A0A077ZBF0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZBF0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 85 aa.

						>A0A077ZBF0_TRITR|A0A077ZBF0
MQNSMREEQGFPLMFDSWNAIGDELASMNNASAALPDKPEDAEAAAKAAGKKVIKDIVMFFVVAGLIEAGARMLGRDNLPGPSRL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.2	Very low	46.7	Very low	241 Å²	241	168 Å²	168	100%	1.187	83%	0.826	S	S	*	*				0	133.9	0	-81.8	177.5	171.7	0	0	108.2
2	Q	41.2	Very low	47.4	Very low	184 Å²	184	161.3 Å²	161.3	86%	0.86	81%	0.805	S	S	*	*			trans	64.8	93	168	-67.8	174.6	19.4	0	0	117.6	S4	Q2-S4 VanDerWaalsContact C-N 3.25Å; Q2-S4 PolarHBondContact O-N 3.18Å
3	N	49.5	Very low	48.3	Very low	158 Å²	158	159.7 Å²	159.7	85%	0.845	80%	0.799	S	S	*	*			trans	-54.9	94	142.7	-75.1	-19.4	0	0	0	107.7	M5	N3-M5 VanDerWaalsContact C-N 3.27Å; N3-M5 PolarHBondContact O-N 3.27Å
4	S	49.9	Very low	49.4	Very low	103 Å²	103	158.1 Å²	158.1	72%	0.72	79%	0.791	S	S	*	*			trans	-70.5	96.5	164.5	58.5	0	0	0	0	106.4	Q2 R6	Q2-S4 VanDerWaalsContact C-N 3.25Å; Q2-S4 PolarHBondContact O-N 3.18Å; S4-R6 PolarHBondContact O-N 3.46Å
5	M	50.9	Low	50.3	Low	166 Å²	166	158.2 Å²	158.2	82%	0.818	79%	0.785	S	S	*	*			trans	-49.2	91.6	151.9	-60.4	175.6	-144.7	0	0	105.5	N3 E7	N3-M5 VanDerWaalsContact C-N 3.27Å; N3-M5 PolarHBondContact O-N 3.27Å; M5-E7 PolarHBondContact O-N 2.78Å
6	R	47.6	Very low	51.2	Low	238 Å²	238	154.9 Å²	154.9	90%	0.898	77%	0.771	S	S	*	*			trans	-76.4	83.2	165.9	-151.8	177.4	-164.3	174.8	3.7	102.6	S4 E8	S4-R6 PolarHBondContact O-N 3.46Å; R6-E8 PolarHBondContact O-N 3.45Å; R6-E8 VanDerWaalsContact O-N 3.15Å
7	E	46.8	Very low	52	Low	162 Å²	162	149.1 Å²	149.1	76%	0.757	75%	0.748	S	S	*	*			trans	-36.8	122.7	170.2	-69.5	174.6	163.1	0	0	106.5	M5 Q9	M5-E7 PolarHBondContact O-N 2.78Å; E7-Q9 PolarHBondContact O-N 2.99Å
8	E	46.1	Very low	52.8	Low	192 Å²	192	151.4 Å²	151.4	90%	0.897	75%	0.747	S	S	*	*			trans	-47.4	92.9	162.6	-64.8	176.6	157.8	0	0	106	R6 G10	R6-E8 PolarHBondContact O-N 3.45Å; R6-E8 VanDerWaalsContact O-N 3.15Å; E8-G10 PolarHBondContact O-N 3.42Å
9	Q	46.1	Very low	53.8	Low	176 Å²	176	148.3 Å²	148.3	82%	0.822	73%	0.734	S	S	*	*			trans	-69.2	65.8	156.4	-71.7	-177.5	0	0	0	104.9	E7	E7-Q9 PolarHBondContact O-N 2.99Å
10	G	45.8	Very low	54.7	Low	48 Å²	48	143.8 Å²	143.8	50%	0.495	72%	0.721	S	S	.	*			trans	-48.5	148.3	153.5	0	0	0	0	0	106.2	E8 P12	E8-G10 PolarHBondContact O-N 3.42Å; G10-P12 WeakPolarHBondContact O-CD 3.16Å
11	F	48.2	Very low	55.6	Low	180 Å²	180	141.2 Å²	141.2	79%	0.789	71%	0.709	S	S	*	*			trans	-92	63.4	165.6	-81.7	-98.9	0	0	0	109.2	L13	F11-L13 PolarHBondContact O-N 3.25Å
12	P	55.8	Low	57.1	Low	88 Å²	88	131.3 Å²	131.3	57%	0.571	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	66.9	175.8	38.1	-35	0	0	0	109.2	G10	G10-P12 WeakPolarHBondContact O-CD 3.16Å
13	L	58.4	Low	58.7	Low	140 Å²	140	128.3 Å²	128.3	73%	0.733	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-147.4	-33.9	170.4	-71.1	178	0	0	0	112.8	F11 S17	F11-L13 PolarHBondContact O-N 3.25Å; L13-S17 WeakPolarHBondContact O-CB 3.16Å; L13-S17 PolarHBondContact O-OG 2.67Å
14	M	64.2	Low	59.7	Low	138 Å²	138	127.2 Å²	127.2	68%	0.68	65%	0.648	S	S	*	*	H	α-helix	trans	-80.6	-34.8	-175.1	-60.4	-63.8	-78.4	0	0	113.1	S17 W18	M14-S17 PolarHBondContact O-OG 3.41Å; M14-W18 PolarHBondContact O-N 2.96Å
15	F	63	Low	60.6	Low	159 Å²	159	127.5 Å²	127.5	70%	0.697	64%	0.641	S	S	*	*	H	α-helix	trans	-79.3	-39.9	-178.5	-78.9	-80.2	0	0	0	112.7	S17 W18 N19	F15-S17 VanDerWaalsContact C-N 3.32Å; F15-S17 PolarHBondContact O-N 3.42Å; F15-W18 WeakPolarHBondContact O-CB 3.38Å; F15-W18 PolarHBondContact O-N 3.29Å; F15-N19 PolarHBondContact O-N 2.87Å
16	D	64	Low	61.3	Low	106 Å²	106	121.9 Å²	121.9	57%	0.567	62%	0.621	S	S	*	*	H	α-helix	trans	-65.2	-37.8	177.7	-66.9	-28.4	0	0	0	111.8	N19 A20	D16-N19 PolarHBondContact O-N 3.33Å; D16-A20 WeakPolarHBondContact O-CB 3.17Å; D16-A20 PolarHBondContact O-N 2.86Å
