A0A077ZB06_TRITR Loading...

RAMP4 domain containing protein

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins.

AlphaFold DB , UniProt , Accession A0A077ZB06, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 65 aa.

						>A0A077ZB06_TRITR|A0A077ZB06
MPPKQRMRLANEFYSKNVTQRGNVAKTLKPQEDKYAAAPWLIGLFVFVVCGSAVFEIIRYVKMGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.6	Low	83.2	Confident	159 Å²	159	115.5 Å²	115.5	78%	0.783	57%	0.567	S	S	*	*				0	123.3	0	-63.7	174.4	-178	0	0	108.3	R6	M1-R6 HydrophobicContact CB-CG 4.16Å
2	P	80.7	Confident	83.3	Confident	80 Å²	80	112.5 Å²	112.5	52%	0.519	55%	0.551	S	S	.	*			trans	-52.7	143.4	176.2	-24.7	33.9	0	0	0	111.7	K4 Q5 R6	P2-K4 PolarHBondContact O-N 3Å; P2-K4 VanDerWaalsContact O-N 3.14Å; P2-Q5 WeakPolarHBondContact O-CB 3.3Å; P2-Q5 PolarHBondContact O-N 3.22Å; P2-R6 PolarHBondContact O-N 3.4Å
3	P	81.9	Confident	83.1	Confident	109 Å²	109	113.5 Å²	113.5	71%	0.708	55%	0.551	S	S	*	*	H	α-helix	trans	-51.7	-40	-177.7	-28.1	34.3	0	0	0	113.6	Q5 R6 M7	P3-Q5 VanDerWaalsContact C-N 3.28Å; P3-Q5 PolarHBondContact O-N 2.87Å; P3-R6 PolarHBondContact O-N 3.47Å; P3-M7 PolarHBondContact O-N 2.93Å
4	K	84.3	Confident	82.8	Confident	174 Å²	174	117.4 Å²	117.4	76%	0.757	56%	0.559	S	S	*	*	H	α-helix	trans	-61.6	-34.1	178.4	-153.1	175.7	-163.7	179.7	0	113	P2 R8	P2-K4 PolarHBondContact O-N 3Å; P2-K4 VanDerWaalsContact O-N 3.14Å; K4-R8 PolarHBondContact O-N 3.34Å
5	Q	84.4	Confident	82.6	Confident	107 Å²	107	114.3 Å²	114.3	50%	0.5	56%	0.555	S	S	.	*	H	α-helix	trans	-74.2	-38.4	-180	-165.8	175	3.1	0	0	111.7	P2 P3 R8 L9	P2-Q5 WeakPolarHBondContact O-CB 3.3Å; P2-Q5 PolarHBondContact O-N 3.22Å; P3-Q5 VanDerWaalsContact C-N 3.28Å; P3-Q5 PolarHBondContact O-N 2.87Å; Q5-R8 PolarHBondContact O-N 2.79Å; Q5-L9 PolarHBondContact O-N 2.79Å; Q5-L9 VanDerWaalsContact O-N 3.09Å
6	R	86.1	Confident	82.2	Confident	158 Å²	158	115 Å²	115	60%	0.596	55%	0.554	S	S	*	*	H	α-helix	trans	-61.7	-43.8	174.3	-71.8	-174.7	179.5	144.6	-2.5	111.7	M1 P2 P3 R8 L9 A10	M1-R6 HydrophobicContact CB-CG 4.16Å; P2-R6 PolarHBondContact O-N 3.4Å; P3-R6 PolarHBondContact O-N 3.47Å; R6-R8 PolarHBondContact O-N 2.86Å; R6-L9 PolarHBondContact O-N 3.35Å; R6-A10 WeakPolarHBondContact O-CB 3.15Å; R6-A10 PolarHBondContact O-N 2.83Å
7	M	86.6	Confident	81.5	Confident	116 Å²	116	113.9 Å²	113.9	57%	0.571	55%	0.552	S	S	*	*	H	α-helix	trans	-64.2	-40.1	178.8	-171.5	175.6	68.5	0	0	111.9	P3 A10 N11	P3-M7 PolarHBondContact O-N 2.93Å; M7-A10 PolarHBondContact O-N 3.48Å; M7-N11 WeakPolarHBondContact O-CB 3.35Å; M7-N11 PolarHBondContact O-N 3.38Å; M7-N11 PolarHBondContact O-OD1 3.29Å
8	R	86	Confident	80.9	Confident	159 Å²	159	112.4 Å²	112.4	60%	0.6	55%	0.55	S	S	*	*	H	α-helix	trans	-61.9	-46	175.6	-162.4	-177.2	83.4	-176.2	-3.9	111.5	K4 Q5 R6 A10 N11 E12	K4-R8 PolarHBondContact O-N 3.34Å; Q5-R8 PolarHBondContact O-N 2.79Å; R6-R8 PolarHBondContact O-N 2.86Å; R8-A10 VanDerWaalsContact C-N 3.34Å; R8-A10 PolarHBondContact O-N 3.41Å; R8-N11 PolarHBondContact O-N 2.82Å; R8-E12 IonicContact CZ-OE1 3.74Å; R8-E12 IonicContact NE-OE1 2.97Å; R8-E12 PolarHBondContact NE-OE1 3.17Å; R8-E12 IonicContact NH2-OE1 3.87Å; R8-E12 WeakPolarHBondContact O-CG 3.23Å; R8-E12 PolarHBondContact O-N 2.89Å
