A0A077ZBM7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZBM7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 71 aa.

						>A0A077ZBM7_TRITR|A0A077ZBM7
MEHVDAAFVVRSAAVLLCRLPLFFNDMRSVGSGLYQSVTLLNQKLISLIVIKAGVCMASNVMDAYSVMHWL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.6	Very low	66.5	Low	237 Å²	237	132.8 Å²	132.8	100%	1.167	69%	0.691	S	S	*	*				0	113.4	0	-81.7	176.3	163.8	0	0	106.9	H3	M1-H3 VanDerWaalsContact C-N 3.34Å; M1-H3 PolarHBondContact O-N 2.99Å
2	E	54.2	Low	67.3	Low	180 Å²	180	125.8 Å²	125.8	84%	0.841	66%	0.661	S	S	*	*			trans	-64.3	85.2	-171.8	-64.8	176	108.7	0	0	110.6	V4	E2-V4 HydrophobicContact CB-CG2 4.08Å; E2-V4 PolarHBondContact O-N 2.84Å
3	H	55.2	Low	68	Low	178 Å²	178	119.3 Å²	119.3	82%	0.824	64%	0.637	S	S	*	*			trans	-70.9	63.7	153.9	-87.7	-73.3	0	0	0	107.5	M1 D5	M1-H3 VanDerWaalsContact C-N 3.34Å; M1-H3 PolarHBondContact O-N 2.99Å; H3-D5 VanDerWaalsContact C-N 3.25Å; H3-D5 PolarHBondContact O-N 2.9Å
4	V	62.3	Low	68.7	Low	87 Å²	87	114.1 Å²	114.1	53%	0.527	62%	0.619	S	S	.	*			trans	-66.6	101.7	159.3	173.5	0	0	0	0	103.3	E2 A6 V9	E2-V4 HydrophobicContact CB-CG2 4.08Å; E2-V4 PolarHBondContact O-N 2.84Å; V4-A6 PolarHBondContact O-N 2.96Å; V4-V9 HydrophobicContact CG1-CG2 3.81Å
5	D	66.2	Low	69.2	Low	114 Å²	114	112.1 Å²	112.1	61%	0.61	61%	0.612	S	S	*	*			trans	-41.3	106	-179.2	-82.4	-75.6	0	0	0	109.2	H3 A7 F8 V9	H3-D5 VanDerWaalsContact C-N 3.25Å; H3-D5 PolarHBondContact O-N 2.9Å; D5-A7 PolarHBondContact O-N 2.82Å; D5-F8 HydrophobicContact CB-CB 4.06Å; D5-F8 WeakPolarHBondContact O-CA 3.34Å; D5-F8 WeakPolarHBondContact O-CB 3.45Å; D5-F8 PolarHBondContact O-N 3.34Å; D5-V9 PolarHBondContact O-N 2.76Å
6	A	70.5	Confident	69.3	Low	72 Å²	72	112.7 Å²	112.7	60%	0.595	61%	0.613	S	S	*	*	H	α-helix	trans	-53.1	-30	177.6	0	0	0	0	0	110.1	V4 F8 V9 V10	V4-A6 PolarHBondContact O-N 2.96Å; A6-F8 PolarHBondContact O-N 3.31Å; A6-V9 PolarHBondContact O-N 2.95Å; A6-V10 WeakPolarHBondContact O-CB 3.43Å; A6-V10 WeakPolarHBondContact O-CG2 3.37Å; A6-V10 PolarHBondContact O-N 3.29Å
7	A	73.3	Confident	69.4	Low	66 Å²	66	113.4 Å²	113.4	55%	0.545	62%	0.615	S	S	.	*	H	α-helix	trans	-58.6	-40.6	171.6	0	0	0	0	0	113.8	D5 R11	D5-A7 PolarHBondContact O-N 2.82Å; A7-R11 WeakPolarHBondContact O-CB 3.2Å; A7-R11 PolarHBondContact O-N 3.47Å
8	F	75.6	Confident	69.4	Low	147 Å²	147	111.9 Å²	111.9	65%	0.645	61%	0.614	S	S	*	*	H	α-helix	trans	-67.2	-43.1	177	-175.3	-94.8	0	0	0	111.4	D5 A6 R11 S12	D5-F8 HydrophobicContact CB-CB 4.06Å; D5-F8 WeakPolarHBondContact O-CA 3.34Å; D5-F8 WeakPolarHBondContact O-CB 3.45Å; D5-F8 PolarHBondContact O-N 3.34Å; A6-F8 PolarHBondContact O-N 3.31Å; F8-R11 PolarHBondContact O-N 3.47Å; F8-S12 WeakPolarHBondContact O-CB 3.4Å; F8-S12 PolarHBondContact O-N 2.87Å; F8-S12 PolarHBondContact O-OG 2.84Å
9	V	74.8	Confident	69	Low	80 Å²	80	115.5 Å²	115.5	49%	0.485	62%	0.617	S	S	.	*	H	α-helix	trans	-64.5	-44.3	176.5	-178.9	0	0	0	0	110.7	V4 D5 A6 S12 A13	V4-V9 HydrophobicContact CG1-CG2 3.81Å; D5-V9 PolarHBondContact O-N 2.76Å; A6-V9 PolarHBondContact O-N 2.95Å; V9-S12 PolarHBondContact O-N 3Å; V9-A13 VanDerWaalsContact O-CB 3.26Å; V9-A13 WeakPolarHBondContact O-CB 3.27Å; V9-A13 PolarHBondContact O-N 3.28Å
10	V	77.4	Confident	68.8	Low	99 Å²	99	114.6 Å²	114.6	60%	0.6	61%	0.612	S	S	*	*	H	α-helix	trans	-63.4	-44	178.3	170.1	0	0	0	0	111.4	A6 A13 A14	A6-V10 WeakPolarHBondContact O-CB 3.43Å; A6-V10 WeakPolarHBondContact O-CG2 3.37Å; A6-V10 PolarHBondContact O-N 3.29Å; V10-A13 PolarHBondContact O-N 3.13Å; V10-A14 VanDerWaalsContact O-CB 3.27Å; V10-A14 WeakPolarHBondContact O-CB 3.37Å; V10-A14 PolarHBondContact O-N 3.18Å