17	S	64.9	Low	62.1	Low	55 Å²	55	114.2 Å²	114.2	39%	0.385	60%	0.604	S	S	.	*	H	α-helix	trans	-66.5	-38.1	173.9	52	0	0	0	0	112.3	L13 M14 F15 A20 I21	L13-S17 WeakPolarHBondContact O-CB 3.16Å; L13-S17 PolarHBondContact O-OG 2.67Å; M14-S17 PolarHBondContact O-OG 3.41Å; F15-S17 VanDerWaalsContact C-N 3.32Å; F15-S17 PolarHBondContact O-N 3.42Å; S17-A20 PolarHBondContact O-N 3.15Å; S17-I21 WeakPolarHBondContact O-CD1 3.35Å; S17-I21 WeakPolarHBondContact O-CG1 3.26Å; S17-I21 PolarHBondContact O-N 3.16Å
18	W	66.4	Low	62.9	Low	191 Å²	191	113 Å²	113	72%	0.723	60%	0.6	S	S	*	*	H	α-helix	trans	-63	-43.6	174	-172.4	-90.7	0	0	0	112.3	M14 F15 I21 G22	M14-W18 PolarHBondContact O-N 2.96Å; F15-W18 WeakPolarHBondContact O-CB 3.38Å; F15-W18 PolarHBondContact O-N 3.29Å; W18-I21 PolarHBondContact O-N 3.49Å; W18-G22 PolarHBondContact O-N 3.36Å
19	N	72.7	Confident	63.5	Low	92 Å²	92	108.8 Å²	108.8	49%	0.492	58%	0.584	S	S	.	*	H	α-helix	trans	-63.6	-44.5	176.6	-72.1	-21.3	0	0	0	111.6	F15 D16 I21 G22 D23	F15-N19 PolarHBondContact O-N 2.87Å; D16-N19 PolarHBondContact O-N 3.33Å; N19-I21 VanDerWaalsContact C-N 3.35Å; N19-I21 PolarHBondContact O-N 3.33Å; N19-G22 WeakPolarHBondContact O-CA 3.41Å; N19-G22 PolarHBondContact O-N 3.27Å; N19-G22 VanDerWaalsContact O-N 3.1Å; N19-D23 PolarHBondContact O-N 2.79Å
20	A	72.3	Confident	64.1	Low	59 Å²	59	107 Å²	107	49%	0.488	58%	0.58	S	S	.	*	H	α-helix	trans	-61.6	-41.4	177.8	0	0	0	0	0	112.6	D16 S17 G22 D23 E24	D16-A20 WeakPolarHBondContact O-CB 3.17Å; D16-A20 PolarHBondContact O-N 2.86Å; S17-A20 PolarHBondContact O-N 3.15Å; A20-G22 VanDerWaalsContact C-N 3.32Å; A20-D23 PolarHBondContact O-N 3.43Å; A20-E24 PolarHBondContact O-N 3.14Å
21	I	72.7	Confident	64.5	Low	90 Å²	90	108.7 Å²	108.7	46%	0.462	59%	0.589	S	S	.	*	H	α-helix	trans	-63.9	-40.2	174	-67.3	164.3	0	0	0	110.5	S17 W18 N19 E24 L25	S17-I21 WeakPolarHBondContact O-CD1 3.35Å; S17-I21 WeakPolarHBondContact O-CG1 3.26Å; S17-I21 PolarHBondContact O-N 3.16Å; W18-I21 PolarHBondContact O-N 3.49Å; N19-I21 VanDerWaalsContact C-N 3.35Å; N19-I21 PolarHBondContact O-N 3.33Å; I21-E24 PolarHBondContact O-N 2.96Å; I21-L25 HydrophobicContact CG2-CD1 3.85Å; I21-L25 HydrophobicContact CG2-CG 4.39Å; I21-L25 WeakPolarHBondContact O-CB 3.38Å; I21-L25 VanDerWaalsContact O-CG 3.27Å; I21-L25 WeakPolarHBondContact O-CG 3.4Å; I21-L25 PolarHBondContact O-N 3.43Å
22	G	72.5	Confident	64.9	Low	33 Å²	33	104.8 Å²	104.8	34%	0.34	58%	0.584	S	S	.	*	H	α-helix	trans	-60.7	-45.8	176.2	0	0	0	0	0	112.9	W18 N19 A20 L25 A26	W18-G22 PolarHBondContact O-N 3.36Å; N19-G22 WeakPolarHBondContact O-CA 3.41Å; N19-G22 PolarHBondContact O-N 3.27Å; N19-G22 VanDerWaalsContact O-N 3.1Å; A20-G22 VanDerWaalsContact C-N 3.32Å; G22-L25 PolarHBondContact O-N 3.14Å; G22-A26 WeakPolarHBondContact O-CB 3.35Å; G22-A26 PolarHBondContact O-N 3.5Å
23	D	74.9	Confident	64.7	Low	120 Å²	120	105.4 Å²	105.4	64%	0.642	60%	0.596	S	S	*	*	H	α-helix	trans	-65.6	-41.5	178.8	-73.6	-15.5	0	0	0	111.9	N19 A20 A26 S27	N19-D23 PolarHBondContact O-N 2.79Å; A20-D23 PolarHBondContact O-N 3.43Å; D23-A26 PolarHBondContact O-N 3.01Å; D23-S27 WeakPolarHBondContact O-CB 3.46Å; D23-S27 PolarHBondContact O-N 3.13Å
24	E	71.2	Confident	64.7	Low	135 Å²	135	102.6 Å²	102.6	63%	0.631	59%	0.593	S	S	*	*	H	α-helix	trans	-65.3	-43.3	176.6	-168.3	172.4	-168.9	0	0	111.4	A20 I21 A26 S27 M28	A20-E24 PolarHBondContact O-N 3.14Å; I21-E24 PolarHBondContact O-N 2.96Å; E24-A26 PolarHBondContact O-N 3.25Å; E24-S27 WeakPolarHBondContact O-CB 3.47Å; E24-S27 PolarHBondContact O-N 3.48Å; E24-M28 WeakPolarHBondContact O-CG 3.44Å; E24-M28 PolarHBondContact O-N 2.99Å
25	L	67.9	Low	64.4	Low	109 Å²	109	103.2 Å²	103.2	57%	0.571	60%	0.599	S	S	*	*	H	α-helix	trans	-63.1	-41.7	175.3	-75.3	170.4	0	0	0	112.1	I21 G22 M28 N29	I21-L25 HydrophobicContact CG2-CD1 3.85Å; I21-L25 HydrophobicContact CG2-CG 4.39Å; I21-L25 WeakPolarHBondContact O-CB 3.38Å; I21-L25 VanDerWaalsContact O-CG 3.27Å; I21-L25 WeakPolarHBondContact O-CG 3.4Å; I21-L25 PolarHBondContact O-N 3.43Å; G22-L25 PolarHBondContact O-N 3.14Å; L25-M28 PolarHBondContact O-N 3.39Å; L25-N29 WeakPolarHBondContact O-CB 3.44Å; L25-N29 PolarHBondContact O-N 2.89Å
26	A	65.1	Low	64.1	Low	48 Å²	48	98.5 Å²	98.5	40%	0.397	58%	0.584	S	S	.	*	H	α-helix	trans	-64.5	-41.9	176.6	0	0	0	0	0	111.8	G22 D23 E24 N29 N30	G22-A26 WeakPolarHBondContact O-CB 3.35Å; G22-A26 PolarHBondContact O-N 3.5Å; D23-A26 PolarHBondContact O-N 3.01Å; E24-A26 PolarHBondContact O-N 3.25Å; A26-N29 PolarHBondContact O-N 2.98Å; A26-N30 PolarHBondContact O-N 3.33Å