9	L	86.9	Confident	80.4	Confident	83 Å²	83	112.4 Å²	112.4	44%	0.435	56%	0.558	S	S	.	*	H	α-helix	trans	-61.9	-43.2	178.9	-152.3	76.8	0	0	0	111.3	Q5 R6 E12 F13	Q5-L9 PolarHBondContact O-N 2.79Å; Q5-L9 VanDerWaalsContact O-N 3.09Å; R6-L9 PolarHBondContact O-N 3.35Å; L9-E12 PolarHBondContact O-N 2.88Å; L9-F13 HydrophobicContact CD2-CE2 3.9Å; L9-F13 HydrophobicContact CG-CD2 4.3Å; L9-F13 HydrophobicContact CG-CE2 3.71Å; L9-F13 WeakPolarHBondContact O-CD2 3.12Å; L9-F13 PolarHBondContact O-N 3.49Å
10	A	85.7	Confident	79.6	Confident	35 Å²	35	113.2 Å²	113.2	29%	0.289	56%	0.56	S	S	.	*	H	α-helix	trans	-59.6	-48	174.6	0	0	0	0	0	111.6	R6 M7 R8 E12 F13 Y14	R6-A10 WeakPolarHBondContact O-CB 3.15Å; R6-A10 PolarHBondContact O-N 2.83Å; M7-A10 PolarHBondContact O-N 3.48Å; R8-A10 VanDerWaalsContact C-N 3.34Å; R8-A10 PolarHBondContact O-N 3.41Å; A10-E12 VanDerWaalsContact C-N 3.32Å; A10-E12 PolarHBondContact O-N 2.76Å; A10-F13 WeakPolarHBondContact O-CB 3.29Å; A10-F13 PolarHBondContact O-N 3.32Å; A10-F13 VanDerWaalsContact O-N 3.12Å; A10-Y14 HydrophobicContact CB-CD2 4.4Å; A10-Y14 HydrophobicContact CB-CE2 4.13Å; A10-Y14 WeakPolarHBondContact O-CD2 3.33Å; A10-Y14 PolarHBondContact O-N 3.19Å
11	N	86.7	Confident	78.9	Confident	90 Å²	90	117.2 Å²	117.2	48%	0.481	57%	0.569	S	S	.	*	H	α-helix	trans	-62.2	-38.3	177.7	-73.3	1.9	0	0	0	112.3	M7 R8 F13 Y14 S15	M7-N11 WeakPolarHBondContact O-CB 3.35Å; M7-N11 PolarHBondContact O-N 3.38Å; M7-N11 PolarHBondContact O-OD1 3.29Å; R8-N11 PolarHBondContact O-N 2.82Å; N11-F13 VanDerWaalsContact C-N 3.33Å; N11-Y14 PolarHBondContact O-N 3Å; N11-S15 VanDerWaalsContact O-CB 3.24Å; N11-S15 WeakPolarHBondContact O-CB 3.18Å; N11-S15 PolarHBondContact O-N 3.32Å; N11-S15 PolarHBondContact O-OG 2.96Å
12	E	85.3	Confident	78.8	Confident	80 Å²	80	112.7 Å²	112.7	37%	0.374	56%	0.563	S	S	.	*	H	α-helix	trans	-61.4	-40.8	173.6	-73.8	170.8	-155.8	0	0	111.3	R8 L9 A10 K16	R8-E12 IonicContact CZ-OE1 3.74Å; R8-E12 IonicContact NE-OE1 2.97Å; R8-E12 PolarHBondContact NE-OE1 3.17Å; R8-E12 IonicContact NH2-OE1 3.87Å; R8-E12 WeakPolarHBondContact O-CG 3.23Å; R8-E12 PolarHBondContact O-N 2.89Å; L9-E12 PolarHBondContact O-N 2.88Å; A10-E12 VanDerWaalsContact C-N 3.32Å; A10-E12 PolarHBondContact O-N 2.76Å; E12-K16 WeakPolarHBondContact O-CG 3.23Å; E12-K16 PolarHBondContact O-N 3.47Å
13	F	80.1	Confident	77.9	Confident	125 Å²	125	116.1 Å²	116.1	55%	0.548	58%	0.577	S	S	.	*	H	α-helix	trans	-65.8	-46.7	174.5	-73.9	-64.8	0	0	0	112.5	L9 A10 N11 S15 K16	L9-F13 HydrophobicContact CD2-CE2 3.9Å; L9-F13 HydrophobicContact CG-CD2 4.3Å; L9-F13 HydrophobicContact CG-CE2 3.71Å; L9-F13 WeakPolarHBondContact O-CD2 3.12Å; L9-F13 PolarHBondContact O-N 3.49Å; A10-F13 WeakPolarHBondContact O-CB 3.29Å; A10-F13 PolarHBondContact O-N 3.32Å; A10-F13 VanDerWaalsContact O-N 3.12Å; N11-F13 VanDerWaalsContact C-N 3.33Å; F13-S15 VanDerWaalsContact C-N 3.32Å; F13-S15 PolarHBondContact O-N 2.83Å; F13-K16 PolarHBondContact O-N 3.46Å
14	Y	78.4	Confident	77	Confident	168 Å²	168	116 Å²	116	66%	0.659	57%	0.574	S	S	*	*	H	α-helix	trans	-64.5	-36.9	178.1	-69.8	-64.7	0	0	0	112.4	A10 N11 K16 N17 V18	A10-Y14 HydrophobicContact CB-CD2 4.4Å; A10-Y14 HydrophobicContact CB-CE2 4.13Å; A10-Y14 WeakPolarHBondContact O-CD2 3.33Å; A10-Y14 PolarHBondContact O-N 3.19Å; N11-Y14 PolarHBondContact O-N 3Å; Y14-K16 VanDerWaalsContact C-N 3.31Å; Y14-K16 PolarHBondContact O-N 3.43Å; Y14-N17 PolarHBondContact O-N 3.36Å; Y14-V18 PolarHBondContact O-N 3.48Å
