A0A077ZBF6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZBF6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 56 aa.

						>A0A077ZBF6_TRITR|A0A077ZBF6
MSKLTFRARALDCIKRLSLYRKEQLPDLAEYAANQRSVPAMPSGMEKEEEMVALSM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.3	Low	78.1	Confident	242 Å²	242	162.7 Å²	162.7	100%	1.192	84%	0.839	S	S	*	*				0	118.5	0	-68.4	-152.6	-80.6	0	0	108.1	K3	M1-K3 PolarHBondContact O-N 3.2Å
2	S	73.7	Confident	79.1	Confident	124 Å²	124	154.7 Å²	154.7	87%	0.867	80%	0.798	S	S	*	*			trans	-68.2	119.9	172.9	44.6	0	0	0	0	108.1	L4	S2-L4 PolarHBondContact O-N 2.84Å
3	K	76.6	Confident	79.8	Confident	187 Å²	187	151.5 Å²	151.5	81%	0.813	80%	0.796	S	S	*	*			trans	-59	124.4	174.4	-171.9	172.6	-177.9	174.7	0	107.6	M1 T5	M1-K3 PolarHBondContact O-N 3.2Å; K3-T5 PolarHBondContact O-N 3.26Å
4	L	73.1	Confident	80.7	Confident	176 Å²	176	152 Å²	152	92%	0.921	80%	0.797	S	S	*	*			trans	-64.7	103.5	174.2	-163.8	75.9	0	0	0	107.3	S2 F6	S2-L4 PolarHBondContact O-N 2.84Å; L4-F6 PolarHBondContact O-N 3.39Å
5	T	78	Confident	81.4	Confident	101 Å²	101	151.3 Å²	151.3	62%	0.62	79%	0.785	S	S	*	*			trans	-86.5	108.1	179.8	60.7	0	0	0	0	108.8	K3 R7	K3-T5 PolarHBondContact O-N 3.26Å; T5-R7 PolarHBondContact O-N 3.29Å
6	F	80.1	Confident	81.9	Confident	195 Å²	195	156.8 Å²	156.8	86%	0.855	79%	0.792	S	S	*	*			trans	-72.8	115.2	161.3	-171.8	-100.9	0	0	0	107.9	L4	L4-F6 PolarHBondContact O-N 3.39Å
7	R	79.9	Confident	82.2	Confident	207 Å²	207	155.8 Å²	155.8	78%	0.781	79%	0.789	S	S	*	*			trans	-90.3	107.7	170.6	-68.7	-170.9	178.7	-168.2	-0.7	107.6	T5 R9	T5-R7 PolarHBondContact O-N 3.29Å; R7-R9 PolarHBondContact O-N 2.89Å; R7-R9 VanDerWaalsContact O-N 3.15Å
8	A	82.9	Confident	82.6	Confident	89 Å²	89	151.8 Å²	151.8	74%	0.736	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-54.2	122.4	167.8	0	0	0	0	0	108.3
9	R	83.8	Confident	82.9	Confident	230 Å²	230	152.3 Å²	152.3	87%	0.868	78%	0.781	S	S	*	*	P	Polyproline II helix	trans	-94.4	140.2	171.6	-60.8	-170.4	-168	-169.7	4.7	107.6	R7 L11	R7-R9 PolarHBondContact O-N 2.89Å; R7-R9 VanDerWaalsContact O-N 3.15Å; R9-L11 PolarHBondContact O-N 2.99Å; R9-L11 VanDerWaalsContact O-N 3.15Å
10	A	87.8	Confident	83.4	Confident	106 Å²	106	151.8 Å²	151.8	88%	0.876	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-59.2	120.2	170.1	0	0	0	0	0	108.8
11	L	85.5	Confident	83.7	Confident	133 Å²	133	153.4 Å²	153.4	70%	0.696	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-78	128.3	171.6	-176.9	69	0	0	0	108	R9 C13	R9-L11 PolarHBondContact O-N 2.99Å; R9-L11 VanDerWaalsContact O-N 3.15Å; L11-C13 PolarHBondContact O-N 3.35Å