27	S	65.7	Low	64	Low	78 Å²	78	101.2 Å²	101.2	55%	0.545	60%	0.598	S	S	.	*	H	α-helix	trans	-58.7	-48.7	174.3	178.5	0	0	0	0	111.6	D23 E24 N29 N30 A31	D23-S27 WeakPolarHBondContact O-CB 3.46Å; D23-S27 PolarHBondContact O-N 3.13Å; E24-S27 WeakPolarHBondContact O-CB 3.47Å; E24-S27 PolarHBondContact O-N 3.48Å; S27-N29 VanDerWaalsContact C-N 3.3Å; S27-N29 PolarHBondContact O-N 3.43Å; S27-N30 PolarHBondContact O-N 3.09Å; S27-A31 WeakPolarHBondContact O-CB 3.35Å; S27-A31 PolarHBondContact O-N 3.11Å; S27-A31 VanDerWaalsContact O-N 3.13Å
28	M	63.3	Low	63.8	Low	137 Å²	137	104 Å²	104	68%	0.675	60%	0.603	S	S	*	*	H	α-helix	trans	-62.4	-35.9	177	-69.1	-176.4	80.2	0	0	112.8	E24 L25	E24-M28 WeakPolarHBondContact O-CG 3.44Å; E24-M28 PolarHBondContact O-N 2.99Å; L25-M28 PolarHBondContact O-N 3.39Å
29	N	59.6	Low	63.6	Low	103 Å²	103	100.4 Å²	100.4	55%	0.551	61%	0.605	S	S	*	*	H	α-helix	trans	-71.9	-31.4	-179.9	-133.3	12.5	0	0	0	112.3	L25 A26 S27 K52	L25-N29 WeakPolarHBondContact O-CB 3.44Å; L25-N29 PolarHBondContact O-N 2.89Å; A26-N29 PolarHBondContact O-N 2.98Å; S27-N29 VanDerWaalsContact C-N 3.3Å; S27-N29 PolarHBondContact O-N 3.43Å; N29-K52 PolarHBondContact OD1-NZ 2.79Å
30	N	58.1	Low	63.3	Low	139 Å²	139	102.3 Å²	102.3	74%	0.743	61%	0.611	S	S	*	*	H	α-helix	trans	-83.4	-20	179	-71.7	-18	0	0	0	113.4	A26 S27 S32	A26-N30 PolarHBondContact O-N 3.33Å; S27-N30 PolarHBondContact O-N 3.09Å; N30-S32 VanDerWaalsContact C-N 3.3Å; N30-S32 PolarHBondContact O-N 3.44Å
31	A	54.7	Low	63	Low	83 Å²	83	102.9 Å²	102.9	69%	0.686	61%	0.606	S	S	*	*	S	Bend	trans	-76.6	-0.5	-171.8	0	0	0	0	0	115.8	S27	S27-A31 WeakPolarHBondContact O-CB 3.35Å; S27-A31 PolarHBondContact O-N 3.11Å; S27-A31 VanDerWaalsContact O-N 3.13Å
32	S	55.3	Low	62.6	Low	98 Å²	98	100.9 Å²	100.9	69%	0.685	60%	0.602	S	S	*	*			trans	-155.1	81.9	177.3	-158.4	0	0	0	0	113.9	N30	N30-S32 VanDerWaalsContact C-N 3.3Å; N30-S32 PolarHBondContact O-N 3.44Å
33	A	52.7	Low	62.6	Low	100 Å²	100	104.9 Å²	104.9	83%	0.826	61%	0.612	S	S	*	*			trans	-108.9	36.8	151.7	0	0	0	0	0	110.1	L35	A33-L35 PolarHBondContact O-N 2.74Å; A33-L35 VanDerWaalsContact O-N 3.14Å
34	A	58	Low	62.6	Low	81 Å²	81	101.8 Å²	101.8	67%	0.669	60%	0.604	S	S	*	*			trans	-66	112.2	167.6	0	0	0	0	0	107.1
35	L	57.1	Low	62.6	Low	152 Å²	152	97.6 Å²	97.6	80%	0.796	59%	0.592	S	S	*	*			trans	-57.4	129.9	173.8	-72	163.4	0	0	0	108	A33 D37	A33-L35 PolarHBondContact O-N 2.74Å; A33-L35 VanDerWaalsContact O-N 3.14Å; L35-D37 PolarHBondContact O-N 3.49Å; L35-D37 VanDerWaalsContact O-N 3.16Å
36	P	56.5	Low	62.9	Low	60 Å²	60	95.5 Å²	95.5	39%	0.39	59%	0.59	S	S	.	*			trans	-62.9	117.7	178.9	19.3	-27	0	0	0	110.3	K38 D41 A42 A45	P36-K38 PolarHBondContact O-N 2.98Å; P36-K38 VanDerWaalsContact O-N 3.15Å; P36-D41 HydrophobicContact CB-CB 3.37Å; P36-A42 HydrophobicContact CG-CB 4.29Å; P36-A45 HydrophobicContact CG-CB 4.47Å
37	D	62.7	Low	63.4	Low	163 Å²	163	99.1 Å²	99.1	87%	0.872	60%	0.597	S	S	*	*	S	Bend	trans	-65.2	-13.6	-179.1	-76.8	-37.8	0	0	0	113.1	L35	L35-D37 PolarHBondContact O-N 3.49Å; L35-D37 VanDerWaalsContact O-N 3.16Å
38	K	60.3	Low	63.9	Low	112 Å²	112	98.2 Å²	98.2	49%	0.487	60%	0.595	S	S	.	*	S	Bend	trans	-129.9	145.4	-177.6	-56.9	-179.7	-174.6	165	0	112.6	P36 E40 D41 A42	P36-K38 PolarHBondContact O-N 2.98Å; P36-K38 VanDerWaalsContact O-N 3.15Å; K38-E40 HydrophobicContact CB-CG 3.81Å; K38-E40 HydrophobicContact CD-CG 4.35Å; K38-E40 WeakPolarHBondContact CD-OE1 3.41Å; K38-E40 IonicContact NZ-OE1 3.34Å; K38-E40 PolarHBondContact O-N 2.92Å; K38-D41 WeakPolarHBondContact O-CB 3.41Å; K38-D41 PolarHBondContact O-N 3.27Å; K38-A42 PolarHBondContact O-N 3.45Å
39	P	63.4	Low	64.4	Low	117 Å²	117	94.2 Å²	94.2	76%	0.76	58%	0.583	S	S	*	*	H	α-helix	trans	-62.4	-28.8	179.1	24.8	-34	0	0	0	113.3	D41 A42 E43	P39-D41 VanDerWaalsContact C-N 3.27Å; P39-D41 PolarHBondContact O-N 3Å; P39-A42 WeakPolarHBondContact O-CB 3.4Å; P39-A42 PolarHBondContact O-N 3.1Å; P39-E43 PolarHBondContact O-N 3.39Å
