; S107-V109 VanDerWaalsContact C-N 3.26Å; S107-V109 PolarHBondContact O-N 2.73Å; V109-Y112 PolarHBondContact O-N 3.25Å; V109-I113 HydrophobicContact CG1-CD1 3.93Å; V109-I113 VanDerWaalsContact O-CG1 3.25Å; V109-I113 WeakPolarHBondContact O-CG1 3.23Å; V109-I113 PolarHBondContact O-N 3.31Å
110	I	97.3	Very high	96.7	Very high	85 Å²	85	98.7 Å²	98.7	44%	0.436	49%	0.493	S	S	.	.	H	α-helix	trans	-62.8	-47.9	175.7	-68.3	167.8	0	0	0	110	V106 S107 Y112 I113 D114	V106-I110 HydrophobicContact CG1-CD1 3.97Å; V106-I110 WeakPolarHBondContact O-CG1 3.48Å; V106-I110 PolarHBondContact O-N 2.9Å; S107-I110 PolarHBondContact O-N 3.44Å; S107-I110 VanDerWaalsContact O-N 3.09Å; I110-Y112 VanDerWaalsContact C-N 3.28Å; I110-Y112 PolarHBondContact O-N 2.99Å; I110-I113 WeakPolarHBondContact O-CB 3.16Å; I110-I113 PolarHBondContact O-N 2.85Å; I110-I113 VanDerWaalsContact O-N 3.1Å; I110-D114 PolarHBondContact O-N 3.39Å
111	D	97.4	Very high	96.5	Very high	79 Å²	79	96.6 Å²	96.6	42%	0.422	49%	0.493	S	S	.	.	H	α-helix	trans	-60.7	-38.5	178.5	-73.1	-20.8	0	0	0	111.9	S107 D114 Q115	S107-D111 PolarHBondContact O-N 3.38Å; D111-D114 PolarHBondContact O-N 3.34Å; D111-Q115 VanDerWaalsContact O-CG 3.27Å; D111-Q115 WeakPolarHBondContact O-CG 3.29Å; D111-Q115 PolarHBondContact O-N 3.34Å
112	Y	97.5	Very high	96.2	Very high	151 Å²	151	96.3 Å²	96.3	59%	0.592	49%	0.486	S	S	*	.	H	α-helix	trans	-65.1	-43.9	174.1	178.3	-103.4	0	0	0	112.3	D108 V109 I110 D114 Q115 V116	D108-Y112 WeakPolarHBondContact O-CB 3.13Å; D108-Y112 PolarHBondContact O-N 3.46Å; V109-Y112 PolarHBondContact O-N 3.25Å; I110-Y112 VanDerWaalsContact C-N 3.28Å; I110-Y112 PolarHBondContact O-N 2.99Å; Y112-D114 VanDerWaalsContact C-N 3.31Å; Y112-D114 PolarHBondContact O-N 2.92Å; Y112-Q115 PolarHBondContact O-N 2.87Å; Y112-V116 HydrophobicContact CD1-CG2 4.27Å; Y112-V116 HydrophobicContact CD2-CG2 4.35Å; Y112-V116 HydrophobicContact CE1-CG2 3.81Å; Y112-V116 HydrophobicContact CE2-CG2 3.9Å; Y112-V116 WeakPolarHBondContact O-CG2 3.37Å; Y112-V116 PolarHBondContact O-N 2.94Å
113	I	96.6	Very high	95.8	Very high	75 Å²	75	96.5 Å²	96.5	39%	0.385	49%	0.486	S	S	.	.	H	α-helix	trans	-59.1	-46.2	176.1	-71.4	165.3	0	0	0	109.9	V109 I110 Q115 V116 Q117	V109-I113 HydrophobicContact CG1-CD1 3.93Å; V109-I113 VanDerWaalsContact O-CG1 3.25Å; V109-I113 WeakPolarHBondContact O-CG1 3.23Å; V109-I113 PolarHBondContact O-N 3.31Å; I110-I113 WeakPolarHBondContact O-CB 3.16Å; I110-I113 PolarHBondContact O-N 2.85Å; I110-I113 VanDerWaalsContact O-N 3.1Å; I113-Q115 PolarHBondContact O-N 2.92Å; I113-V116 PolarHBondContact O-N 3.45Å; I113-Q117 HydrophobicContact CG2-CG 4.3Å; I113-Q117 WeakPolarHBondContact O-CB 3.47Å; I113-Q117 VanDerWaalsContact O-CG 3.29Å; I113-Q117 WeakPolarHBondContact O-CG 3.35Å; I113-Q117 PolarHBondContact O-N 3.47Å