15	S	80.1	Confident	76.1	Confident	72 Å²	72	111 Å²	111	50%	0.503	57%	0.565	S	S	.	*	H	α-helix	trans	-66.2	-32.1	-179.3	-59.3	0	0	0	0	112.3	N11 F13 N17 V18	N11-S15 VanDerWaalsContact O-CB 3.24Å; N11-S15 WeakPolarHBondContact O-CB 3.18Å; N11-S15 PolarHBondContact O-N 3.32Å; N11-S15 PolarHBondContact O-OG 2.96Å; F13-S15 VanDerWaalsContact C-N 3.32Å; F13-S15 PolarHBondContact O-N 2.83Å; S15-N17 VanDerWaalsContact C-N 3.26Å; S15-N17 PolarHBondContact O-N 2.82Å; S15-V18 VanDerWaalsContact O-CG1 3.28Å; S15-V18 WeakPolarHBondContact O-CG1 2.94Å; S15-V18 PolarHBondContact O-N 2.88Å
16	K	76.8	Confident	75.3	Confident	125 Å²	125	115.9 Å²	115.9	54%	0.543	59%	0.585	S	S	.	*	H	α-helix	trans	-66.5	-27.2	176.2	-70.8	172.4	-174.4	-177.7	0	113.4	E12 F13 Y14 T19 Q20	E12-K16 WeakPolarHBondContact O-CG 3.23Å; E12-K16 PolarHBondContact O-N 3.47Å; F13-K16 PolarHBondContact O-N 3.46Å; Y14-K16 VanDerWaalsContact C-N 3.31Å; Y14-K16 PolarHBondContact O-N 3.43Å; K16-T19 PolarHBondContact O-OG1 2.8Å; K16-Q20 PolarHBondContact O-NE2 2.85Å; K16-Q20 VanDerWaalsContact O-NE2 3.17Å
17	N	70	Confident	74.4	Confident	96 Å²	96	111.4 Å²	111.4	51%	0.513	58%	0.575	S	S	.	*	H	α-helix	trans	-84.9	-17	179	-65.9	-12.7	0	0	0	111.8	Y14 S15 Q20 R21	Y14-N17 PolarHBondContact O-N 3.36Å; S15-N17 VanDerWaalsContact C-N 3.26Å; S15-N17 PolarHBondContact O-N 2.82Å; N17-Q20 CarbonylContact O-C 3.59Å; N17-Q20 PolarHBondContact O-N 3.26Å; N17-R21 PolarHBondContact O-N 2.89Å
18	V	70.3	Confident	73.4	Confident	87 Å²	87	114.7 Å²	114.7	53%	0.527	59%	0.594	S	S	.	*	H	α-helix	trans	-68.5	-38.1	179.5	97.7	0	0	0	0	111.9	Y14 S15 Q20 R21	Y14-V18 PolarHBondContact O-N 3.48Å; S15-V18 VanDerWaalsContact O-CG1 3.28Å; S15-V18 WeakPolarHBondContact O-CG1 2.94Å; S15-V18 PolarHBondContact O-N 2.88Å; V18-Q20 VanDerWaalsContact C-N 3.29Å; V18-R21 WeakPolarHBondContact O-CB 3.49Å; V18-R21 PolarHBondContact O-N 3.49Å
19	T	71.6	Confident	72.3	Confident	113 Å²	113	114.8 Å²	114.8	69%	0.693	60%	0.599	S	S	*	*	H	α-helix	trans	-71.1	-29.1	174.7	54.5	0	0	0	0	111.5	K16	K16-T19 PolarHBondContact O-OG1 2.8Å
20	Q	65.4	Low	71.1	Confident	128 Å²	128	116 Å²	116	60%	0.598	61%	0.612	S	S	*	*	H	α-helix	trans	-79.3	-15.3	176.4	-67.3	-178.6	69.4	0	0	113.9	K16 N17 V18 G22 N23	K16-Q20 PolarHBondContact O-NE2 2.85Å; K16-Q20 VanDerWaalsContact O-NE2 3.17Å; N17-Q20 CarbonylContact O-C 3.59Å; N17-Q20 PolarHBondContact O-N 3.26Å; V18-Q20 VanDerWaalsContact C-N 3.29Å; Q20-G22 PolarHBondContact O-N 3.47Å; Q20-N23 PolarHBondContact O-N 3.23Å; Q20-N23 VanDerWaalsContact O-N 3.08Å
21	R	64.8	Low	70	Confident	198 Å²	198	121.2 Å²	121.2	75%	0.747	63%	0.63	S	S	*	*	G	3₁₀ helix	trans	-56	-20.5	171.3	-81.6	-179.1	151.4	-166.1	-6.8	112.8	N17 V18 V24	N17-R21 PolarHBondContact O-N 2.89Å; V18-R21 WeakPolarHBondContact O-CB 3.49Å; V18-R21 PolarHBondContact O-N 3.49Å; R21-V24 WeakPolarHBondContact O-CG2 3.5Å
22	G	62.5	Low	68.8	Low	64 Å²	64	125.3 Å²	125.3	66%	0.66	65%	0.646	S	S	*	*	G	3₁₀ helix	trans	-81.8	-12.3	178.7	0	0	0	0	0	115.7	Q20 V24	Q20-G22 PolarHBondContact O-N 3.47Å; G22-V24 PolarHBondContact O-N 3.49Å
23	N	61.3	Low	67.6	Low	152 Å²	152	127.8 Å²	127.8	81%	0.813	66%	0.662	S	S	*	*	G	3₁₀ helix	trans	-88.4	19.7	176.9	-160.3	61	0	0	0	112.9	Q20 A25	Q20-N23 PolarHBondContact O-N 3.23Å; Q20-N23 VanDerWaalsContact O-N 3.08Å; N23-A25 PolarHBondContact O-N 2.85Å
24	V	64.5	Low	66.7	Low	106 Å²	106	130.9 Å²	130.9	64%	0.642	68%	0.675	S	S	*	*	S	Bend	trans	-70.1	122.8	167.9	-178	0	0	0	0	106.7	R21 G22 K26	R21-V24 WeakPolarHBondContact O-CG2 3.5Å; G22-V24 PolarHBondContact O-N 3.49Å; V24-K26 PolarHBondContact O-N 3.43Å