12	D	90.4	Very high	85.2	Confident	66 Å²	66	150.2 Å²	150.2	35%	0.353	75%	0.746	S	S	.	*			trans	-85.3	96.6	171.5	-174	-19.9	0	0	0	109	I14 K15	D12-I14 PolarHBondContact O-N 3.18Å; D12-I14 WeakPolarHBondContact OD1-CB 3.45Å; D12-I14 PolarHBondContact OD1-N 3.3Å; D12-K15 PolarHBondContact OD2-NZ 3.21Å; D12-K15 IonicContact OD2-NZ 2.7Å; D12-K15 WeakPolarHBondContact OD2-CG 3.32Å; D12-K15 WeakPolarHBondContact OD2-CE 3.45Å; D12-K15 WeakPolarHBondContact OD2-CD 3.48Å; D12-K15 PolarHBondContact O-N 3.29Å; D12-K15 HydrophobicContact CB-CG 4.03Å; D12-K15 HydrophobicContact CB-CD 3.9Å; D12-K15 HydrophobicContact CB-CB 4.24Å; D12-K15 PolarHBondContact OD1-N 3.05Å
13	C	88	Confident	86	Confident	114 Å²	114	151.9 Å²	151.9	77%	0.77	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.7	-14.2	-177.7	-54.7	0	0	0	0	113.6	L11	L11-C13 PolarHBondContact O-N 3.35Å
14	I	92.6	Very high	86.7	Confident	158 Å²	158	148.6 Å²	148.6	81%	0.81	73%	0.728	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	-28.7	179.1	-57.8	173.9	0	0	0	110.1	D12 R16	D12-I14 PolarHBondContact O-N 3.18Å; D12-I14 WeakPolarHBondContact OD1-CB 3.45Å; D12-I14 PolarHBondContact OD1-N 3.3Å; I14-R16 PolarHBondContact O-N 3.48Å
15	K	90.8	Very high	87.3	Confident	142 Å²	142	145 Å²	145	62%	0.617	71%	0.709	S	S	*	*	S	Bend	trans	-67	120.6	175.5	-76.7	-178.9	-178.4	113	0	110.2	D12 L17	D12-K15 PolarHBondContact OD2-NZ 3.21Å; D12-K15 IonicContact OD2-NZ 2.7Å; D12-K15 WeakPolarHBondContact OD2-CG 3.32Å; D12-K15 WeakPolarHBondContact OD2-CE 3.45Å; D12-K15 WeakPolarHBondContact OD2-CD 3.48Å; D12-K15 PolarHBondContact O-N 3.29Å; D12-K15 HydrophobicContact CB-CG 4.03Å; D12-K15 HydrophobicContact CB-CD 3.9Å; D12-K15 HydrophobicContact CB-CB 4.24Å; D12-K15 PolarHBondContact OD1-N 3.05Å; K15-L17 PolarHBondContact O-N 3.2Å
16	R	89.9	Confident	87.7	Confident	239 Å²	239	143.2 Å²	143.2	90%	0.902	70%	0.699	S	S	*	*	P	Polyproline II helix	trans	-62.1	127.1	169.9	-70.5	-173.2	175.2	89.3	0.2	109.3	I14	I14-R16 PolarHBondContact O-N 3.48Å
17	L	86.4	Confident	87.8	Confident	139 Å²	139	138.9 Å²	138.9	73%	0.728	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-74.8	135.3	169.8	-64	175.9	0	0	0	109.2	K15 L19	K15-L17 PolarHBondContact O-N 3.2Å; L17-L19 PolarHBondContact O-N 3.05Å
18	S	89.2	Confident	87.7	Confident	84 Å²	84	135.4 Å²	135.4	59%	0.587	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-64.1	123.7	173.9	-60.6	0	0	0	0	109.8
19	L	90	Very high	87.5	Confident	161 Å²	161	134.5 Å²	134.5	84%	0.843	67%	0.673	S	S	*	*			trans	-92.8	109.6	171.4	-64.1	176.7	0	0	0	108.3	L17	L17-L19 PolarHBondContact O-N 3.05Å
20	Y	91.6	Very high	87.3	Confident	143 Å²	143	129.9 Å²	129.9	56%	0.561	66%	0.662	S	S	*	*			trans	-93.2	138	174.7	-64.8	-80.9	0	0	0	110.2	Q24 L25	Y20-Q24 HydrophobicContact CD1-CB 4.11Å; Y20-L25 HydrophobicContact CG-CD2 4.16Å