114	D	96.3	Very high	95.4	Very high	91 Å²	91	100 Å²	100	49%	0.487	49%	0.491	S	S	.	.	H	α-helix	trans	-62	-42.6	179.3	-75.5	-7.6	0	0	0	111.7	I110 D111 Y112 Q117 H118	I110-D114 PolarHBondContact O-N 3.39Å; D111-D114 PolarHBondContact O-N 3.34Å; Y112-D114 VanDerWaalsContact C-N 3.31Å; Y112-D114 PolarHBondContact O-N 2.92Å; D114-Q117 PolarHBondContact O-N 3.43Å; D114-H118 WeakPolarHBondContact O-CB 3.49Å; D114-H118 PolarHBondContact O-N 3.29Å
115	Q	96.5	Very high	94.8	Very high	119 Å²	119	100.1 Å²	100.1	56%	0.556	50%	0.504	S	S	*	.	H	α-helix	trans	-62.1	-45.8	175.3	-73.7	174.3	33	0	0	112.4	D111 Y112 I113 H118 Q119	D111-Q115 VanDerWaalsContact O-CG 3.27Å; D111-Q115 WeakPolarHBondContact O-CG 3.29Å; D111-Q115 PolarHBondContact O-N 3.34Å; Y112-Q115 PolarHBondContact O-N 2.87Å; I113-Q115 PolarHBondContact O-N 2.92Å; Q115-H118 PolarHBondContact O-N 2.9Å; Q115-Q119 WeakPolarHBondContact O-CG 3.14Å; Q115-Q119 PolarHBondContact O-N 3.42Å
116	V	96.2	Very high	93.9	Very high	44 Å²	44	99.3 Å²	99.3	27%	0.267	51%	0.507	S	S	.	.	H	α-helix	trans	-63.6	-43.9	178.1	170.4	0	0	0	0	110.7	Y112 I113 H118 Q119 I120	Y112-V116 HydrophobicContact CD1-CG2 4.27Å; Y112-V116 HydrophobicContact CD2-CG2 4.35Å; Y112-V116 HydrophobicContact CE1-CG2 3.81Å; Y112-V116 HydrophobicContact CE2-CG2 3.9Å; Y112-V116 WeakPolarHBondContact O-CG2 3.37Å; Y112-V116 PolarHBondContact O-N 2.94Å; I113-V116 PolarHBondContact O-N 3.45Å; V116-H118 VanDerWaalsContact C-N 3.33Å; V116-H118 PolarHBondContact O-N 3.45Å; V116-Q119 PolarHBondContact O-N 3.49Å; V116-I120 HydrophobicContact CG1-CD1 3.8Å; V116-I120 HydrophobicContact CG1-CG1 4.42Å; V116-I120 VanDerWaalsContact O-CG1 3.3Å; V116-I120 WeakPolarHBondContact O-CG1 3.37Å; V116-I120 PolarHBondContact O-N 3.39Å
117	Q	94.9	Very high	92.3	Very high	118 Å²	118	102.6 Å²	102.6	55%	0.551	52%	0.518	S	S	*	.	H	α-helix	trans	-61.9	-41.1	176.8	-73.1	-178	11.1	0	0	111.8	I113 D114 I120 A121	I113-Q117 HydrophobicContact CG2-CG 4.3Å; I113-Q117 WeakPolarHBondContact O-CB 3.47Å; I113-Q117 VanDerWaalsContact O-CG 3.29Å; I113-Q117 WeakPolarHBondContact O-CG 3.35Å; I113-Q117 PolarHBondContact O-N 3.47Å; D114-Q117 PolarHBondContact O-N 3.43Å; Q117-I120 PolarHBondContact O-N 2.92Å; Q117-A121 WeakPolarHBondContact O-CB 3.17Å; Q117-A121 PolarHBondContact O-N 3.48Å