25	A	64	Low	65.9	Low	70 Å²	70	132.2 Å²	132.2	58%	0.579	68%	0.68	S	S	*	*			trans	-51.4	117	176.8	0	0	0	0	0	108.7	N23 T27	N23-A25 PolarHBondContact O-N 2.85Å; A25-T27 PolarHBondContact O-N 2.85Å
26	K	67.3	Low	65.4	Low	208 Å²	208	134.3 Å²	134.3	90%	0.904	70%	0.702	S	S	*	*	S	Bend	trans	-61.7	-12.8	-176.4	-65.9	-175.7	178.5	-178.4	0	113	V24	V24-K26 PolarHBondContact O-N 3.43Å
27	T	67.3	Low	65.1	Low	64 Å²	64	130 Å²	130	39%	0.393	69%	0.69	S	S	.	*			trans	-153	143.3	-175.9	176.2	0	0	0	0	109.6	A25 K29	A25-T27 PolarHBondContact O-N 2.85Å; T27-K29 HydrophobicContact CG2-CB 4.33Å; T27-K29 PolarHBondContact O-N 3.32Å; T27-K29 VanDerWaalsContact OG1-CB 3.29Å; T27-K29 WeakPolarHBondContact OG1-CB 3.34Å; T27-K29 WeakPolarHBondContact OG1-CG 3.21Å; T27-K29 PolarHBondContact OG1-N 2.95Å
28	L	66.8	Low	65.6	Low	185 Å²	185	127.8 Å²	127.8	97%	0.969	69%	0.685	S	S	*	*	S	Bend	trans	-72.7	-14	168.9	-67.5	170.9	0	0	0	111.9
29	K	62.8	Low	66.3	Low	162 Å²	162	129.2 Å²	129.2	70%	0.704	70%	0.696	S	S	*	*	S	Bend	trans	-65.6	128.2	173.4	-58.7	-175.4	179.2	-169.8	0	107.3	T27 Q31	T27-K29 HydrophobicContact CG2-CB 4.33Å; T27-K29 PolarHBondContact O-N 3.32Å; T27-K29 VanDerWaalsContact OG1-CB 3.29Å; T27-K29 WeakPolarHBondContact OG1-CB 3.34Å; T27-K29 WeakPolarHBondContact OG1-CG 3.21Å; T27-K29 PolarHBondContact OG1-N 2.95Å; K29-Q31 PolarHBondContact O-N 3.22Å; K29-Q31 VanDerWaalsContact O-N 3.1Å
30	P	61.9	Low	67.2	Low	108 Å²	108	132.5 Å²	132.5	70%	0.701	70%	0.696	S	S	*	*			trans	-51.3	125.6	173.5	21.8	-30.5	0	0	0	107.4	E32	P30-E32 PolarHBondContact O-N 3.44Å
31	Q	62	Low	68.4	Low	145 Å²	145	130.5 Å²	130.5	68%	0.678	69%	0.689	S	S	*	*			trans	-62.8	105.1	175.8	-81.9	-165	80.1	0	0	107.1	K29 D33	K29-Q31 PolarHBondContact O-N 3.22Å; K29-Q31 VanDerWaalsContact O-N 3.1Å; Q31-D33 PolarHBondContact O-N 2.86Å; Q31-D33 VanDerWaalsContact O-N 3.12Å
32	E	62.1	Low	69.6	Low	175 Å²	175	124.5 Å²	124.5	82%	0.818	67%	0.671	S	S	*	*			trans	-66.1	-5.8	176.5	-65.1	179	168	0	0	111.7	P30 K34	P30-E32 PolarHBondContact O-N 3.44Å; E32-K34 VanDerWaalsContact C-N 3.34Å; E32-K34 PolarHBondContact O-N 3.08Å
33	D	58.8	Low	71	Confident	132 Å²	132	123.4 Å²	123.4	71%	0.706	66%	0.66	S	S	*	*			trans	-85	10.9	-160.9	-65.7	-50.5	0	0	0	116.8	Q31	Q31-D33 PolarHBondContact O-N 2.86Å; Q31-D33 VanDerWaalsContact O-N 3.12Å
34	K	61	Low	72.6	Confident	191 Å²	191	119.7 Å²	119.7	83%	0.83	64%	0.639	S	S	*	*	S	Bend	trans	-129.6	101.7	161.9	-76.4	-178.4	179.7	175.2	0	106.3	E32 A36	E32-K34 VanDerWaalsContact C-N 3.34Å; E32-K34 PolarHBondContact O-N 3.08Å; K34-A36 PolarHBondContact O-N 2.8Å; K34-A36 VanDerWaalsContact O-N 3.08Å
35	Y	62.8	Low	74	Confident	195 Å²	195	121.2 Å²	121.2	77%	0.765	64%	0.638	S	S	*	*			trans	-26.2	120.4	161.4	-73.1	-88.8	0	0	0	108.7	A37 I42	Y35-A37 WeakPolarHBondContact CB-O 3.44Å; Y35-A37 CarbonylContact O-C 3.37Å; Y35-A37 PolarHBondContact O-N 3.03Å; Y35-A37 VanDerWaalsContact O-O 3.11Å; Y35-I42 HydrophobicContact CD1-CD1 4.4Å
36	A	68.3	Low	75.4	Confident	116 Å²	116	121.5 Å²	121.5	96%	0.959	63%	0.632	S	S	*	*	S	Bend	trans	-53	-23.9	-174.4	0	0	0	0	0	111.8	K34	K34-A36 PolarHBondContact O-N 2.8Å; K34-A36 VanDerWaalsContact O-N 3.08Å