40	E	65.9	Low	65.2	Low	131 Å²	131	90.9 Å²	90.9	61%	0.612	57%	0.573	S	S	*	*	H	α-helix	trans	-63.1	-34	172.8	60.8	-165.1	-176.9	0	0	112.4	K38 A44	K38-E40 HydrophobicContact CB-CG 3.81Å; K38-E40 HydrophobicContact CD-CG 4.35Å; K38-E40 WeakPolarHBondContact CD-OE1 3.41Å; K38-E40 IonicContact NZ-OE1 3.34Å; K38-E40 PolarHBondContact O-N 2.92Å; E40-A44 PolarHBondContact O-N 3.42Å
41	D	65	Low	66.3	Low	72 Å²	72	91.8 Å²	91.8	39%	0.385	57%	0.571	S	S	.	*	H	α-helix	trans	-75.9	-25.4	175.7	-64	-42	0	0	0	111.6	P36 K38 P39 A44 A45	P36-D41 HydrophobicContact CB-CB 3.37Å; K38-D41 WeakPolarHBondContact O-CB 3.41Å; K38-D41 PolarHBondContact O-N 3.27Å; P39-D41 VanDerWaalsContact C-N 3.27Å; P39-D41 PolarHBondContact O-N 3Å; D41-A44 PolarHBondContact O-N 3.05Å; D41-A45 WeakPolarHBondContact O-CB 3.41Å; D41-A45 PolarHBondContact O-N 3.03Å
42	A	65.6	Low	67.6	Low	47 Å²	47	92.8 Å²	92.8	39%	0.388	56%	0.559	S	S	.	*	H	α-helix	trans	-68.2	-40	176.1	0	0	0	0	0	112.4	P36 K38 P39 A45 A46	P36-A42 HydrophobicContact CG-CB 4.29Å; K38-A42 PolarHBondContact O-N 3.45Å; P39-A42 WeakPolarHBondContact O-CB 3.4Å; P39-A42 PolarHBondContact O-N 3.1Å; A42-A45 PolarHBondContact O-N 3.44Å; A42-A46 WeakPolarHBondContact O-CB 3.21Å; A42-A46 PolarHBondContact O-N 3.42Å
43	E	71.6	Confident	69	Low	118 Å²	118	92.1 Å²	92.1	55%	0.551	55%	0.551	S	S	*	*	H	α-helix	trans	-68.4	-39.4	175.1	-163.6	-169.2	153.7	0	0	111.1	P39 A46 K47	P39-E43 PolarHBondContact O-N 3.39Å; E43-A46 PolarHBondContact O-N 2.96Å; E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.43Å; E43-K47 WeakPolarHBondContact OE1-CE 3.43Å; E43-K47 IonicContact OE1-NZ 3.81Å; E43-K47 PolarHBondContact OE1-NZ 2.9Å
44	A	74.9	Confident	70.6	Confident	55 Å²	55	92.5 Å²	92.5	46%	0.455	54%	0.538	S	S	.	.	H	α-helix	trans	-63.5	-43.4	173.8	0	0	0	0	0	111.7	E40 D41 K47 A48	E40-A44 PolarHBondContact O-N 3.42Å; D41-A44 PolarHBondContact O-N 3.05Å; A44-K47 PolarHBondContact O-N 2.97Å; A44-A48 WeakPolarHBondContact O-CB 3.5Å; A44-A48 PolarHBondContact O-N 2.91Å
45	A	70.4	Confident	72	Confident	47 Å²	47	95.4 Å²	95.4	39%	0.388	54%	0.536	S	S	.	.	H	α-helix	trans	-63.6	-41.4	175.5	0	0	0	0	0	111.6	P36 D41 A42 A48 A49	P36-A45 HydrophobicContact CG-CB 4.47Å; D41-A45 WeakPolarHBondContact O-CB 3.41Å; D41-A45 PolarHBondContact O-N 3.03Å; A42-A45 PolarHBondContact O-N 3.44Å; A45-A48 PolarHBondContact O-N 3.15Å; A45-A49 VanDerWaalsContact O-CB 3.26Å; A45-A49 WeakPolarHBondContact O-CB 3.27Å; A45-A49 PolarHBondContact O-N 3.05Å
46	A	74.8	Confident	73.6	Confident	65 Å²	65	92.5 Å²	92.5	54%	0.537	52%	0.521	S	S	.	.	H	α-helix	trans	-63.6	-42.4	175.3	0	0	0	0	0	112	A42 E43 A49 G50	A42-A46 WeakPolarHBondContact O-CB 3.21Å; A42-A46 PolarHBondContact O-N 3.42Å; E43-A46 PolarHBondContact O-N 2.96Å; A46-A49 PolarHBondContact O-N 3.48Å; A46-G50 PolarHBondContact O-N 3.35Å
47	K	75.1	Confident	75.2	Confident	123 Å²	123	93.9 Å²	93.9	54%	0.535	52%	0.524	S	S	.	.	H	α-helix	trans	-63.9	-40.7	173.8	-74.2	174	-175.1	165.3	0	111.9	E43 A44 K51	E43-K47 WeakPolarHBondContact O-CG 3.39Å; E43-K47 PolarHBondContact O-N 3.43Å; E43-K47 WeakPolarHBondContact OE1-CE 3.43Å; E43-K47 IonicContact OE1-NZ 3.81Å; E43-K47 PolarHBondContact OE1-NZ 2.9Å; A44-K47 PolarHBondContact O-N 2.97Å; K47-K51 WeakPolarHBondContact O-CG 3.38Å; K47-K51 PolarHBondContact O-N 2.99Å; K47-K51 VanDerWaalsContact O-N 3.09Å
48	A	76.6	Confident	76.6	Confident	60 Å²	60	90.1 Å²	90.1	50%	0.496	51%	0.507	S	S	.	.	H	α-helix	trans	-66.6	-43.6	176.4	0	0	0	0	0	111.9	A44 A45 K51 K52	A44-A48 WeakPolarHBondContact O-CB 3.5Å; A44-A48 PolarHBondContact O-N 2.91Å; A45-A48 PolarHBondContact O-N 3.15Å; A48-K51 PolarHBondContact O-N 3.28Å; A48-K52 PolarHBondContact O-N 3.27Å
49	A	74.4	Confident	78.1	Confident	53 Å²	53	89.6 Å²	89.6	44%	0.438	51%	0.507	S	S	.	.	H	α-helix	trans	-61.5	-44.5	175.1	0	0	0	0	0	111.4	A45 A46 K51 K52 V53	A45-A49 VanDerWaalsContact O-CB 3.26Å; A45-A49 WeakPolarHBondContact O-CB 3.27Å; A45-A49 PolarHBondContact O-N 3.05Å; A46-A49 PolarHBondContact O-N 3.48Å; A49-K51 PolarHBondContact O-N 3.4Å; A49-K52 WeakPolarHBondContact O-CB 3.45Å; A49-K52 PolarHBondContact O-N 3.22Å; A49-K52 VanDerWaalsContact O-N 3.14Å; A49-V53 WeakPolarHBondContact O-CG2 3.47Å; A49-V53 PolarHBondContact O-N 2.97Å