11	R	77.8	Confident	68.5	Low	201 Å²	201	112.7 Å²	112.7	76%	0.758	61%	0.606	S	S	*	*	H	α-helix	trans	-61.9	-44.3	174.7	-90.4	-177.7	161.9	-170.7	-3.9	112	A7 F8 A14 V15	A7-R11 WeakPolarHBondContact O-CB 3.2Å; A7-R11 PolarHBondContact O-N 3.47Å; F8-R11 PolarHBondContact O-N 3.47Å; R11-A14 PolarHBondContact O-N 3.43Å; R11-V15 WeakPolarHBondContact O-CG2 3.26Å; R11-V15 PolarHBondContact O-N 3.39Å
12	S	75.3	Confident	69.5	Low	48 Å²	48	107.5 Å²	107.5	34%	0.336	58%	0.583	S	S	.	*	H	α-helix	trans	-64.3	-43.7	178.9	-58.2	0	0	0	0	111.6	F8 V9 V15 L16	F8-S12 WeakPolarHBondContact O-CB 3.4Å; F8-S12 PolarHBondContact O-N 2.87Å; F8-S12 PolarHBondContact O-OG 2.84Å; V9-S12 PolarHBondContact O-N 3Å; S12-V15 PolarHBondContact O-N 2.85Å; S12-L16 PolarHBondContact O-N 2.89Å; S12-L16 VanDerWaalsContact O-N 3.13Å
13	A	77.1	Confident	69.8	Low	42 Å²	42	105.8 Å²	105.8	35%	0.347	57%	0.573	S	S	.	*	H	α-helix	trans	-64.1	-42.3	176	0	0	0	0	0	111.8	V9 V10 V15 L16 L17	V9-A13 VanDerWaalsContact O-CB 3.26Å; V9-A13 WeakPolarHBondContact O-CB 3.27Å; V9-A13 PolarHBondContact O-N 3.28Å; V10-A13 PolarHBondContact O-N 3.13Å; A13-V15 PolarHBondContact O-N 3.44Å; A13-L16 PolarHBondContact O-N 3.33Å; A13-L17 WeakPolarHBondContact O-CB 3.48Å; A13-L17 VanDerWaalsContact O-CG 3.27Å; A13-L17 WeakPolarHBondContact O-CG 3.48Å; A13-L17 PolarHBondContact O-N 3.49Å
14	A	77.5	Confident	70.1	Confident	47 Å²	47	103.5 Å²	103.5	39%	0.388	56%	0.561	S	S	.	*	H	α-helix	trans	-61.5	-42.6	177.1	0	0	0	0	0	112	V10 R11 L16 L17 C18	V10-A14 VanDerWaalsContact O-CB 3.27Å; V10-A14 WeakPolarHBondContact O-CB 3.37Å; V10-A14 PolarHBondContact O-N 3.18Å; R11-A14 PolarHBondContact O-N 3.43Å; A14-L16 PolarHBondContact O-N 3.46Å; A14-L17 PolarHBondContact O-N 3.42Å; A14-C18 WeakPolarHBondContact O-CB 3.48Å; A14-C18 PolarHBondContact O-N 3.07Å; A14-C18 PolarHBondContact O-SG 3.33Å; A14-C18 VanDerWaalsContact O-SG 3.37Å
15	V	76.9	Confident	70.2	Confident	84 Å²	84	104.7 Å²	104.7	51%	0.509	56%	0.564	S	S	.	*	H	α-helix	trans	-63.4	-42.1	176.6	172.9	0	0	0	0	111.4	R11 S12 A13 C18 R19	R11-V15 WeakPolarHBondContact O-CG2 3.26Å; R11-V15 PolarHBondContact O-N 3.39Å; S12-V15 PolarHBondContact O-N 2.85Å; A13-V15 PolarHBondContact O-N 3.44Å; V15-C18 PolarHBondContact O-N 2.82Å; V15-R19 WeakPolarHBondContact O-CG 3.49Å; V15-R19 PolarHBondContact O-N 3.37Å
16	L	70	Confident	70	Confident	121 Å²	121	104.3 Å²	104.3	63%	0.634	56%	0.562	S	S	*	*	H	α-helix	trans	-61.9	-46.8	174.6	-89.7	154.4	0	0	0	111.7	S12 A13 A14 C18 R19 L20	S12-L16 PolarHBondContact O-N 2.89Å; S12-L16 VanDerWaalsContact O-N 3.13Å; A13-L16 PolarHBondContact O-N 3.33Å; A14-L16 PolarHBondContact O-N 3.46Å; L16-C18 VanDerWaalsContact C-N 3.32Å; L16-C18 PolarHBondContact O-N 3.1Å; L16-R19 PolarHBondContact O-N 3.1Å; L16-L20 PolarHBondContact O-N 2.85Å; L16-L20 VanDerWaalsContact O-N 3.1Å
17	L	71	Confident	69.3	Low	124 Å²	124	106.4 Å²	106.4	65%	0.649	56%	0.561	S	S	*	*	H	α-helix	trans	-65.1	-32.2	178.7	-72.4	172.5	0	0	0	112.8	A13 A14 P21	A13-L17 WeakPolarHBondContact O-CB 3.48Å; A13-L17 VanDerWaalsContact O-CG 3.27Å; A13-L17 WeakPolarHBondContact O-CG 3.48Å; A13-L17 PolarHBondContact O-N 3.49Å; A14-L17 PolarHBondContact O-N 3.42Å; L17-P21 WeakPolarHBondContact O-CD 3.46Å
18	C	70.1	Confident	68.9	Low	88 Å²	88	112.7 Å²	112.7	60%	0.595	57%	0.57	S	S	*	*	H	α-helix	trans	-72.6	-31.3	174.2	-74.7	0	0	0	0	112.9	A14 V15 L16 P21	A14-C18 WeakPolarHBondContact O-CB 3.48Å; A14-C18 PolarHBondContact O-N 3.07Å; A14-C18 PolarHBondContact O-SG 3.33Å; A14-C18 VanDerWaalsContact O-SG 3.37Å; V15-C18 PolarHBondContact O-N 2.82Å; L16-C18 VanDerWaalsContact C-N 3.32Å; L16-C18 PolarHBondContact O-N 3.1Å; C18-P21 WeakPolarHBondContact O-CD 3.27Å; C18-P21 WeakPolarHBondContact O-CG 2.88Å