37	A	70.5	Confident	76.6	Confident	34 Å²	34	118 Å²	118	28%	0.281	62%	0.617	S	S	.	*	S	Bend	trans	-98.9	129.8	170.2	0	0	0	0	0	112.1	Y35 L41 I42	Y35-A37 WeakPolarHBondContact CB-O 3.44Å; Y35-A37 CarbonylContact O-C 3.37Å; Y35-A37 PolarHBondContact O-N 3.03Å; Y35-A37 VanDerWaalsContact O-O 3.11Å; A37-L41 HydrophobicContact CB-CB 4.16Å; A37-I42 HydrophobicContact CB-CD1 4.29Å; A37-I42 HydrophobicContact CB-CG1 3.74Å
38	A	81.4	Confident	77.9	Confident	50 Å²	50	119 Å²	119	41%	0.413	62%	0.622	S	S	.	*			trans	-55.4	146.4	168	0	0	0	0	0	110.7	W40 L41 I42	A38-W40 PolarHBondContact O-N 3.1Å; A38-L41 HydrophobicContact CB-CD1 4.42Å; A38-L41 HydrophobicContact CB-CG 4.42Å; A38-L41 WeakPolarHBondContact O-CA 3.32Å; A38-L41 WeakPolarHBondContact O-CB 3.5Å; A38-L41 PolarHBondContact O-N 2.89Å; A38-I42 PolarHBondContact O-N 3.12Å
39	P	86.1	Confident	79.2	Confident	117 Å²	117	113.8 Å²	113.8	76%	0.76	60%	0.598	S	S	*	*	H	α-helix	trans	-50.6	-35	178.9	-29.7	35.3	0	0	0	114	I42 G43	P39-I42 PolarHBondContact O-N 3.2Å; P39-G43 PolarHBondContact O-N 2.99Å
40	W	89	Confident	80.7	Confident	183 Å²	183	109.6 Å²	109.6	69%	0.693	59%	0.589	S	S	*	*	H	α-helix	trans	-59.2	-44.8	172.2	147.3	-99.8	0	0	0	113.2	A38 G43 L44	A38-W40 PolarHBondContact O-N 3.1Å; W40-G43 PolarHBondContact O-N 3.34Å; W40-L44 HydrophobicContact CH2-CD1 3.9Å; W40-L44 HydrophobicContact CZ2-CD1 3.55Å; W40-L44 WeakPolarHBondContact O-CB 3.01Å; W40-L44 PolarHBondContact O-N 3.01Å
41	L	90.6	Very high	82.1	Confident	86 Å²	86	105 Å²	105	45%	0.45	56%	0.56	S	S	.	*	H	α-helix	trans	-67	-39.4	-179.7	-71	175.1	0	0	0	111.2	A37 A38 L44 F45	A37-L41 HydrophobicContact CB-CB 4.16Å; A38-L41 HydrophobicContact CB-CD1 4.42Å; A38-L41 HydrophobicContact CB-CG 4.42Å; A38-L41 WeakPolarHBondContact O-CA 3.32Å; A38-L41 WeakPolarHBondContact O-CB 3.5Å; A38-L41 PolarHBondContact O-N 2.89Å; L41-L44 PolarHBondContact O-N 3.35Å; L41-F45 VanDerWaalsContact O-CB 3.28Å; L41-F45 WeakPolarHBondContact O-CB 3.31Å; L41-F45 PolarHBondContact O-N 3.17Å
42	I	90.3	Very high	83.6	Confident	71 Å²	71	101.2 Å²	101.2	36%	0.364	55%	0.55	S	S	.	*	H	α-helix	trans	-64.2	-45.1	175	-58.4	176.4	0	0	0	109.8	Y35 A37 A38 P39 L44 F45 V46	Y35-I42 HydrophobicContact CD1-CD1 4.4Å; A37-I42 HydrophobicContact CB-CD1 4.29Å; A37-I42 HydrophobicContact CB-CG1 3.74Å; A38-I42 PolarHBondContact O-N 3.12Å; P39-I42 PolarHBondContact O-N 3.2Å; I42-L44 PolarHBondContact O-N 3.49Å; I42-F45 PolarHBondContact O-N 3.04Å; I42-V46 HydrophobicContact CG2-CG2 4.42Å; I42-V46 WeakPolarHBondContact O-CG2 3.31Å; I42-V46 PolarHBondContact O-N 3.27Å
43	G	92.7	Very high	85	Confident	42 Å²	42	95 Å²	95	43%	0.433	53%	0.529	S	S	.	.	H	α-helix	trans	-59.5	-45.4	175.6	0	0	0	0	0	112.7	P39 W40 V46 F47	P39-G43 PolarHBondContact O-N 2.99Å; W40-G43 PolarHBondContact O-N 3.34Å; G43-V46 PolarHBondContact O-N 3.23Å; G43-F47 VanDerWaalsContact O-CB 3.29Å; G43-F47 WeakPolarHBondContact O-CB 3.28Å; G43-F47 PolarHBondContact O-N 3.2Å
44	L	93.6	Very high	86.6	Confident	74 Å²	74	92.6 Å²	92.6	39%	0.387	52%	0.519	S	S	.	.	H	α-helix	trans	-60.6	-46.2	174.3	-175.4	157.9	0	0	0	110.9	W40 L41 I42 V46 F47 V48	W40-L44 HydrophobicContact CH2-CD1 3.9Å; W40-L44 HydrophobicContact CZ2-CD1 3.55Å; W40-L44 WeakPolarHBondContact O-CB 3.01Å; W40-L44 PolarHBondContact O-N 3.01Å; L41-L44 PolarHBondContact O-N 3.35Å; I42-L44 PolarHBondContact O-N 3.49Å; L44-V46 PolarHBondContact O-N 3.41Å; L44-F47 PolarHBondContact O-N 3.39Å; L44-V48 HydrophobicContact CD2-CG2 3.85Å; L44-V48 HydrophobicContact CG-CG2 4.48Å; L44-V48 VanDerWaalsContact O-CG2 3.31Å; L44-V48 WeakPolarHBondContact O-CG2 3.34Å; L44-V48 PolarHBondContact O-N 3.08Å