50	G	76	Confident	79.5	Confident	33 Å²	33	90.4 Å²	90.4	34%	0.34	50%	0.499	S	S	.	.	H	α-helix	trans	-60.1	-42.5	175.8	0	0	0	0	0	113.1	A46 K52 V53 I54	A46-G50 PolarHBondContact O-N 3.35Å; G50-K52 VanDerWaalsContact C-N 3.34Å; G50-K52 PolarHBondContact O-N 3.01Å; G50-V53 PolarHBondContact O-N 3.45Å; G50-I54 WeakPolarHBondContact O-CG1 3.32Å; G50-I54 PolarHBondContact O-N 3.4Å; G50-I54 VanDerWaalsContact O-N 3.11Å
51	K	81	Confident	80.8	Confident	158 Å²	158	90.8 Å²	90.8	69%	0.687	50%	0.499	S	S	*	.	H	α-helix	trans	-63.3	-38.2	173.9	-73.4	177.3	-177.8	-178.9	0	112.3	K47 A48 A49 I54 K55	K47-K51 WeakPolarHBondContact O-CG 3.38Å; K47-K51 PolarHBondContact O-N 2.99Å; K47-K51 VanDerWaalsContact O-N 3.09Å; A48-K51 PolarHBondContact O-N 3.28Å; A49-K51 PolarHBondContact O-N 3.4Å; K51-I54 PolarHBondContact O-N 2.87Å; K51-K55 WeakPolarHBondContact O-CB 3.33Å; K51-K55 PolarHBondContact O-N 2.88Å
52	K	83.1	Confident	82.1	Confident	103 Å²	103	90.9 Å²	90.9	45%	0.448	50%	0.502	S	S	.	.	H	α-helix	trans	-62.7	-47.3	176.2	-170.3	-179.9	-178.9	-178.9	0	111	N29 A48 A49 G50 I54 K55 D56	N29-K52 PolarHBondContact OD1-NZ 2.79Å; A48-K52 PolarHBondContact O-N 3.27Å; A49-K52 WeakPolarHBondContact O-CB 3.45Å; A49-K52 PolarHBondContact O-N 3.22Å; A49-K52 VanDerWaalsContact O-N 3.14Å; G50-K52 VanDerWaalsContact C-N 3.34Å; G50-K52 PolarHBondContact O-N 3.01Å; K52-I54 PolarHBondContact O-N 2.98Å; K52-K55 WeakPolarHBondContact O-CB 3.31Å; K52-K55 PolarHBondContact O-N 3.29Å; K52-K55 VanDerWaalsContact O-N 3.15Å; K52-D56 VanDerWaalsContact O-CG 3.24Å; K52-D56 PolarHBondContact O-N 3.46Å
53	V	83.8	Confident	83.4	Confident	84 Å²	84	92 Å²	92	51%	0.509	50%	0.504	S	S	.	.	H	α-helix	trans	-59.3	-45	177.8	174.6	0	0	0	0	111.7	A49 G50 K55 D56 I57	A49-V53 WeakPolarHBondContact O-CG2 3.47Å; A49-V53 PolarHBondContact O-N 2.97Å; G50-V53 PolarHBondContact O-N 3.45Å; V53-K55 VanDerWaalsContact C-N 3.35Å; V53-K55 PolarHBondContact O-N 3.25Å; V53-D56 PolarHBondContact O-N 2.97Å; V53-I57 HydrophobicContact CG1-CD1 3.94Å; V53-I57 WeakPolarHBondContact O-CG1 3.39Å; V53-I57 PolarHBondContact O-N 3.41Å
54	I	86.3	Confident	84.4	Confident	109 Å²	109	88.2 Å²	88.2	56%	0.559	49%	0.493	S	S	*	.	H	α-helix	trans	-62.5	-43.8	177.3	-66	166.6	0	0	0	110.7	G50 K51 K52 D56 I57 V58	G50-I54 WeakPolarHBondContact O-CG1 3.32Å; G50-I54 PolarHBondContact O-N 3.4Å; G50-I54 VanDerWaalsContact O-N 3.11Å; K51-I54 PolarHBondContact O-N 2.87Å; K52-I54 PolarHBondContact O-N 2.98Å; I54-D56 VanDerWaalsContact C-N 3.32Å; I54-D56 PolarHBondContact O-N 3.45Å; I54-I57 PolarHBondContact O-N 2.99Å; I54-V58 HydrophobicContact CG2-CG2 4.42Å; I54-V58 WeakPolarHBondContact O-CG2 2.78Å; I54-V58 PolarHBondContact O-N 3.5Å
55	K	88.5	Confident	85.1	Confident	142 Å²	142	87.2 Å²	87.2	62%	0.617	49%	0.487	S	S	*	.	H	α-helix	trans	-59.9	-42.8	176.6	-176.5	-176	174.5	-174.2	0	111.4	K51 K52 V53 V58 M59	K51-K55 WeakPolarHBondContact O-CB 3.33Å; K51-K55 PolarHBondContact O-N 2.88Å; K52-K55 WeakPolarHBondContact O-CB 3.31Å; K52-K55 PolarHBondContact O-N 3.29Å; K52-K55 VanDerWaalsContact O-N 3.15Å; V53-K55 VanDerWaalsContact C-N 3.35Å; V53-K55 PolarHBondContact O-N 3.25Å; K55-V58 PolarHBondContact O-N 3.4Å; K55-M59 VanDerWaalsContact O-CB 3.31Å; K55-M59 WeakPolarHBondContact O-CB 3.36Å; K55-M59 PolarHBondContact O-N 3.47Å
56	D	89.3	Confident	86.1	Confident	90 Å²	90	90.6 Å²	90.6	48%	0.481	50%	0.498	S	S	.	.	H	α-helix	trans	-65.6	-41.1	179.7	-66.5	-15.7	0	0	0	111.4	K52 V53 I54 M59 F60	K52-D56 VanDerWaalsContact O-CG 3.24Å; K52-D56 PolarHBondContact O-N 3.46Å; V53-D56 PolarHBondContact O-N 2.97Å; I54-D56 VanDerWaalsContact C-N 3.32Å; I54-D56 PolarHBondContact O-N 3.45Å; D56-M59 PolarHBondContact O-N 2.9Å; D56-F60 WeakPolarHBondContact O-CB 3.43Å; D56-F60 PolarHBondContact O-N 3.36Å