21	R	90.8	Very high	86.8	Confident	186 Å²	186	130.9 Å²	130.9	70%	0.702	64%	0.644	S	S	*	*			trans	-79.9	160.4	165	-61.2	-63.4	-171.6	-164.2	0.5	109.9	E23 Q24 L25	R21-E23 PolarHBondContact O-N 3.42Å; R21-E23 WeakPolarHBondContact CB-OE2 3.22Å; R21-E23 VanDerWaalsContact CB-OE2 3.23Å; R21-Q24 HydrophobicContact CB-CG 4.38Å; R21-Q24 WeakPolarHBondContact O-CB 3.38Å; R21-Q24 PolarHBondContact O-N 3.15Å; R21-L25 PolarHBondContact O-N 3.15Å
22	K	88	Confident	86.3	Confident	175 Å²	175	127.1 Å²	127.1	76%	0.761	63%	0.632	S	S	*	*	G	3₁₀ helix	trans	-55.8	-36.8	-177.4	-175.3	-177.9	176.7	-174.8	0	111.7	Q24 L25	K22-Q24 PolarHBondContact O-N 3.33Å; K22-L25 PolarHBondContact O-N 3.3Å
23	E	90.3	Very high	85.7	Confident	158 Å²	158	128.3 Å²	128.3	74%	0.738	65%	0.651	S	S	*	*	G	3₁₀ helix	trans	-74	-15.4	-178.2	-51.3	72.4	-152.5	0	0	112.9	R21	R21-E23 PolarHBondContact O-N 3.42Å; R21-E23 WeakPolarHBondContact CB-OE2 3.22Å; R21-E23 VanDerWaalsContact CB-OE2 3.23Å
24	Q	91.6	Very high	85.2	Confident	119 Å²	119	129.5 Å²	129.5	56%	0.556	65%	0.649	S	S	*	*	G	3₁₀ helix	trans	-95.6	-12.1	176.1	-58	176.7	-64	0	0	112.2	Y20 R21 K22	Y20-Q24 HydrophobicContact CD1-CB 4.11Å; R21-Q24 HydrophobicContact CB-CG 4.38Å; R21-Q24 WeakPolarHBondContact O-CB 3.38Å; R21-Q24 PolarHBondContact O-N 3.15Å; K22-Q24 PolarHBondContact O-N 3.33Å
25	L	86.3	Confident	84.5	Confident	99 Å²	99	128.6 Å²	128.6	52%	0.518	64%	0.642	S	S	.	*	S	Bend	trans	-81.6	134.8	175.8	-65.9	176.6	0	0	0	108.6	Y20 R21 K22	Y20-L25 HydrophobicContact CG-CD2 4.16Å; R21-L25 PolarHBondContact O-N 3.15Å; K22-L25 PolarHBondContact O-N 3.3Å
26	P	85.2	Confident	84.1	Confident	65 Å²	65	132.8 Å²	132.8	42%	0.422	65%	0.654	S	S	.	*	P	Polyproline II helix	trans	-63.2	145.8	172.2	28.3	-34.9	0	0	0	110.1	L28 Y31	P26-L28 PolarHBondContact O-N 3.21Å; P26-Y31 HydrophobicContact CB-CE2 3.52Å; P26-Y31 WeakPolarHBondContact CB-OH 3.23Å; P26-Y31 HydrophobicContact CG-CE2 3.38Å; P26-Y31 WeakPolarHBondContact CG-OH 3.37Å
27	D	82.6	Confident	83.6	Confident	103 Å²	103	126.9 Å²	126.9	55%	0.551	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-64.5	134.3	-174.8	-165.1	-22.7	0	0	0	109.7	A29 E30	D27-A29 PolarHBondContact OD1-N 3.26Å; D27-A29 PolarHBondContact O-N 2.7Å; D27-A29 VanDerWaalsContact O-N 3.16Å; D27-E30 WeakPolarHBondContact O-CB 3.47Å; D27-E30 PolarHBondContact O-N 3.29Å; D27-E30 HydrophobicContact CB-CG 4.23Å
28	L	77.1	Confident	83.3	Confident	134 Å²	134	126 Å²	126	70%	0.702	65%	0.649	S	S	*	*	H	α-helix	trans	-58.7	-31.6	-179.8	-169.3	68.1	0	0	0	111.1	P26 E30 Y31 A32	P26-L28 PolarHBondContact O-N 3.21Å; L28-E30 PolarHBondContact O-N 3.23Å; L28-Y31 PolarHBondContact O-N 2.95Å; L28-A32 PolarHBondContact O-N 3.34Å; L28-A32 VanDerWaalsContact O-N 3.12Å