45	F	93.8	Very high	88	Confident	138 Å²	138	89.4 Å²	89.4	61%	0.605	51%	0.505	S	S	*	.	H	α-helix	trans	-60.2	-48.1	179.8	-177.5	-100.8	0	0	0	111.7	L41 I42 F47 V48 V49	L41-F45 VanDerWaalsContact O-CB 3.28Å; L41-F45 WeakPolarHBondContact O-CB 3.31Å; L41-F45 PolarHBondContact O-N 3.17Å; I42-F45 PolarHBondContact O-N 3.04Å; F45-F47 VanDerWaalsContact C-N 3.35Å; F45-F47 PolarHBondContact O-N 3.02Å; F45-V48 PolarHBondContact O-N 3.38Å; F45-V49 HydrophobicContact CD1-CG2 4.47Å; F45-V49 HydrophobicContact CD2-CG2 4.48Å; F45-V49 HydrophobicContact CE1-CG2 4.15Å; F45-V49 HydrophobicContact CE2-CG2 4.15Å; F45-V49 HydrophobicContact CZ-CG2 3.98Å; F45-V49 WeakPolarHBondContact O-CB 3.29Å; F45-V49 WeakPolarHBondContact O-CG2 3.41Å; F45-V49 PolarHBondContact O-N 3.01Å
46	V	93.5	Very high	89.3	Confident	76 Å²	76	86.9 Å²	86.9	46%	0.461	50%	0.5	S	S	.	.	H	α-helix	trans	-63.1	-41.1	176.3	174.2	0	0	0	0	111.2	I42 G43 L44 V49 C50	I42-V46 HydrophobicContact CG2-CG2 4.42Å; I42-V46 WeakPolarHBondContact O-CG2 3.31Å; I42-V46 PolarHBondContact O-N 3.27Å; G43-V46 PolarHBondContact O-N 3.23Å; L44-V46 PolarHBondContact O-N 3.41Å; V46-V49 PolarHBondContact O-N 3.4Å; V46-C50 VanDerWaalsContact O-CB 3.31Å; V46-C50 WeakPolarHBondContact O-CB 3.48Å; V46-C50 PolarHBondContact O-N 2.92Å
47	F	93.8	Very high	90.3	Very high	135 Å²	135	86.5 Å²	86.5	59%	0.592	48%	0.481	S	S	*	.	H	α-helix	trans	-63.7	-41.6	176.7	176.9	-99.4	0	0	0	112.2	G43 L44 F45 G51 F55	G43-F47 VanDerWaalsContact O-CB 3.29Å; G43-F47 WeakPolarHBondContact O-CB 3.28Å; G43-F47 PolarHBondContact O-N 3.2Å; L44-F47 PolarHBondContact O-N 3.39Å; F45-F47 VanDerWaalsContact C-N 3.35Å; F45-F47 PolarHBondContact O-N 3.02Å; F47-G51 WeakPolarHBondContact O-CA 3.46Å; F47-G51 PolarHBondContact O-N 3.44Å; F47-F55 HydrophobicContact CZ-CE2 4.28Å
48	V	94.7	Very high	91.3	Very high	83 Å²	83	89.4 Å²	89.4	50%	0.503	49%	0.491	S	S	.	.	H	α-helix	trans	-67.6	-45.6	177.9	171.4	0	0	0	0	110.7	L44 F45 S52	L44-V48 HydrophobicContact CD2-CG2 3.85Å; L44-V48 HydrophobicContact CG-CG2 4.48Å; L44-V48 VanDerWaalsContact O-CG2 3.31Å; L44-V48 WeakPolarHBondContact O-CG2 3.34Å; L44-V48 PolarHBondContact O-N 3.08Å; F45-V48 PolarHBondContact O-N 3.38Å; V48-S52 WeakPolarHBondContact O-CB 3.41Å; V48-S52 PolarHBondContact O-N 3.39Å; V48-S52 VanDerWaalsContact O-N 3.17Å; V48-S52 PolarHBondContact O-OG 3.22Å
49	V	94.2	Very high	91.6	Very high	76 Å²	76	94.6 Å²	94.6	46%	0.461	50%	0.5	S	S	.	.	H	α-helix	trans	-71.4	-56.2	-177.7	175.9	0	0	0	0	111.7	F45 V46 S52	F45-V49 HydrophobicContact CD1-CG2 4.47Å; F45-V49 HydrophobicContact CD2-CG2 4.48Å; F45-V49 HydrophobicContact CE1-CG2 4.15Å; F45-V49 HydrophobicContact CE2-CG2 4.15Å; F45-V49 HydrophobicContact CZ-CG2 3.98Å; F45-V49 WeakPolarHBondContact O-CB 3.29Å; F45-V49 WeakPolarHBondContact O-CG2 3.41Å; F45-V49 PolarHBondContact O-N 3.01Å; V46-V49 PolarHBondContact O-N 3.4Å; V49-S52 PolarHBondContact O-OG 3.35Å
50	C	94.4	Very high	91.9	Very high	75 Å²	75	96.3 Å²	96.3	51%	0.507	49%	0.492	S	S	.	.	H	α-helix	trans	-76.1	-37	-179.1	-71.8	0	0	0	0	112.3	V46 S52 A53 V54	V46-C50 VanDerWaalsContact O-CB 3.31Å; V46-C50 WeakPolarHBondContact O-CB 3.48Å; V46-C50 PolarHBondContact O-N 2.92Å; C50-S52 PolarHBondContact O-N 3.36Å; C50-A53 PolarHBondContact O-N 3.12Å; C50-V54 WeakPolarHBondContact O-CG2 3.43Å; C50-V54 PolarHBondContact O-N 2.85Å