19	R	60.9	Low	68.5	Low	179 Å²	179	109.5 Å²	109.5	68%	0.675	57%	0.566	S	S	*	*	H	α-helix	trans	-80.9	-31.5	-179.1	-74.9	-175.5	175	-162.1	-0.8	113.6	V15 L16 L22 F23	V15-R19 WeakPolarHBondContact O-CG 3.49Å; V15-R19 PolarHBondContact O-N 3.37Å; L16-R19 PolarHBondContact O-N 3.1Å; R19-L22 WeakPolarHBondContact O-CB 3.4Å; R19-L22 PolarHBondContact O-N 3.2Å; R19-F23 PolarHBondContact O-N 3.42Å; R19-F23 VanDerWaalsContact O-N 3.1Å
20	L	65.6	Low	68	Low	97 Å²	97	109.6 Å²	109.6	51%	0.508	57%	0.567	S	S	.	*	H	α-helix	trans	-54.9	-51.5	178.5	-139	78.5	0	0	0	113.8	L16 L22 F23 F24	L16-L20 PolarHBondContact O-N 2.85Å; L16-L20 VanDerWaalsContact O-N 3.1Å; L20-L22 VanDerWaalsContact C-N 3.33Å; L20-L22 PolarHBondContact O-N 3.38Å; L20-F23 WeakPolarHBondContact O-CB 3.49Å; L20-F23 PolarHBondContact O-N 3.31Å; L20-F24 HydrophobicContact CD2-CE2 3.84Å; L20-F24 HydrophobicContact CG-CD2 4.22Å; L20-F24 HydrophobicContact CG-CE2 3.77Å; L20-F24 WeakPolarHBondContact O-CD2 3.16Å; L20-F24 PolarHBondContact O-N 3.42Å
21	P	62.5	Low	67.8	Low	76 Å²	76	106.6 Å²	106.6	49%	0.494	56%	0.556	S	S	.	*	H	α-helix	trans	-67.8	-31.5	-179.5	25.4	-33.2	0	0	0	112.7	L17 C18 F23 F24 N25	L17-P21 WeakPolarHBondContact O-CD 3.46Å; C18-P21 WeakPolarHBondContact O-CD 3.27Å; C18-P21 WeakPolarHBondContact O-CG 2.88Å; P21-F23 VanDerWaalsContact C-N 3.34Å; P21-F24 PolarHBondContact O-N 2.88Å; P21-N25 WeakPolarHBondContact O-CB 3.45Å; P21-N25 PolarHBondContact O-N 3.01Å
22	L	65.1	Low	67.2	Low	128 Å²	128	100.5 Å²	100.5	67%	0.67	54%	0.544	S	S	*	.	H	α-helix	trans	-60.4	-45.3	171.8	-93.1	151.2	0	0	0	110.9	R19 L20 N25 D26	R19-L22 WeakPolarHBondContact O-CB 3.4Å; R19-L22 PolarHBondContact O-N 3.2Å; L20-L22 VanDerWaalsContact C-N 3.33Å; L20-L22 PolarHBondContact O-N 3.38Å; L22-N25 PolarHBondContact O-N 3.5Å; L22-D26 PolarHBondContact O-N 3.02Å
23	F	60.6	Low	67	Low	144 Å²	144	99.6 Å²	99.6	63%	0.632	54%	0.543	S	S	*	.	H	α-helix	trans	-65.1	-41.4	177.1	-127.1	-86	0	0	0	112.6	R19 L20 P21 N25 D26 M27	R19-F23 PolarHBondContact O-N 3.42Å; R19-F23 VanDerWaalsContact O-N 3.1Å; L20-F23 WeakPolarHBondContact O-CB 3.49Å; L20-F23 PolarHBondContact O-N 3.31Å; P21-F23 VanDerWaalsContact C-N 3.34Å; F23-N25 VanDerWaalsContact C-N 3.33Å; F23-N25 PolarHBondContact O-N 3.4Å; F23-D26 PolarHBondContact O-N 3Å; F23-M27 HydrophobicContact CD1-CE 3.97Å; F23-M27 HydrophobicContact CE1-CE 4.49Å; F23-M27 PolarHBondContact O-N 3.2Å
24	F	61	Low	66.5	Low	130 Å²	130	103 Å²	103	57%	0.57	55%	0.554	S	S	*	*	H	α-helix	trans	-65.4	-36.1	175.1	-79.7	-65.4	0	0	0	112.5	L20 P21 R28	L20-F24 HydrophobicContact CD2-CE2 3.84Å; L20-F24 HydrophobicContact CG-CD2 4.22Å; L20-F24 HydrophobicContact CG-CE2 3.77Å; L20-F24 WeakPolarHBondContact O-CD2 3.16Å; L20-F24 PolarHBondContact O-N 3.42Å; P21-F24 PolarHBondContact O-N 2.88Å; F24-R28 VanDerWaalsContact O-CB 3.26Å; F24-R28 WeakPolarHBondContact O-CB 3.34Å; F24-R28 PolarHBondContact O-N 3.12Å
25	N	64.3	Low	66.2	Low	111 Å²	111	109.1 Å²	109.1	59%	0.594	57%	0.569	S	S	*	*	H	α-helix	trans	-68.3	-39.2	177	-157.2	10.7	0	0	0	111.1	P21 L22 F23 R28 S29	P21-N25 WeakPolarHBondContact O-CB 3.45Å; P21-N25 PolarHBondContact O-N 3.01Å; L22-N25 PolarHBondContact O-N 3.5Å; F23-N25 VanDerWaalsContact C-N 3.33Å; F23-N25 PolarHBondContact O-N 3.4Å; N25-R28 PolarHBondContact O-N 2.84Å; N25-S29 WeakPolarHBondContact O-CB 3.35Å; N25-S29 PolarHBondContact O-N 2.91Å