29	A	79.1	Confident	82.8	Confident	70 Å²	70	127.1 Å²	127.1	58%	0.579	65%	0.654	S	S	*	*	H	α-helix	trans	-59.6	-33.1	176.1	0	0	0	0	0	112.8	D27 Y31 A32	D27-A29 PolarHBondContact OD1-N 3.26Å; D27-A29 PolarHBondContact O-N 2.7Å; D27-A29 VanDerWaalsContact O-N 3.16Å; A29-Y31 VanDerWaalsContact C-N 3.31Å; A29-Y31 PolarHBondContact O-N 3.05Å; A29-A32 PolarHBondContact O-N 3.3Å
30	E	80	Confident	82.3	Confident	134 Å²	134	124.1 Å²	124.1	63%	0.626	65%	0.653	S	S	*	*	H	α-helix	trans	-66.8	-32.7	178.7	-65.5	178.5	-176.5	0	0	111.9	D27 L28	D27-E30 WeakPolarHBondContact O-CB 3.47Å; D27-E30 PolarHBondContact O-N 3.29Å; D27-E30 HydrophobicContact CB-CG 4.23Å; L28-E30 PolarHBondContact O-N 3.23Å
31	Y	76.4	Confident	81.6	Confident	126 Å²	126	124.4 Å²	124.4	49%	0.494	66%	0.662	S	S	.	*	H	α-helix	trans	-86.7	-22.8	178.3	-64.9	-76.8	0	0	0	114	P26 L28 A29 A33 N34 Q35	P26-Y31 HydrophobicContact CB-CE2 3.52Å; P26-Y31 WeakPolarHBondContact CB-OH 3.23Å; P26-Y31 HydrophobicContact CG-CE2 3.38Å; P26-Y31 WeakPolarHBondContact CG-OH 3.37Å; L28-Y31 PolarHBondContact O-N 2.95Å; A29-Y31 VanDerWaalsContact C-N 3.31Å; A29-Y31 PolarHBondContact O-N 3.05Å; Y31-A33 VanDerWaalsContact O-N 3.15Å; Y31-A33 PolarHBondContact O-N 3.25Å; Y31-N34 PolarHBondContact O-N 3.33Å; Y31-Q35 PolarHBondContact O-N 3.17Å
32	A	76.5	Confident	80.9	Confident	55 Å²	55	119.4 Å²	119.4	46%	0.455	65%	0.653	S	S	.	*	H	α-helix	trans	-56.5	-32.7	-179.4	0	0	0	0	0	111.9	L28 A29 N34 Q35	L28-A32 PolarHBondContact O-N 3.34Å; L28-A32 VanDerWaalsContact O-N 3.12Å; A29-A32 PolarHBondContact O-N 3.3Å; A32-N34 VanDerWaalsContact C-N 3.26Å; A32-N34 PolarHBondContact O-N 2.97Å; A32-Q35 PolarHBondContact O-N 3.26Å; A32-Q35 VanDerWaalsContact O-N 3.14Å
33	A	76.4	Confident	80.4	Confident	90 Å²	90	117 Å²	117	74%	0.744	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.6	-31.8	177.5	0	0	0	0	0	113.8	Y31	Y31-A33 VanDerWaalsContact O-N 3.15Å; Y31-A33 PolarHBondContact O-N 3.25Å
34	N	78.4	Confident	79.6	Confident	139 Å²	139	113.1 Å²	113.1	74%	0.743	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.5	-6.9	178.6	-70.1	-41.3	0	0	0	112.9	Y31 A32 R36	Y31-N34 PolarHBondContact O-N 3.33Å; A32-N34 VanDerWaalsContact C-N 3.26Å; A32-N34 PolarHBondContact O-N 2.97Å; N34-R36 PolarHBondContact O-N 3.19Å
35	Q	78	Confident	78.6	Confident	139 Å²	139	114.3 Å²	114.3	65%	0.65	67%	0.668	S	S	*	*			trans	-76.8	108	-177.4	-170.1	173	-38.7	0	0	109.5	Y31 A32	Y31-Q35 PolarHBondContact O-N 3.17Å; A32-Q35 PolarHBondContact O-N 3.26Å; A32-Q35 VanDerWaalsContact O-N 3.14Å