57	I	90.6	Very high	86.9	Confident	89 Å²	89	92.3 Å²	92.3	46%	0.456	50%	0.498	S	S	.	.	H	α-helix	trans	-63.2	-47.2	174.8	-67.7	166.8	0	0	0	111	V53 I54 M59 F60 F61	V53-I57 HydrophobicContact CG1-CD1 3.94Å; V53-I57 WeakPolarHBondContact O-CG1 3.39Å; V53-I57 PolarHBondContact O-N 3.41Å; I54-I57 PolarHBondContact O-N 2.99Å; I57-M59 VanDerWaalsContact C-N 3.32Å; I57-M59 PolarHBondContact O-N 3.2Å; I57-F60 WeakPolarHBondContact O-CB 3.5Å; I57-F60 PolarHBondContact O-N 3.42Å; I57-F61 HydrophobicContact CG2-CD2 4.04Å; I57-F61 HydrophobicContact CG2-CE2 3.9Å; I57-F61 VanDerWaalsContact O-CD2 3.28Å; I57-F61 WeakPolarHBondContact O-CD2 3.3Å; I57-F61 PolarHBondContact O-N 2.9Å
58	V	91.2	Very high	87.4	Confident	85 Å²	85	91.2 Å²	91.2	52%	0.515	49%	0.494	S	S	.	.	H	α-helix	trans	-62	-44	178.2	172.4	0	0	0	0	110.3	I54 K55 F60 F61 V62	I54-V58 HydrophobicContact CG2-CG2 4.42Å; I54-V58 WeakPolarHBondContact O-CG2 2.78Å; I54-V58 PolarHBondContact O-N 3.5Å; K55-V58 PolarHBondContact O-N 3.4Å; V58-F60 VanDerWaalsContact C-N 3.32Å; V58-F60 PolarHBondContact O-N 3.29Å; V58-F61 PolarHBondContact O-N 3.4Å; V58-V62 HydrophobicContact CG1-CG2 4.39Å; V58-V62 WeakPolarHBondContact O-CG2 3.34Å; V58-V62 PolarHBondContact O-N 2.74Å
59	M	92.7	Very high	87.9	Confident	100 Å²	100	91 Å²	91	49%	0.493	49%	0.492	S	S	.	.	H	α-helix	trans	-62	-40	178.2	-169.1	61.6	72.9	0	0	111.8	K55 D56 I57 F61 V62 V63	K55-M59 VanDerWaalsContact O-CB 3.31Å; K55-M59 WeakPolarHBondContact O-CB 3.36Å; K55-M59 PolarHBondContact O-N 3.47Å; D56-M59 PolarHBondContact O-N 2.9Å; I57-M59 VanDerWaalsContact C-N 3.32Å; I57-M59 PolarHBondContact O-N 3.2Å; M59-F61 PolarHBondContact O-N 2.91Å; M59-V62 PolarHBondContact O-N 2.77Å; M59-V63 HydrophobicContact CG-CG2 4.37Å; M59-V63 WeakPolarHBondContact O-CG2 3.28Å; M59-V63 PolarHBondContact O-N 2.99Å; M59-V63 HydrophobicContact SD-CG2 4.4Å
60	F	92.9	Very high	88.5	Confident	135 Å²	135	89.8 Å²	89.8	59%	0.592	49%	0.485	S	S	*	.	H	α-helix	trans	-56.4	-49	174.5	175.1	-94.4	0	0	0	111.9	D56 I57 V58 V62 V63 A64	D56-F60 WeakPolarHBondContact O-CB 3.43Å; D56-F60 PolarHBondContact O-N 3.36Å; I57-F60 WeakPolarHBondContact O-CB 3.5Å; I57-F60 PolarHBondContact O-N 3.42Å; V58-F60 VanDerWaalsContact C-N 3.32Å; V58-F60 PolarHBondContact O-N 3.29Å; F60-V62 PolarHBondContact O-N 2.88Å; F60-V63 PolarHBondContact O-N 2.86Å; F60-A64 VanDerWaalsContact O-CB 3.23Å; F60-A64 WeakPolarHBondContact O-CB 3.21Å; F60-A64 PolarHBondContact O-N 2.8Å
61	F	92.1	Very high	88.9	Confident	138 Å²	138	88.6 Å²	88.6	61%	0.605	47%	0.473	S	S	*	.	H	α-helix	trans	-68.7	-34.1	179.3	-77.4	-71.5	0	0	0	113.1	I57 V58 M59 G65	I57-F61 HydrophobicContact CG2-CD2 4.04Å; I57-F61 HydrophobicContact CG2-CE2 3.9Å; I57-F61 VanDerWaalsContact O-CD2 3.28Å; I57-F61 WeakPolarHBondContact O-CD2 3.3Å; I57-F61 PolarHBondContact O-N 2.9Å; V58-F61 PolarHBondContact O-N 3.4Å; M59-F61 PolarHBondContact O-N 2.91Å; F61-G65 PolarHBondContact O-N 2.69Å
62	V	92.6	Very high	88.8	Confident	75 Å²	75	89.6 Å²	89.6	46%	0.455	47%	0.472	S	S	.	.	H	α-helix	trans	-63.3	-49.7	173.6	171.2	0	0	0	0	110.4	V58 M59 F60 G65 L66	V58-V62 HydrophobicContact CG1-CG2 4.39Å; V58-V62 WeakPolarHBondContact O-CG2 3.34Å; V58-V62 PolarHBondContact O-N 2.74Å; M59-V62 PolarHBondContact O-N 2.77Å; F60-V62 PolarHBondContact O-N 2.88Å; V62-G65 PolarHBondContact O-N 3.15Å; V62-L66 HydrophobicContact CG1-CD1 4.15Å; V62-L66 VanDerWaalsContact O-CG 3.3Å; V62-L66 WeakPolarHBondContact O-CG 3.32Å; V62-L66 PolarHBondContact O-N 2.97Å
63	V	93.8	Very high	88.8	Confident	71 Å²	71	93.1 Å²	93.1	43%	0.43	49%	0.492	S	S	.	.	H	α-helix	trans	-64.1	-46.3	178.9	172.9	0	0	0	0	111.1	M59 F60 G65 L66 I67	M59-V63 HydrophobicContact CG-CG2 4.37Å; M59-V63 WeakPolarHBondContact O-CG2 3.28Å; M59-V63 PolarHBondContact O-N 2.99Å; M59-V63 HydrophobicContact SD-CG2 4.4Å; F60-V63 PolarHBondContact O-N 2.86Å; V63-G65 VanDerWaalsContact C-N 3.32Å; V63-G65 PolarHBondContact O-N 2.8Å; V63-L66 PolarHBondContact O-N 2.89Å; V63-I67 HydrophobicContact CG1-CD1 3.86Å; V63-I67 HydrophobicContact CG1-CG1 4.46Å; V63-I67 WeakPolarHBondContact O-CG1 3.47Å; V63-I67 PolarHBondContact O-N 3.23Å
64	A	91.6	Very high	88.6	Confident	38 Å²	38	96.5 Å²	96.5	31%	0.314	51%	0.506	S	S	.	.	H	α-helix	trans	-59.8	-43.2	176.8	0	0	0	0	0	111.7	F60 I67 E68	F60-A64 VanDerWaalsContact O-CB 3.23Å; F60-A64 WeakPolarHBondContact O-CB 3.21Å; F60-A64 PolarHBondContact O-N 2.8Å; A64-I67 PolarHBondContact O-N 3.43Å; A64-E68 WeakPolarHBondContact O-CB 3.4Å; A64-E68 PolarHBondContact O-N 3.49Å