26	D	61.8	Low	66.1	Low	106 Å²	106	111.4 Å²	111.4	57%	0.567	57%	0.574	S	S	*	*	H	α-helix	trans	-62.6	-49.6	174.5	-158.9	-88.2	0	0	0	111.3	L22 F23 R28 S29 V30	L22-D26 PolarHBondContact O-N 3.02Å; F23-D26 PolarHBondContact O-N 3Å; D26-R28 VanDerWaalsContact C-N 3.29Å; D26-R28 PolarHBondContact O-N 3.3Å; D26-S29 WeakPolarHBondContact O-CB 3.26Å; D26-S29 PolarHBondContact O-N 2.86Å; D26-S29 VanDerWaalsContact O-N 3.12Å; D26-V30 WeakPolarHBondContact O-CG2 3.33Å; D26-V30 PolarHBondContact O-N 2.98Å
27	M	56.5	Low	66.2	Low	116 Å²	116	109.4 Å²	109.4	57%	0.571	57%	0.57	S	S	*	*	H	α-helix	trans	-60.5	-36.8	175.1	-72.4	-153.8	-123.9	0	0	112.9	F23 G31	F23-M27 HydrophobicContact CD1-CE 3.97Å; F23-M27 HydrophobicContact CE1-CE 4.49Å; F23-M27 PolarHBondContact O-N 3.2Å; M27-G31 PolarHBondContact O-N 2.89Å
28	R	66	Low	66.5	Low	198 Å²	198	107.9 Å²	107.9	75%	0.747	57%	0.565	S	S	*	*	H	α-helix	trans	-69.1	-38.7	176.2	-169.5	177.8	-167.2	179.3	4.4	111.7	F24 N25 D26 G31 S32	F24-R28 VanDerWaalsContact O-CB 3.26Å; F24-R28 WeakPolarHBondContact O-CB 3.34Å; F24-R28 PolarHBondContact O-N 3.12Å; N25-R28 PolarHBondContact O-N 2.84Å; D26-R28 VanDerWaalsContact C-N 3.29Å; D26-R28 PolarHBondContact O-N 3.3Å; R28-G31 PolarHBondContact O-N 3.33Å; R28-S32 WeakPolarHBondContact O-CB 3.37Å; R28-S32 PolarHBondContact O-N 2.9Å
29	S	65.8	Low	67	Low	80 Å²	80	106.8 Å²	106.8	56%	0.559	56%	0.556	S	S	*	*	H	α-helix	trans	-64.8	-46.6	176.3	-168.3	0	0	0	0	111	N25 D26 G31 S32 G33	N25-S29 WeakPolarHBondContact O-CB 3.35Å; N25-S29 PolarHBondContact O-N 2.91Å; D26-S29 WeakPolarHBondContact O-CB 3.26Å; D26-S29 PolarHBondContact O-N 2.86Å; D26-S29 VanDerWaalsContact O-N 3.12Å; S29-G31 PolarHBondContact O-N 2.78Å; S29-S32 PolarHBondContact O-N 3.3Å; S29-G33 PolarHBondContact O-N 2.83Å
30	V	65.5	Low	67.9	Low	82 Å²	82	102.5 Å²	102.5	50%	0.497	55%	0.546	S	S	.	.	H	α-helix	trans	-60.6	-45.7	173.8	175.8	0	0	0	0	110.7	D26 S32 G33 L34	D26-V30 WeakPolarHBondContact O-CG2 3.33Å; D26-V30 PolarHBondContact O-N 2.98Å; V30-S32 PolarHBondContact O-N 3.28Å; V30-G33 PolarHBondContact O-N 3.48Å; V30-L34 HydrophobicContact CG1-CD1 4.13Å; V30-L34 WeakPolarHBondContact O-CG 3.39Å; V30-L34 PolarHBondContact O-N 2.95Å
31	G	71.9	Confident	68.6	Low	36 Å²	36	103 Å²	103	37%	0.371	55%	0.549	S	S	.	.	H	α-helix	trans	-60	-43.1	176.5	0	0	0	0	0	112.9	M27 R28 S29 Y35	M27-G31 PolarHBondContact O-N 2.89Å; R28-G31 PolarHBondContact O-N 3.33Å; S29-G31 PolarHBondContact O-N 2.78Å; G31-Y35 WeakPolarHBondContact O-CB 3.38Å; G31-Y35 PolarHBondContact O-N 2.96Å
32	S	66.6	Low	69.4	Low	73 Å²	73	103.6 Å²	103.6	51%	0.51	55%	0.548	S	S	.	.	H	α-helix	trans	-66.1	-40.5	177	-168.6	0	0	0	0	112	R28 S29 V30 Y35 Q36	R28-S32 WeakPolarHBondContact O-CB 3.37Å; R28-S32 PolarHBondContact O-N 2.9Å; S29-S32 PolarHBondContact O-N 3.3Å; V30-S32 PolarHBondContact O-N 3.28Å; S32-Y35 PolarHBondContact O-N 3.45Å; S32-Q36 VanDerWaalsContact O-CB 3.29Å; S32-Q36 WeakPolarHBondContact O-CB 3.48Å; S32-Q36 PolarHBondContact O-N 2.96Å
33	G	70.1	Confident	70.4	Confident	30 Å²	30	104 Å²	104	31%	0.309	55%	0.546	S	S	.	.	H	α-helix	trans	-66.6	-40.9	178.3	0	0	0	0	0	112.8	S29 V30 S37	S29-G33 PolarHBondContact O-N 2.83Å; V30-G33 PolarHBondContact O-N 3.48Å; G33-S37 WeakPolarHBondContact O-CB 3.33Å; G33-S37 PolarHBondContact O-N 3.41Å; G33-S37 PolarHBondContact O-OG 3.42Å
34	L	66.2	Low	71.5	Confident	112 Å²	112	103.7 Å²	103.7	59%	0.586	55%	0.545	S	S	*	.	H	α-helix	trans	-64.8	-45.9	173.2	-70.5	174.2	0	0	0	111.3	V30 Q36 S37 V38	V30-L34 HydrophobicContact CG1-CD1 4.13Å; V30-L34 WeakPolarHBondContact O-CG 3.39Å; V30-L34 PolarHBondContact O-N 2.95Å; L34-Q36 PolarHBondContact O-N 3.46Å; L34-S37 PolarHBondContact O-N 2.87Å; L34-V38 WeakPolarHBondContact O-CG2 3.32Å; L34-V38 PolarHBondContact O-N 2.93Å