51	G	90.8	Very high	92	Very high	10 Å²	10	92.7 Å²	92.7	10%	0.103	49%	0.49	C	S	.	.	H	α-helix	trans	-64	-40.1	179	0	0	0	0	0	111.7	F47 A53 V54 F55	F47-G51 WeakPolarHBondContact O-CA 3.46Å; F47-G51 PolarHBondContact O-N 3.44Å; G51-A53 PolarHBondContact O-N 3.02Å; G51-V54 PolarHBondContact O-N 2.67Å; G51-F55 WeakPolarHBondContact O-CB 3.36Å; G51-F55 WeakPolarHBondContact O-CD2 3.39Å; G51-F55 WeakPolarHBondContact O-CG 3.29Å; G51-F55 PolarHBondContact O-N 2.95Å
52	S	92.5	Very high	91.7	Very high	66 Å²	66	97.3 Å²	97.3	46%	0.462	51%	0.507	S	S	.	.	H	α-helix	trans	-59	-45.5	175.7	56.5	0	0	0	0	112.2	V48 V49 C50 V54 F55 E56	V48-S52 WeakPolarHBondContact O-CB 3.41Å; V48-S52 PolarHBondContact O-N 3.39Å; V48-S52 VanDerWaalsContact O-N 3.17Å; V48-S52 PolarHBondContact O-OG 3.22Å; V49-S52 PolarHBondContact O-OG 3.35Å; C50-S52 PolarHBondContact O-N 3.36Å; S52-V54 PolarHBondContact O-N 3.39Å; S52-F55 PolarHBondContact O-N 3.46Å; S52-E56 VanDerWaalsContact O-CB 3.29Å; S52-E56 WeakPolarHBondContact O-CB 2.98Å; S52-E56 PolarHBondContact O-N 3.48Å
53	A	92.1	Very high	91	Very high	46 Å²	46	99.9 Å²	99.9	38%	0.38	52%	0.518	S	S	.	.	H	α-helix	trans	-61.1	-43.2	174.9	0	0	0	0	0	112.1	C50 G51 E56 I57	C50-A53 PolarHBondContact O-N 3.12Å; G51-A53 PolarHBondContact O-N 3.02Å; A53-E56 PolarHBondContact O-N 2.93Å; A53-I57 VanDerWaalsContact O-CG1 3.23Å; A53-I57 WeakPolarHBondContact O-CG1 3.38Å; A53-I57 PolarHBondContact O-N 2.89Å
54	V	92.8	Very high	89.8	Confident	80 Å²	80	99.6 Å²	99.6	49%	0.485	52%	0.515	S	S	.	.	H	α-helix	trans	-63.7	-44.9	177.1	172.7	0	0	0	0	111.3	C50 G51 S52 E56 I57 I58	C50-V54 WeakPolarHBondContact O-CG2 3.43Å; C50-V54 PolarHBondContact O-N 2.85Å; G51-V54 PolarHBondContact O-N 2.67Å; S52-V54 PolarHBondContact O-N 3.39Å; V54-E56 VanDerWaalsContact C-N 3.33Å; V54-E56 PolarHBondContact O-N 3.4Å; V54-I57 PolarHBondContact O-N 3.25Å; V54-I58 HydrophobicContact CG1-CD1 3.67Å; V54-I58 HydrophobicContact CG1-CG1 4.38Å; V54-I58 WeakPolarHBondContact O-CB 3.28Å; V54-I58 WeakPolarHBondContact O-CG1 3.24Å; V54-I58 PolarHBondContact O-N 3.5Å
55	F	89.5	Confident	88	Confident	125 Å²	125	107.9 Å²	107.9	55%	0.548	55%	0.549	S	S	.	.	H	α-helix	trans	-65.8	-35.9	176.9	-73.3	-62.8	0	0	0	112.2	F47 G51 S52 R59	F47-F55 HydrophobicContact CZ-CE2 4.28Å; G51-F55 WeakPolarHBondContact O-CB 3.36Å; G51-F55 WeakPolarHBondContact O-CD2 3.39Å; G51-F55 WeakPolarHBondContact O-CG 3.29Å; G51-F55 PolarHBondContact O-N 2.95Å; S52-F55 PolarHBondContact O-N 3.46Å; F55-R59 WeakPolarHBondContact O-CB 3.47Å; F55-R59 PolarHBondContact O-N 3.33Å
56	E	89.8	Confident	87.7	Confident	141 Å²	141	106.4 Å²	106.4	66%	0.659	55%	0.546	S	S	*	.	H	α-helix	trans	-64.8	-45.7	175	-172.7	173.9	169.9	0	0	111.3	S52 A53 V54 R59 Y60	S52-E56 VanDerWaalsContact O-CB 3.29Å; S52-E56 WeakPolarHBondContact O-CB 2.98Å; S52-E56 PolarHBondContact O-N 3.48Å; A53-E56 PolarHBondContact O-N 2.93Å; V54-E56 VanDerWaalsContact C-N 3.33Å; V54-E56 PolarHBondContact O-N 3.4Å; E56-R59 PolarHBondContact O-N 3.31Å; E56-Y60 VanDerWaalsContact O-CB 3.3Å; E56-Y60 WeakPolarHBondContact O-CB 3.42Å; E56-Y60 PolarHBondContact O-N 2.97Å
57	I	91	Very high	87.4	Confident	109 Å²	109	107.9 Å²	107.9	56%	0.559	55%	0.55	S	S	*	*	H	α-helix	trans	-63	-46.4	175.3	-66	167.3	0	0	0	110.7	A53 V54 R59 Y60 V61	A53-I57 VanDerWaalsContact O-CG1 3.23Å; A53-I57 WeakPolarHBondContact O-CG1 3.38Å; A53-I57 PolarHBondContact O-N 2.89Å; V54-I57 PolarHBondContact O-N 3.25Å; I57-R59 VanDerWaalsContact C-N 3.29Å; I57-R59 PolarHBondContact O-N 3.29Å; I57-Y60 PolarHBondContact O-N 3.19Å; I57-V61 HydrophobicContact CG2-CG2 4.37Å; I57-V61 WeakPolarHBondContact O-CG2 3.48Å; I57-V61 PolarHBondContact O-N 3.33Å