65	G	91	Very high	87.8	Confident	33 Å²	33	93.1 Å²	93.1	34%	0.34	50%	0.499	S	S	.	.	H	α-helix	trans	-64.7	-38.1	176	0	0	0	0	0	113	F61 V62 V63 E68 A69	F61-G65 PolarHBondContact O-N 2.69Å; V62-G65 PolarHBondContact O-N 3.15Å; V63-G65 VanDerWaalsContact C-N 3.32Å; V63-G65 PolarHBondContact O-N 2.8Å; G65-E68 PolarHBondContact O-N 3.33Å; G65-A69 WeakPolarHBondContact O-CB 3.32Å; G65-A69 PolarHBondContact O-N 2.86Å
66	L	91.4	Very high	86.4	Confident	118 Å²	118	92.5 Å²	92.5	62%	0.618	49%	0.493	S	S	*	.	H	α-helix	trans	-67.4	-40.4	173.8	-72.9	173.6	0	0	0	112	V62 V63 A69 G70	V62-L66 HydrophobicContact CG1-CD1 4.15Å; V62-L66 VanDerWaalsContact O-CG 3.3Å; V62-L66 WeakPolarHBondContact O-CG 3.32Å; V62-L66 PolarHBondContact O-N 2.97Å; V63-L66 PolarHBondContact O-N 2.89Å; L66-A69 PolarHBondContact O-N 2.84Å; L66-G70 PolarHBondContact O-N 3.34Å
67	I	90.1	Very high	85	Confident	102 Å²	102	96.1 Å²	96.1	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-63	-44.7	174.1	-69	167.6	0	0	0	110	V63 A64 A71	V63-I67 HydrophobicContact CG1-CD1 3.86Å; V63-I67 HydrophobicContact CG1-CG1 4.46Å; V63-I67 WeakPolarHBondContact O-CG1 3.47Å; V63-I67 PolarHBondContact O-N 3.23Å; A64-I67 PolarHBondContact O-N 3.43Å; I67-A71 WeakPolarHBondContact O-CB 3.32Å; I67-A71 PolarHBondContact O-N 3.46Å
68	E	87	Confident	83.4	Confident	99 Å²	99	99.3 Å²	99.3	46%	0.463	53%	0.53	S	S	.	.	H	α-helix	trans	-65.2	-44.5	177.4	-174.1	-178.9	178.3	0	0	112.1	A64 G65 A71 R72	A64-E68 WeakPolarHBondContact O-CB 3.4Å; A64-E68 PolarHBondContact O-N 3.49Å; G65-E68 PolarHBondContact O-N 3.33Å; E68-A71 VanDerWaalsContact O-CB 3.25Å; E68-A71 WeakPolarHBondContact O-CB 3.23Å; E68-A71 PolarHBondContact O-N 3.42Å; E68-R72 VanDerWaalsContact O-CG 3.32Å; E68-R72 WeakPolarHBondContact O-CG 3.34Å; E68-R72 PolarHBondContact O-N 3.11Å; E68-R72 IonicContact OE1-CZ 2.67Å; E68-R72 VanDerWaalsContact OE1-CZ 3.3Å; E68-R72 IonicContact OE1-NE 2.65Å; E68-R72 PolarHBondContact OE1-NE 3.49Å; E68-R72 IonicContact OE1-NH2 3.3Å; E68-R72 PolarHBondContact OE1-NH2 3.33Å
69	A	86.5	Confident	81.8	Confident	55 Å²	55	99.1 Å²	99.1	46%	0.455	53%	0.526	S	S	.	.	H	α-helix	trans	-64.9	-44	176.7	0	0	0	0	0	111.4	G65 L66 A71 R72 M73	G65-A69 WeakPolarHBondContact O-CB 3.32Å; G65-A69 PolarHBondContact O-N 2.86Å; L66-A69 PolarHBondContact O-N 2.84Å; A69-A71 VanDerWaalsContact C-N 3.32Å; A69-A71 PolarHBondContact O-N 2.65Å; A69-R72 PolarHBondContact O-N 3.25Å; A69-M73 WeakPolarHBondContact O-CB 3.24Å; A69-M73 PolarHBondContact O-N 3.32Å
70	G	86.1	Confident	80.1	Confident	28 Å²	28	100.3 Å²	100.3	29%	0.289	54%	0.541	S	S	.	.	H	α-helix	trans	-61.7	-41.3	174.1	0	0	0	0	0	111.6	L66 M73 L74	L66-G70 PolarHBondContact O-N 3.34Å; G70-M73 PolarHBondContact O-N 2.84Å; G70-L74 WeakPolarHBondContact O-CB 3.18Å; G70-L74 WeakPolarHBondContact O-CG 3.15Å; G70-L74 PolarHBondContact O-N 3.26Å
71	A	84.7	Confident	78.4	Confident	9 Å²	9	96.2 Å²	96.2	7%	0.074	54%	0.537	C	S	.	.	H	α-helix	trans	-56.4	-52	170.9	0	0	0	0	0	112.5	I67 E68 A69 M73 L74 G75 R76	I67-A71 WeakPolarHBondContact O-CB 3.32Å; I67-A71 PolarHBondContact O-N 3.46Å; E68-A71 VanDerWaalsContact O-CB 3.25Å; E68-A71 WeakPolarHBondContact O-CB 3.23Å; E68-A71 PolarHBondContact O-N 3.42Å; A69-A71 VanDerWaalsContact C-N 3.32Å; A69-A71 PolarHBondContact O-N 2.65Å; A71-M73 VanDerWaalsContact C-N 3.32Å; A71-M73 PolarHBondContact O-N 3.28Å; A71-L74 PolarHBondContact O-N 2.81Å; A71-G75 PolarHBondContact O-N 3.34Å; A71-R76 HydrophobicContact CB-CB 4.08Å; A71-R76 HydrophobicContact CB-CG 3.55Å; A71-R76 WeakPolarHBondContact O-CB 3.25Å; A71-R76 VanDerWaalsContact O-CG 3.24Å; A71-R76 WeakPolarHBondContact O-CG 3.21Å; A71-R76 PolarHBondContact O-N 2.82Å