118	H	94.5	Very high	90.4	Very high	109 Å²	109	105.1 Å²	105.1	51%	0.505	53%	0.533	S	S	.	.	H	α-helix	trans	-65.3	-39.6	176.1	-171.7	68.1	0	0	0	112.6	D114 Q115 V116 A121 K122	D114-H118 WeakPolarHBondContact O-CB 3.49Å; D114-H118 PolarHBondContact O-N 3.29Å; Q115-H118 PolarHBondContact O-N 2.9Å; V116-H118 VanDerWaalsContact C-N 3.33Å; V116-H118 PolarHBondContact O-N 3.45Å; H118-A121 PolarHBondContact O-N 3.11Å; H118-K122 WeakPolarHBondContact NE2-CE 3.47Å; H118-K122 PolarHBondContact NE2-NZ 3.47Å; H118-K122 WeakPolarHBondContact O-CG 3.36Å; H118-K122 PolarHBondContact O-N 3.35Å
119	Q	94.7	Very high	88.5	Confident	119 Å²	119	108.4 Å²	108.4	56%	0.556	55%	0.55	S	S	*	.	H	α-helix	trans	-64.5	-44.5	174.1	-74.1	-179.8	-5.7	0	0	112	Q115 V116 A121 K122 M123	Q115-Q119 WeakPolarHBondContact O-CG 3.14Å; Q115-Q119 PolarHBondContact O-N 3.42Å; V116-Q119 PolarHBondContact O-N 3.49Å; Q119-A121 VanDerWaalsContact C-N 3.32Å; Q119-A121 PolarHBondContact O-N 3.05Å; Q119-K122 PolarHBondContact O-N 3.49Å; Q119-M123 WeakPolarHBondContact O-CG 3.44Å; Q119-M123 PolarHBondContact O-N 2.77Å
120	I	93.5	Very high	86	Confident	64 Å²	64	117 Å²	117	33%	0.328	59%	0.585	S	S	.	*	H	α-helix	trans	-59.6	-44	175.8	-68.9	167.5	0	0	0	110.8	V116 Q117 K122 M123 R124	V116-I120 HydrophobicContact CG1-CD1 3.8Å; V116-I120 HydrophobicContact CG1-CG1 4.42Å; V116-I120 VanDerWaalsContact O-CG1 3.3Å; V116-I120 WeakPolarHBondContact O-CG1 3.37Å; V116-I120 PolarHBondContact O-N 3.39Å; Q117-I120 PolarHBondContact O-N 2.92Å; I120-K122 VanDerWaalsContact C-N 3.33Å; I120-K122 PolarHBondContact O-N 2.76Å; I120-M123 HydrophobicContact CG1-CE 4.12Å; I120-M123 PolarHBondContact O-N 2.8Å; I120-R124 HydrophobicContact CG2-CG 4.49Å; I120-R124 WeakPolarHBondContact O-CG 3.27Å; I120-R124 PolarHBondContact O-N 3.34Å
121	A	92.4	Very high	85.5	Confident	55 Å²	55	118.7 Å²	118.7	46%	0.455	59%	0.592	S	S	.	*	H	α-helix	trans	-61.7	-40	177.1	0	0	0	0	0	112.4	Q117 H118 Q119 A125	Q117-A121 WeakPolarHBondContact O-CB 3.17Å; Q117-A121 PolarHBondContact O-N 3.48Å; H118-A121 PolarHBondContact O-N 3.11Å; Q119-A121 VanDerWaalsContact C-N 3.32Å; Q119-A121 PolarHBondContact O-N 3.05Å; A121-A125 WeakPolarHBondContact O-CB 3.46Å; A121-A125 PolarHBondContact O-N 3.05Å; A121-A125 VanDerWaalsContact O-N 3.1Å
122	K	91.9	Very high	84.8	Confident	118 Å²	118	120.7 Å²	120.7	51%	0.513	60%	0.601	S	S	.	*	H	α-helix	trans	-64.7	-44.1	174.5	-77.6	179.4	173.1	165.6	0	112.7	H118 Q119 I120 A125 Q126	H118-K122 WeakPolarHBondContact NE2-CE 3.47Å; H118-K122 PolarHBondContact NE2-NZ 3.47Å; H118-K122 WeakPolarHBondContact O-CG 3.36Å; H118-K122 PolarHBondContact O-N 3.35Å; Q119-K122 PolarHBondContact O-N 3.49Å; I120-K122 VanDerWaalsContact C-N 3.33Å; I120-K122 PolarHBondContact O-N 2.76Å; K122-A125 PolarHBondContact O-N 3.38Å; K122-Q126 WeakPolarHBondContact O-CG 3.23Å; K122-Q126 PolarHBondContact O-N 3.06Å