58	I	90.3	Very high	87.1	Confident	94 Å²	94	106.4 Å²	106.4	48%	0.482	55%	0.548	S	S	.	.	H	α-helix	trans	-60.7	-42.9	177.4	-69.5	166.9	0	0	0	110.2	V54 K62	V54-I58 HydrophobicContact CG1-CD1 3.67Å; V54-I58 HydrophobicContact CG1-CG1 4.38Å; V54-I58 WeakPolarHBondContact O-CB 3.28Å; V54-I58 WeakPolarHBondContact O-CG1 3.24Å; V54-I58 PolarHBondContact O-N 3.5Å; I58-K62 WeakPolarHBondContact O-CB 2.96Å; I58-K62 PolarHBondContact O-N 2.93Å
59	R	88	Confident	86.6	Confident	160 Å²	160	107.8 Å²	107.8	60%	0.604	55%	0.551	S	S	*	*	H	α-helix	trans	-63.4	-43.8	176.7	-176.7	-177.9	177.3	175.5	1.1	110.9	F55 E56 I57 K62 M63	F55-R59 WeakPolarHBondContact O-CB 3.47Å; F55-R59 PolarHBondContact O-N 3.33Å; E56-R59 PolarHBondContact O-N 3.31Å; I57-R59 VanDerWaalsContact C-N 3.29Å; I57-R59 PolarHBondContact O-N 3.29Å; R59-K62 PolarHBondContact O-N 3.35Å; R59-M63 HydrophobicContact CG-CE 3.79Å; R59-M63 HydrophobicContact CG-CG 4.18Å; R59-M63 HydrophobicContact CG-SD 3.65Å; R59-M63 VanDerWaalsContact NE-CE 3.29Å; R59-M63 PolarHBondContact NE-SD 3.09Å; R59-M63 VanDerWaalsContact NE-SD 3.35Å; R59-M63 VanDerWaalsContact O-CB 3.23Å; R59-M63 WeakPolarHBondContact O-CB 3.49Å; R59-M63 WeakPolarHBondContact O-CG 3.36Å; R59-M63 PolarHBondContact O-N 3.38Å
60	Y	91.7	Very high	86.1	Confident	153 Å²	153	109.8 Å²	109.8	60%	0.6	56%	0.556	S	S	*	*	H	α-helix	trans	-62.3	-46.1	178.7	-176.5	-102.7	0	0	0	111.5	E56 I57 G64	E56-Y60 VanDerWaalsContact O-CB 3.3Å; E56-Y60 WeakPolarHBondContact O-CB 3.42Å; E56-Y60 PolarHBondContact O-N 2.97Å; I57-Y60 PolarHBondContact O-N 3.19Å; Y60-G64 PolarHBondContact O-N 3.2Å
61	V	91	Very high	85.6	Confident	107 Å²	107	112.1 Å²	112.1	65%	0.648	56%	0.56	S	S	*	*	H	α-helix	trans	-68.4	-38.9	177.4	175	0	0	0	0	111.7	I57 G64	I57-V61 HydrophobicContact CG2-CG2 4.37Å; I57-V61 WeakPolarHBondContact O-CG2 3.48Å; I57-V61 PolarHBondContact O-N 3.33Å; V61-G64 PolarHBondContact O-N 3.14Å
62	K	84.6	Confident	85.2	Confident	183 Å²	183	119.4 Å²	119.4	80%	0.796	59%	0.592	S	S	*	*	H	α-helix	trans	-75.2	-37.1	-179	-175.5	-177.3	172.4	75.4	0	112.9	I58 R59	I58-K62 WeakPolarHBondContact O-CB 2.96Å; I58-K62 PolarHBondContact O-N 2.93Å; R59-K62 PolarHBondContact O-N 3.35Å
63	M	77.4	Confident	84.6	Confident	124 Å²	124	123.5 Å²	123.5	61%	0.611	60%	0.602	S	S	*	*	H	α-helix	trans	-76.5	-18.7	175	-70.9	-175.6	177.3	0	0	111.5	R59	R59-M63 HydrophobicContact CG-CE 3.79Å; R59-M63 HydrophobicContact CG-CG 4.18Å; R59-M63 HydrophobicContact CG-SD 3.65Å; R59-M63 VanDerWaalsContact NE-CE 3.29Å; R59-M63 PolarHBondContact NE-SD 3.09Å; R59-M63 VanDerWaalsContact NE-SD 3.35Å; R59-M63 VanDerWaalsContact O-CB 3.23Å; R59-M63 WeakPolarHBondContact O-CB 3.49Å; R59-M63 WeakPolarHBondContact O-CG 3.36Å; R59-M63 PolarHBondContact O-N 3.38Å
64	G	66.8	Low	84	Confident	36 Å²	36	130 Å²	130	37%	0.371	62%	0.621	S	S	.	*			trans	61.7	173.1	-177.7	0	0	0	0	0	111.3	Y60 V61	Y60-G64 PolarHBondContact O-N 3.2Å; V61-G64 PolarHBondContact O-N 3.14Å
65	F	55.5	Low	83.2	Confident	248 Å²	248	134.5 Å²	134.5	100%	1.088	63%	0.633	S	S	*	*			trans	-56.1	0	140.1	-95.4	-95.8	0	0	0	110

Retrieved 65 of 65 residues in 44.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).