35	Y	71.1	Confident	72.5	Confident	177 Å²	177	101.7 Å²	101.7	69%	0.694	54%	0.539	S	S	*	.	H	α-helix	trans	-58.9	-47.5	176.9	-171.7	-96.9	0	0	0	111.2	G31 S32 S37 V38 T39	G31-Y35 WeakPolarHBondContact O-CB 3.38Å; G31-Y35 PolarHBondContact O-N 2.96Å; S32-Y35 PolarHBondContact O-N 3.45Å; Y35-S37 VanDerWaalsContact C-N 3.33Å; Y35-S37 PolarHBondContact O-N 3.29Å; Y35-V38 PolarHBondContact O-N 3.4Å; Y35-T39 WeakPolarHBondContact O-CB 3.29Å; Y35-T39 PolarHBondContact O-N 3.25Å; Y35-T39 PolarHBondContact O-OG1 3.43Å
36	Q	76.6	Confident	73.4	Confident	132 Å²	132	100.9 Å²	100.9	62%	0.617	53%	0.534	S	S	*	.	H	α-helix	trans	-61.3	-41	177.9	-170.6	173.1	23	0	0	112.3	S32 L34 T39 L40	S32-Q36 VanDerWaalsContact O-CB 3.29Å; S32-Q36 WeakPolarHBondContact O-CB 3.48Å; S32-Q36 PolarHBondContact O-N 2.96Å; L34-Q36 PolarHBondContact O-N 3.46Å; Q36-T39 PolarHBondContact O-N 2.88Å; Q36-L40 WeakPolarHBondContact O-CB 3.36Å; Q36-L40 PolarHBondContact O-N 2.98Å
37	S	71.8	Confident	74.5	Confident	78 Å²	78	98.7 Å²	98.7	55%	0.545	53%	0.527	S	S	.	.	H	α-helix	trans	-65.4	-42.8	177.7	-59.7	0	0	0	0	112	G33 L34 Y35 L40 L41	G33-S37 WeakPolarHBondContact O-CB 3.33Å; G33-S37 PolarHBondContact O-N 3.41Å; G33-S37 PolarHBondContact O-OG 3.42Å; L34-S37 PolarHBondContact O-N 2.87Å; Y35-S37 VanDerWaalsContact C-N 3.33Å; Y35-S37 PolarHBondContact O-N 3.29Å; S37-L40 PolarHBondContact O-N 3.08Å; S37-L41 WeakPolarHBondContact O-CB 3.4Å; S37-L41 PolarHBondContact O-N 2.87Å
38	V	77.4	Confident	75.6	Confident	92 Å²	92	98.6 Å²	98.6	56%	0.558	53%	0.528	S	S	*	.	H	α-helix	trans	-65.7	-42.6	176.1	172.9	0	0	0	0	110.8	L34 Y35 L40 L41 N42	L34-V38 WeakPolarHBondContact O-CG2 3.32Å; L34-V38 PolarHBondContact O-N 2.93Å; Y35-V38 PolarHBondContact O-N 3.4Å; V38-L40 VanDerWaalsContact C-N 3.35Å; V38-L40 PolarHBondContact O-N 3.5Å; V38-L41 PolarHBondContact O-N 3.34Å; V38-N42 VanDerWaalsContact O-CB 3.26Å; V38-N42 WeakPolarHBondContact O-CB 3.47Å; V38-N42 PolarHBondContact O-N 2.95Å
39	T	79.8	Confident	76.4	Confident	65 Å²	65	94.5 Å²	94.5	40%	0.399	52%	0.52	S	S	.	.	H	α-helix	trans	-60.3	-44.4	175.6	-59.8	0	0	0	0	111.4	Y35 Q36 N42 Q43	Y35-T39 WeakPolarHBondContact O-CB 3.29Å; Y35-T39 PolarHBondContact O-N 3.25Å; Y35-T39 PolarHBondContact O-OG1 3.43Å; Q36-T39 PolarHBondContact O-N 2.88Å; T39-N42 PolarHBondContact O-N 2.95Å; T39-Q43 WeakPolarHBondContact O-CB 3.48Å; T39-Q43 PolarHBondContact O-N 3.38Å
40	L	79.3	Confident	77	Confident	89 Å²	89	95.1 Å²	95.1	47%	0.466	52%	0.52	S	S	.	.	H	α-helix	trans	-68.6	-38	-179.5	-159.6	142.7	0	0	0	111.9	Q36 S37 V38 Q43 K44	Q36-L40 WeakPolarHBondContact O-CB 3.36Å; Q36-L40 PolarHBondContact O-N 2.98Å; S37-L40 PolarHBondContact O-N 3.08Å; V38-L40 VanDerWaalsContact C-N 3.35Å; V38-L40 PolarHBondContact O-N 3.5Å; L40-Q43 PolarHBondContact O-N 3.41Å; L40-K44 HydrophobicContact CD2-CD 4.26Å; L40-K44 WeakPolarHBondContact O-CG 3.44Å; L40-K44 PolarHBondContact O-N 3.46Å; L40-K44 VanDerWaalsContact O-N 3.08Å
41	L	81	Confident	77.5	Confident	108 Å²	108	96 Å²	96	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-64.3	-45.5	172.4	-176.4	66.7	0	0	0	111.5	S37 V38 Q43 K44 L45	S37-L41 WeakPolarHBondContact O-CB 3.4Å; S37-L41 PolarHBondContact O-N 2.87Å; V38-L41 PolarHBondContact O-N 3.34Å; L41-Q43 VanDerWaalsContact C-N 3.32Å; L41-Q43 PolarHBondContact O-N 3.48Å; L41-K44 PolarHBondContact O-N 3.39Å; L41-L45 HydrophobicContact CG-CD1 4.34Å; L41-L45 WeakPolarHBondContact O-CG 3.39Å; L41-L45 PolarHBondContact O-N 2.85Å