36	R	81.8	Confident	77.7	Confident	230 Å²	230	117.1 Å²	117.1	87%	0.868	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-72.1	136.8	165.8	-63.8	-177.2	-177	-177.8	0.2	108.4	N34 V38	N34-R36 PolarHBondContact O-N 3.19Å; R36-V38 PolarHBondContact O-N 3.42Å
37	S	79.3	Confident	77	Confident	115 Å²	115	120.1 Å²	120.1	80%	0.804	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-57.3	128.3	173.9	49.5	0	0	0	0	109.6
38	V	79.6	Confident	76.6	Confident	121 Å²	121	123.6 Å²	123.6	73%	0.733	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-79.3	132.3	167.2	-176.2	0	0	0	0	106.1	R36 A40	R36-V38 PolarHBondContact O-N 3.42Å; V38-A40 PolarHBondContact O-N 3.37Å
39	P	80.2	Confident	76.4	Confident	107 Å²	107	125 Å²	125	70%	0.695	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-51	131.3	171.4	-25.3	33.9	0	0	0	109.4	M41	P39-M41 PolarHBondContact O-N 3.27Å
40	A	78.7	Confident	76	Confident	99 Å²	99	127 Å²	127	82%	0.818	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-57.6	119.7	171.2	0	0	0	0	0	107.6	V38	V38-A40 PolarHBondContact O-N 3.37Å
41	M	76.3	Confident	75.4	Confident	149 Å²	149	127 Å²	127	73%	0.734	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-63	137.2	167.5	-68.1	-65.9	-66	0	0	107	P39 S43	P39-M41 PolarHBondContact O-N 3.27Å; M41-S43 PolarHBondContact O-N 3.14Å
42	P	77.7	Confident	75	Confident	80 Å²	80	126 Å²	126	52%	0.519	71%	0.706	S	S	.	*	P	Polyproline II helix	trans	-58.8	117.7	173.8	25	-33	0	0	0	108.5	G44 M45	P42-G44 PolarHBondContact O-N 3.22Å; P42-M45 HydrophobicContact CG-CG 3.98Å; P42-M45 HydrophobicContact CG-SD 3.57Å; P42-M45 VanDerWaalsContact CG-SD 3.57Å
43	S	76.5	Confident	74.4	Confident	124 Å²	124	127.2 Å²	127.2	87%	0.867	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	131.1	169.4	52.2	0	0	0	0	108.5	M41	M41-S43 PolarHBondContact O-N 3.14Å
44	G	73.6	Confident	73.6	Confident	77 Å²	77	130.2 Å²	130.2	79%	0.794	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	105.3	-1.2	-178.3	0	0	0	0	0	115.4	P42 E46	P42-G44 PolarHBondContact O-N 3.22Å; G44-E46 VanDerWaalsContact C-N 3.33Å; G44-E46 PolarHBondContact O-N 3.28Å
45	M	70.8	Confident	72.8	Confident	144 Å²	144	128.4 Å²	128.4	71%	0.709	72%	0.718	S	S	*	*			trans	-79.2	88.7	158.1	-73.5	-173.9	76.5	0	0	108.1	P42 K47	P42-M45 HydrophobicContact CG-CG 3.98Å; P42-M45 HydrophobicContact CG-SD 3.57Å; P42-M45 VanDerWaalsContact CG-SD 3.57Å; M45-K47 PolarHBondContact O-N 3.01Å
46	E	68.4	Low	71.8	Confident	158 Å²	158	133.1 Å²	133.1	74%	0.738	74%	0.742	S	S	*	*			trans	-55.4	128.3	169.4	-66.2	-175.6	167.2	0	0	108.8	G44	G44-E46 VanDerWaalsContact C-N 3.33Å; G44-E46 PolarHBondContact O-N 3.28Å