72	R	79.7	Confident	76.8	Confident	178 Å²	178	95.8 Å²	95.8	67%	0.672	55%	0.548	S	S	*	.	H	α-helix	trans	-61.2	-41.8	178	-70.6	174.3	-176.6	-159.5	2.4	111.3	E68 A69 G75	E68-R72 VanDerWaalsContact O-CG 3.32Å; E68-R72 WeakPolarHBondContact O-CG 3.34Å; E68-R72 PolarHBondContact O-N 3.11Å; E68-R72 IonicContact OE1-CZ 2.67Å; E68-R72 VanDerWaalsContact OE1-CZ 3.3Å; E68-R72 IonicContact OE1-NE 2.65Å; E68-R72 PolarHBondContact OE1-NE 3.49Å; E68-R72 IonicContact OE1-NH2 3.3Å; E68-R72 PolarHBondContact OE1-NH2 3.33Å; A69-R72 PolarHBondContact O-N 3.25Å; R72-G75 PolarHBondContact O-N 2.88Å; R72-G75 VanDerWaalsContact O-N 3.11Å
73	M	82.2	Confident	75.2	Confident	177 Å²	177	96.7 Å²	96.7	87%	0.872	56%	0.558	S	S	*	*	H	α-helix	trans	-65.3	-38.7	177.7	-175.7	179	171.6	0	0	112.6	A69 G70 A71 G75	A69-M73 WeakPolarHBondContact O-CB 3.24Å; A69-M73 PolarHBondContact O-N 3.32Å; G70-M73 PolarHBondContact O-N 2.84Å; A71-M73 VanDerWaalsContact C-N 3.32Å; A71-M73 PolarHBondContact O-N 3.28Å; M73-G75 PolarHBondContact O-N 3.06Å
74	L	81.4	Confident	73.4	Confident	155 Å²	155	105.3 Å²	105.3	81%	0.812	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.1	-0.3	174.2	-68.2	172.8	0	0	0	113.2	G70 A71	G70-L74 WeakPolarHBondContact O-CB 3.18Å; G70-L74 WeakPolarHBondContact O-CG 3.15Å; G70-L74 PolarHBondContact O-N 3.26Å; A71-L74 PolarHBondContact O-N 2.81Å
75	G	69	Low	71.5	Confident	39 Å²	39	114.4 Å²	114.4	40%	0.402	63%	0.625	S	S	.	*	T	Hydrogen-bonded Turn	trans	78.7	46.2	176.8	0	0	0	0	0	114.2	A71 R72 M73 D77 N78	A71-G75 PolarHBondContact O-N 3.34Å; R72-G75 PolarHBondContact O-N 2.88Å; R72-G75 VanDerWaalsContact O-N 3.11Å; M73-G75 PolarHBondContact O-N 3.06Å; G75-D77 PolarHBondContact O-N 3.41Å; G75-N78 PolarHBondContact O-N 3.4Å
76	R	59.6	Low	70.5	Confident	129 Å²	129	118.5 Å²	118.5	49%	0.487	64%	0.639	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.4	29.8	-178.7	-91.8	-144.5	-177	171.2	-16.9	118	A71 N78 L79	A71-R76 HydrophobicContact CB-CB 4.08Å; A71-R76 HydrophobicContact CB-CG 3.55Å; A71-R76 WeakPolarHBondContact O-CB 3.25Å; A71-R76 VanDerWaalsContact O-CG 3.24Å; A71-R76 WeakPolarHBondContact O-CG 3.21Å; A71-R76 PolarHBondContact O-N 2.82Å; R76-N78 PolarHBondContact O-N 2.81Å; R76-L79 VanDerWaalsContact CD-CG 3.46Å; R76-L79 HydrophobicContact CG-CD1 4.03Å; R76-L79 HydrophobicContact CG-CD2 4.42Å; R76-L79 HydrophobicContact CG-CG 3.78Å; R76-L79 VanDerWaalsContact CZ-CD1 3.44Å; R76-L79 VanDerWaalsContact CZ-CD2 3.47Å
77	D	58.6	Low	69.4	Low	166 Å²	166	118.5 Å²	118.5	89%	0.888	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	-13.2	149.8	-68.7	-29.8	0	0	0	111.2	G75	G75-D77 PolarHBondContact O-N 3.41Å
78	N	57.2	Low	68.2	Low	155 Å²	155	119.4 Å²	119.4	83%	0.829	65%	0.647	S	S	*	*	S	Bend	trans	-111.4	8.9	-167.6	-86.5	-24.1	0	0	0	117.7	G75 R76	G75-N78 PolarHBondContact O-N 3.4Å; R76-N78 PolarHBondContact O-N 2.81Å
79	L	56.8	Low	67.1	Low	82 Å²	82	120.6 Å²	120.6	43%	0.429	66%	0.657	S	S	.	*	S	Bend	trans	-106.9	137.6	163.1	53.2	64.1	0	0	0	113.5	R76 G81	R76-L79 VanDerWaalsContact CD-CG 3.46Å; R76-L79 HydrophobicContact CG-CD1 4.03Å; R76-L79 HydrophobicContact CG-CD2 4.42Å; R76-L79 HydrophobicContact CG-CG 3.78Å; R76-L79 VanDerWaalsContact CZ-CD1 3.44Å; R76-L79 VanDerWaalsContact CZ-CD2 3.47Å; L79-G81 PolarHBondContact O-N 2.81Å
80	P	57.3	Low	65.9	Low	124 Å²	124	124.8 Å²	124.8	81%	0.805	67%	0.67	S	S	*	*			trans	-55.4	110.3	-168.9	17.1	-29.6	0	0	0	107.1
81	G	57.4	Low	64.6	Low	50 Å²	50	131.2 Å²	131.2	52%	0.515	70%	0.695	S	S	.	*			trans	-51.4	157.4	157.1	0	0	0	0	0	107.8	L79 S83	L79-G81 PolarHBondContact O-N 2.81Å; G81-S83 PolarHBondContact O-N 2.82Å
82	P	58	Low	63.1	Low	128 Å²	128	139.9 Å²	139.9	83%	0.831	74%	0.74	S	S	*	*			trans	-48.1	114.5	-178.8	20.7	-31.8	0	0	0	108	R84	P82-R84 PolarHBondContact O-N 2.78Å
83	S	60.1	Low	61.9	Low	95 Å²	95	137 Å²	137	66%	0.664	75%	0.745	S	S	*	*			trans	-52.2	116.3	177.6	43.4	0	0	0	0	105.5	G81 L85	G81-S83 PolarHBondContact O-N 2.82Å; S83-L85 PolarHBondContact O-N 2.96Å
84	R	55	Low	60.2	Low	251 Å²	251	133.7 Å²	133.7	95%	0.947	73%	0.734	S	S	*	*			trans	-62	93	172.5	-67.5	-176.4	176.1	-168.7	-0.8	106.5	P82	P82-R84 PolarHBondContact O-N 2.78Å
85	L	51.4	Low	58.2	Low	230 Å²	230	131.7 Å²	131.7	100%	1.204	73%	0.727	S	S	*	*			trans	-125.7	0	162.5	-69.1	179.9	0	0	0	106.4	S83	S83-L85 PolarHBondContact O-N 2.96Å

Retrieved 85 of 85 residues in 31.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).