42	N	79.8	Confident	77.7	Confident	88 Å²	88	101.5 Å²	101.5	47%	0.471	54%	0.535	S	S	.	.	H	α-helix	trans	-62.7	-40.6	178.2	-163	-3.2	0	0	0	111.1	V38 T39 K44 L45 I46	V38-N42 VanDerWaalsContact O-CB 3.26Å; V38-N42 WeakPolarHBondContact O-CB 3.47Å; V38-N42 PolarHBondContact O-N 2.95Å; T39-N42 PolarHBondContact O-N 2.95Å; N42-K44 PolarHBondContact O-N 3Å; N42-L45 PolarHBondContact O-N 3.45Å; N42-I46 WeakPolarHBondContact O-CG1 3.26Å; N42-I46 PolarHBondContact O-N 3.45Å
43	Q	86.2	Confident	78	Confident	136 Å²	136	100.6 Å²	100.6	64%	0.636	53%	0.531	S	S	*	.	H	α-helix	trans	-62.2	-41.4	175.1	-168.2	173.1	18.3	0	0	112.4	T39 L40 L41 S47	T39-Q43 WeakPolarHBondContact O-CB 3.48Å; T39-Q43 PolarHBondContact O-N 3.38Å; L40-Q43 PolarHBondContact O-N 3.41Å; L41-Q43 VanDerWaalsContact C-N 3.32Å; L41-Q43 PolarHBondContact O-N 3.48Å; Q43-S47 WeakPolarHBondContact O-CB 3.33Å; Q43-S47 PolarHBondContact O-N 3.26Å
44	K	82.6	Confident	78.1	Confident	139 Å²	139	101.1 Å²	101.1	60%	0.604	54%	0.537	S	S	*	.	H	α-helix	trans	-64.2	-41.5	173.9	-75.3	-178.5	176.3	-176.9	0	112.2	L40 L41 N42 S47 L48	L40-K44 HydrophobicContact CD2-CD 4.26Å; L40-K44 WeakPolarHBondContact O-CG 3.44Å; L40-K44 PolarHBondContact O-N 3.46Å; L40-K44 VanDerWaalsContact O-N 3.08Å; L41-K44 PolarHBondContact O-N 3.39Å; N42-K44 PolarHBondContact O-N 3Å; K44-S47 PolarHBondContact O-N 2.98Å; K44-L48 PolarHBondContact O-N 3.23Å
45	L	82.4	Confident	77.9	Confident	88 Å²	88	99.9 Å²	99.9	46%	0.461	53%	0.534	S	S	.	.	H	α-helix	trans	-62.7	-46.2	177.2	-76.1	169.1	0	0	0	111.7	L41 N42 S47 L48 I49	L41-L45 HydrophobicContact CG-CD1 4.34Å; L41-L45 WeakPolarHBondContact O-CG 3.39Å; L41-L45 PolarHBondContact O-N 2.85Å; N42-L45 PolarHBondContact O-N 3.45Å; L45-S47 VanDerWaalsContact C-N 3.35Å; L45-S47 PolarHBondContact O-N 3.38Å; L45-L48 PolarHBondContact O-N 2.92Å; L45-I49 VanDerWaalsContact O-CG1 3.3Å; L45-I49 WeakPolarHBondContact O-CG1 3.3Å; L45-I49 PolarHBondContact O-N 3.23Å
46	I	83.9	Confident	77.3	Confident	93 Å²	93	95.2 Å²	95.2	48%	0.477	53%	0.526	S	S	.	.	H	α-helix	trans	-60.5	-46	176.3	-67.1	165.8	0	0	0	110.4	N42 L48 I49 V50	N42-I46 WeakPolarHBondContact O-CG1 3.26Å; N42-I46 PolarHBondContact O-N 3.45Å; I46-L48 VanDerWaalsContact C-N 3.31Å; I46-L48 PolarHBondContact O-N 3.43Å; I46-I49 PolarHBondContact O-N 2.93Å; I46-V50 HydrophobicContact CG2-CG2 4.32Å; I46-V50 WeakPolarHBondContact O-CG2 3.24Å; I46-V50 PolarHBondContact O-N 2.89Å
47	S	84.5	Confident	76.4	Confident	60 Å²	60	95.5 Å²	95.5	42%	0.42	53%	0.529	S	S	.	.	H	α-helix	trans	-57.8	-44.1	177.2	-177.6	0	0	0	0	111.9	Q43 K44 L45 V50 I51	Q43-S47 WeakPolarHBondContact O-CB 3.33Å; Q43-S47 PolarHBondContact O-N 3.26Å; K44-S47 PolarHBondContact O-N 2.98Å; L45-S47 VanDerWaalsContact C-N 3.35Å; L45-S47 PolarHBondContact O-N 3.38Å; S47-V50 PolarHBondContact O-N 2.95Å; S47-I51 WeakPolarHBondContact O-CD1 3.38Å; S47-I51 VanDerWaalsContact O-CG1 3.24Å; S47-I51 WeakPolarHBondContact O-CG1 3.32Å; S47-I51 PolarHBondContact O-N 3.49Å
48	L	78.9	Confident	75.7	Confident	115 Å²	115	94.5 Å²	94.5	60%	0.602	53%	0.525	S	S	*	.	H	α-helix	trans	-64.7	-41	177.6	-168.8	72.2	0	0	0	112.4	K44 L45 I46 I51 K52	K44-L48 PolarHBondContact O-N 3.23Å; L45-L48 PolarHBondContact O-N 2.92Å; I46-L48 VanDerWaalsContact C-N 3.31Å; I46-L48 PolarHBondContact O-N 3.43Å; L48-I51 PolarHBondContact O-N 3.3Å; L48-K52 WeakPolarHBondContact O-CB 3.37Å; L48-K52 PolarHBondContact O-N 2.92Å
49	I	82.2	Confident	74.9	Confident	112 Å²	112	93.7 Å²	93.7	57%	0.574	52%	0.524	S	S	*	.	H	α-helix	trans	-62.7	-45.4	176.7	-69.3	165.2	0	0	0	110.4	L45 I46 K52 A53	L45-I49 VanDerWaalsContact O-CG1 3.3Å; L45-I49 WeakPolarHBondContact O-CG1 3.3Å; L45-I49 PolarHBondContact O-N 3.23Å; I46-I49 PolarHBondContact O-N 2.93Å; I49-K52 PolarHBondContact O-N 2.86Å; I49-A53 WeakPolarHBondContact O-CB 3.5Å; I49-A53 PolarHBondContact O-N 3.37Å