123	M	89.4	Confident	84.1	Confident	113 Å²	113	119.1 Å²	119.1	56%	0.557	60%	0.602	S	S	*	*	H	α-helix	trans	-62.5	-44.3	178.1	-70.6	-174.8	-68.1	0	0	111.4	Q119 I120 A125 Q126 E127	Q119-M123 WeakPolarHBondContact O-CG 3.44Å; Q119-M123 PolarHBondContact O-N 2.77Å; I120-M123 HydrophobicContact CG1-CE 4.12Å; I120-M123 PolarHBondContact O-N 2.8Å; M123-A125 VanDerWaalsContact C-N 3.28Å; M123-A125 PolarHBondContact O-N 2.87Å; M123-Q126 PolarHBondContact O-N 3.48Å; M123-Q126 VanDerWaalsContact O-N 3.07Å; M123-E127 PolarHBondContact O-N 3.02Å
124	R	88.4	Confident	83.4	Confident	182 Å²	182	121.6 Å²	121.6	69%	0.687	61%	0.614	S	S	*	*	H	α-helix	trans	-63.6	-30.3	175.8	-71.6	-179.5	-176.3	174	2.3	113.6	I120 Q126	I120-R124 HydrophobicContact CG2-CG 4.49Å; I120-R124 WeakPolarHBondContact O-CG 3.27Å; I120-R124 PolarHBondContact O-N 3.34Å; R124-Q126 VanDerWaalsContact C-N 3.29Å
125	A	86.7	Confident	82.6	Confident	86 Å²	86	123.6 Å²	123.6	71%	0.711	62%	0.622	S	S	*	*	H	α-helix	trans	-76.4	-16.6	175.4	0	0	0	0	0	113.3	A121 K122 M123	A121-A125 WeakPolarHBondContact O-CB 3.46Å; A121-A125 PolarHBondContact O-N 3.05Å; A121-A125 VanDerWaalsContact O-N 3.1Å; K122-A125 PolarHBondContact O-N 3.38Å; M123-A125 VanDerWaalsContact C-N 3.28Å; M123-A125 PolarHBondContact O-N 2.87Å
126	Q	78.7	Confident	81.7	Confident	158 Å²	158	123.9 Å²	123.9	74%	0.738	63%	0.627	S	S	*	*	H	α-helix	trans	-99.4	-10.5	178.9	-71.3	-179	-15.6	0	0	113.5	K122 M123 R124 P128	K122-Q126 WeakPolarHBondContact O-CG 3.23Å; K122-Q126 PolarHBondContact O-N 3.06Å; M123-Q126 PolarHBondContact O-N 3.48Å; M123-Q126 VanDerWaalsContact O-N 3.07Å; R124-Q126 VanDerWaalsContact C-N 3.29Å; Q126-P128 VanDerWaalsContact O-CD 3.29Å; Q126-P128 WeakPolarHBondContact O-CD 3.33Å
127	E	63.4	Low	80.6	Confident	143 Å²	143	129.6 Å²	129.6	67%	0.668	65%	0.653	S	S	*	*	S	Bend	trans	-63.1	116.8	171	-90.7	174.7	156	0	0	109.3	M123 L129	M123-E127 PolarHBondContact O-N 3.02Å; E127-L129 PolarHBondContact O-N 2.94Å
128	P	57.4	Low	79.5	Confident	110 Å²	110	130.5 Å²	130.5	71%	0.714	66%	0.66	S	S	*	*			trans	-65.1	132.5	173.3	26.7	-29.6	0	0	0	108.3	Q126 E130	Q126-P128 VanDerWaalsContact O-CD 3.29Å; Q126-P128 WeakPolarHBondContact O-CD 3.33Å; P128-E130 VanDerWaalsContact C-N 3.33Å; P128-E130 PolarHBondContact O-N 3.11Å
129	L	57.6	Low	78.3	Confident	179 Å²	179	132.3 Å²	132.3	94%	0.937	67%	0.673	S	S	*	*			trans	-58.7	99.9	162.8	-76.2	136.3	0	0	0	107.1	E127	E127-L129 PolarHBondContact O-N 2.94Å
130	E	45.7	Very low	76.8	Confident	260 Å²	260	133.5 Å²	133.5	100%	1.215	68%	0.684	S	S	*	*			trans	-60.9	0	159.8	-70.6	-167.2	155.6	0	0	110.7	P128	P128-E130 VanDerWaalsContact C-N 3.33Å; P128-E130 PolarHBondContact O-N 3.11Å

Retrieved 130 of 130 residues in 134.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).