47	K	70.2	Confident	71.3	Confident	128 Å²	128	128.3 Å²	128.3	56%	0.557	74%	0.736	S	S	*	*			trans	-79.7	135.4	169.2	-68.6	178	-176.6	170	0	107.5	M45 E49 E50	M45-K47 PolarHBondContact O-N 3.01Å; K47-E49 PolarHBondContact O-N 3.15Å; K47-E50 PolarHBondContact O-N 3.41Å; K47-E50 WeakPolarHBondContact O-CB 3.46Å; K47-E50 HydrophobicContact CB-CG 4.34Å
48	E	73.4	Confident	70.9	Confident	177 Å²	177	129 Å²	129	83%	0.827	73%	0.733	S	S	*	*	H	α-helix	trans	-49.9	-32.9	177.6	-69.9	179.6	168.6	0	0	112.9	E50 M51	E48-E50 VanDerWaalsContact C-N 3.29Å; E48-E50 PolarHBondContact O-N 3.12Å; E48-M51 WeakPolarHBondContact O-CB 3.14Å; E48-M51 PolarHBondContact O-N 3.43Å
49	E	73.6	Confident	70.4	Confident	163 Å²	163	129.4 Å²	129.4	76%	0.762	73%	0.733	S	S	*	*	H	α-helix	trans	-63.4	-28.9	177.9	-63.2	176.5	178.3	0	0	113.8	K47	K47-E49 PolarHBondContact O-N 3.15Å
50	E	70.8	Confident	69.8	Low	113 Å²	113	130.8 Å²	130.8	53%	0.528	74%	0.735	S	S	.	*	H	α-helix	trans	-76.9	-26.9	178.4	-65.1	171.1	-171.6	0	0	111.5	K47 E48	K47-E50 PolarHBondContact O-N 3.41Å; K47-E50 WeakPolarHBondContact O-CB 3.46Å; K47-E50 HydrophobicContact CB-CG 4.34Å; E48-E50 VanDerWaalsContact C-N 3.29Å; E48-E50 PolarHBondContact O-N 3.12Å
51	M	67.1	Low	69.2	Low	134 Å²	134	132.8 Å²	132.8	66%	0.66	73%	0.73	S	S	*	*	H	α-helix	trans	-73.1	-33.1	178.7	-167.7	176.9	127.7	0	0	112.1	E48 A53 L54	E48-M51 WeakPolarHBondContact O-CB 3.14Å; E48-M51 PolarHBondContact O-N 3.43Å; M51-A53 VanDerWaalsContact C-N 3.3Å; M51-A53 PolarHBondContact O-N 3.18Å; M51-L54 PolarHBondContact O-N 3.32Å
52	V	67.5	Low	68.8	Low	104 Å²	104	131.7 Å²	131.7	63%	0.63	73%	0.729	S	S	*	*	H	α-helix	trans	-62.9	-38.9	-179.9	-177.7	0	0	0	0	111.1	L54 S55	V52-L54 PolarHBondContact O-N 2.97Å; V52-S55 PolarHBondContact O-N 3.16Å; V52-S55 PolarHBondContact O-OG 3.19Å
53	A	64.5	Low	68.1	Low	80 Å²	80	135.4 Å²	135.4	66%	0.661	74%	0.744	S	S	*	*	H	α-helix	trans	-66.1	-23.8	-179.5	0	0	0	0	0	114	M51	M51-A53 VanDerWaalsContact C-N 3.3Å; M51-A53 PolarHBondContact O-N 3.18Å
54	L	59.8	Low	67.5	Low	153 Å²	153	136.2 Å²	136.2	80%	0.801	74%	0.735	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.2	-10.6	178.4	-79.1	158	0	0	0	113.3	M51 V52	M51-L54 PolarHBondContact O-N 3.32Å; V52-L54 PolarHBondContact O-N 2.97Å
55	S	61.8	Low	67	Low	102 Å²	102	141.2 Å²	141.2	71%	0.713	73%	0.73	S	S	*	*			trans	-93.6	2.3	-175.7	69.8	0	0	0	0	114.9	V52	V52-S55 PolarHBondContact O-N 3.16Å; V52-S55 PolarHBondContact O-OG 3.19Å
56	M	56.1	Low	66.6	Low	238 Å²	238	140.9 Å²	140.9	100%	1.172	73%	0.732	S	S	*	*			trans	-112	0	177.9	-168	173.3	175	0	0	110.9

Retrieved 56 of 56 residues in 30.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).