50	V	78.9	Confident	73.8	Confident	93 Å²	93	96.2 Å²	96.2	56%	0.564	54%	0.535	S	S	*	.	H	α-helix	trans	-63.4	-44	178.2	173.2	0	0	0	0	110.9	I46 S47 K52 A53 G54	I46-V50 HydrophobicContact CG2-CG2 4.32Å; I46-V50 WeakPolarHBondContact O-CG2 3.24Å; I46-V50 PolarHBondContact O-N 2.89Å; S47-V50 PolarHBondContact O-N 2.95Å; V50-K52 PolarHBondContact O-N 3.21Å; V50-A53 PolarHBondContact O-N 3.39Å; V50-G54 PolarHBondContact O-N 2.85Å
51	I	76.8	Confident	72.7	Confident	99 Å²	99	96.2 Å²	96.2	51%	0.508	54%	0.538	S	S	.	.	H	α-helix	trans	-60.3	-47.2	175.5	-68.9	164.3	0	0	0	110.1	S47 L48 A53 G54 V55	S47-I51 WeakPolarHBondContact O-CD1 3.38Å; S47-I51 VanDerWaalsContact O-CG1 3.24Å; S47-I51 WeakPolarHBondContact O-CG1 3.32Å; S47-I51 PolarHBondContact O-N 3.49Å; L48-I51 PolarHBondContact O-N 3.3Å; I51-A53 PolarHBondContact O-N 3.38Å; I51-G54 PolarHBondContact O-N 3.25Å; I51-V55 HydrophobicContact CG2-CG2 4.34Å; I51-V55 VanDerWaalsContact O-CG2 3.3Å; I51-V55 WeakPolarHBondContact O-CG2 3.46Å; I51-V55 PolarHBondContact O-N 2.86Å
52	K	75.6	Confident	71.5	Confident	153 Å²	153	97.4 Å²	97.4	67%	0.665	54%	0.543	S	S	*	.	H	α-helix	trans	-62.6	-43.1	179.4	-171.7	172.8	-178.5	176.1	0	111.9	L48 I49 V50 V55 C56	L48-K52 WeakPolarHBondContact O-CB 3.37Å; L48-K52 PolarHBondContact O-N 2.92Å; I49-K52 PolarHBondContact O-N 2.86Å; V50-K52 PolarHBondContact O-N 3.21Å; K52-V55 PolarHBondContact O-N 3.46Å; K52-C56 WeakPolarHBondContact O-CB 3.3Å; K52-C56 PolarHBondContact O-N 3.32Å; K52-C56 PolarHBondContact O-SG 2.9Å
53	A	72.5	Confident	70.4	Confident	53 Å²	53	98.4 Å²	98.4	44%	0.438	55%	0.548	S	S	.	.	H	α-helix	trans	-63.4	-41.2	175.8	0	0	0	0	0	111.9	I49 V50 I51 C56 M57	I49-A53 WeakPolarHBondContact O-CB 3.5Å; I49-A53 PolarHBondContact O-N 3.37Å; V50-A53 PolarHBondContact O-N 3.39Å; I51-A53 PolarHBondContact O-N 3.38Å; A53-C56 PolarHBondContact O-N 3.18Å; A53-M57 WeakPolarHBondContact O-CB 3.32Å; A53-M57 WeakPolarHBondContact O-CG 3.38Å; A53-M57 PolarHBondContact O-N 2.97Å
54	G	71.8	Confident	69	Low	42 Å²	42	94.6 Å²	94.6	43%	0.433	54%	0.54	S	S	.	.	H	α-helix	trans	-63.2	-43.3	175	0	0	0	0	0	112.7	V50 I51 M57 A58	V50-G54 PolarHBondContact O-N 2.85Å; I51-G54 PolarHBondContact O-N 3.25Å; G54-M57 PolarHBondContact O-N 3.48Å; G54-A58 WeakPolarHBondContact O-CB 3.41Å; G54-A58 PolarHBondContact O-N 3.32Å
55	V	63.6	Low	67.7	Low	86 Å²	86	96 Å²	96	52%	0.521	54%	0.542	S	S	.	.	H	α-helix	trans	-65.4	-42	175.4	173.7	0	0	0	0	111	I51 K52 M57 A58 S59	I51-V55 HydrophobicContact CG2-CG2 4.34Å; I51-V55 VanDerWaalsContact O-CG2 3.3Å; I51-V55 WeakPolarHBondContact O-CG2 3.46Å; I51-V55 PolarHBondContact O-N 2.86Å; K52-V55 PolarHBondContact O-N 3.46Å; V55-M57 PolarHBondContact O-N 3.38Å; V55-A58 PolarHBondContact O-N 3.49Å; V55-S59 WeakPolarHBondContact O-CB 3.4Å; V55-S59 PolarHBondContact O-N 2.91Å
56	C	58.6	Low	66.4	Low	78 Å²	78	95 Å²	95	53%	0.527	54%	0.543	S	S	.	.	H	α-helix	trans	-62.1	-42.2	175	-73.3	0	0	0	0	112.1	K52 A53 N60	K52-C56 WeakPolarHBondContact O-CB 3.3Å; K52-C56 PolarHBondContact O-N 3.32Å; K52-C56 PolarHBondContact O-SG 2.9Å; A53-C56 PolarHBondContact O-N 3.18Å; C56-N60 WeakPolarHBondContact O-CB 3.31Å; C56-N60 PolarHBondContact O-N 3.36Å
57	M	57.4	Low	65.1	Low	139 Å²	139	94.6 Å²	94.6	69%	0.685	54%	0.544	S	S	*	.	H	α-helix	trans	-64.6	-45.3	174.9	-77.9	-85.2	158.5	0	0	111.5	A53 G54 V55 S59 N60 V61	A53-M57 WeakPolarHBondContact O-CB 3.32Å; A53-M57 WeakPolarHBondContact O-CG 3.38Å; A53-M57 PolarHBondContact O-N 2.97Å; G54-M57 PolarHBondContact O-N 3.48Å; V55-M57 PolarHBondContact O-N 3.38Å; M57-S59 PolarHBondContact O-N 3.34Å; M57-N60 PolarHBondContact O-N 2.92Å; M57-V61 WeakPolarHBondContact O-CG2 3.4Å; M57-V61 PolarHBondContact O-N 2.88Å
58	A	57.2	Low	63.7	Low	56 Å²	56	98.8 Å²	98.8	46%	0.463	56%	0.559	S	S	.	*	H	α-helix	trans	-63.3	-41.7	177.8	0	0	0	0	0	112	G54 V55 N60 V61 M62	G54-A58 WeakPolarHBondContact O-CB 3.41Å; G54-A58 PolarHBondContact O-N 3.32Å; V55-A58 PolarHBondContact O-N 3.49Å; A58-N60 VanDerWaalsContact C-N 3.34Å; A58-V61 PolarHBondContact O-N 2.82Å; A58-M62 WeakPolarHBondContact O-CB 3.36Å; A58-M62 VanDerWaalsContact O-CG 3.31Å; A58-M62 WeakPolarHBondContact O-CG 3.44Å; A58-M62 PolarHBondContact O-N 3.37Å
59	S	59.4	Low	62.4	Low	75 Å²	75	100.5 Å²	100.5	52%	0.524	56%	0.564	S	S	.	*	H	α-helix	trans	-60.8	-42.2	172.3	-89.6	0	0	0	0	111.6	V55 M57 V61 M62 D63	V55-S59 WeakPolarHBondContact O-CB 3.4Å; V55-S59 PolarHBondContact O-N 2.91Å; M57-S59 PolarHBondContact O-N 3.34Å; S59-V61 VanDerWaalsContact C-N 3.35Å; S59-V61 PolarHBondContact O-N 2.84Å; S59-M62 PolarHBondContact O-N 2.96Å; S59-D63 WeakPolarHBondContact O-CB 3.39Å; S59-D63 PolarHBondContact O-N 3.48Å
60	N	57.4	Low	61.2	Low	118 Å²	118	105.7 Å²	105.7	63%	0.631	58%	0.576	S	S	*	*	H	α-helix	trans	-67.7	-35.1	179.8	-157.7	72.1	0	0	0	112.4	C56 M57 A58 A64	C56-N60 WeakPolarHBondContact O-CB 3.31Å; C56-N60 PolarHBondContact O-N 3.36Å; M57-N60 PolarHBondContact O-N 2.92Å; A58-N60 VanDerWaalsContact C-N 3.34Å; N60-A64 WeakPolarHBondContact O-CB 3.46Å; N60-A64 PolarHBondContact O-N 3.41Å; N60-A64 VanDerWaalsContact O-N 3.12Å
61	V	56	Low	59.9	Low	89 Å²	89	110.9 Å²	110.9	54%	0.539	60%	0.6	S	S	.	*	H	α-helix	trans	-70.7	-40.5	173.7	177.9	0	0	0	0	111.2	M57 A58 S59 A64 Y65	M57-V61 WeakPolarHBondContact O-CG2 3.4Å; M57-V61 PolarHBondContact O-N 2.88Å; A58-V61 PolarHBondContact O-N 2.82Å; S59-V61 VanDerWaalsContact C-N 3.35Å; S59-V61 PolarHBondContact O-N 2.84Å; V61-A64 PolarHBondContact O-N 2.93Å; V61-Y65 WeakPolarHBondContact O-CB 3.47Å; V61-Y65 PolarHBondContact O-N 3.42Å
62	M	56.6	Low	59	Low	134 Å²	134	111.5 Å²	111.5	66%	0.66	60%	0.604	S	S	*	*	H	α-helix	trans	-64.9	-38.3	176	-77	-79	132	0	0	112.3	A58 S59 Y65 S66	A58-M62 WeakPolarHBondContact O-CB 3.36Å; A58-M62 VanDerWaalsContact O-CG 3.31Å; A58-M62 WeakPolarHBondContact O-CG 3.44Å; A58-M62 PolarHBondContact O-N 3.37Å; S59-M62 PolarHBondContact O-N 2.96Å; M62-Y65 PolarHBondContact O-N 3.12Å; M62-S66 WeakPolarHBondContact O-CB 3.43Å; M62-S66 PolarHBondContact O-N 3.2Å
63	D	55.5	Low	58.1	Low	109 Å²	109	109.3 Å²	109.3	58%	0.583	60%	0.601	S	S	*	*	H	α-helix	trans	-64.6	-47.4	175.2	-158.1	-79.9	0	0	0	110.6	S59 Y65 S66 V67	S59-D63 WeakPolarHBondContact O-CB 3.39Å; S59-D63 PolarHBondContact O-N 3.48Å; D63-Y65 VanDerWaalsContact C-N 3.32Å; D63-Y65 PolarHBondContact O-N 3.33Å; D63-S66 WeakPolarHBondContact O-CB 3.44Å; D63-S66 PolarHBondContact O-N 2.96Å; D63-V67 WeakPolarHBondContact O-CG2 3.4Å; D63-V67 PolarHBondContact O-N 2.93Å
64	A	56.9	Low	57.3	Low	55 Å²	55	112.4 Å²	112.4	46%	0.455	61%	0.61	S	S	.	*	H	α-helix	trans	-60.5	-38.6	175.4	0	0	0	0	0	113	N60 V61 V67 M68	N60-A64 WeakPolarHBondContact O-CB 3.46Å; N60-A64 PolarHBondContact O-N 3.41Å; N60-A64 VanDerWaalsContact O-N 3.12Å; V61-A64 PolarHBondContact O-N 2.93Å; A64-V67 PolarHBondContact O-N 3.42Å; A64-M68 WeakPolarHBondContact O-CB 3.36Å; A64-M68 PolarHBondContact O-N 3.47Å
65	Y	55.4	Low	56.5	Low	169 Å²	169	116.5 Å²	116.5	66%	0.663	62%	0.621	S	S	*	*	H	α-helix	trans	-69.8	-38.7	177.7	-145.7	-90.2	0	0	0	111.9	V61 M62 D63 V67 M68 H69	V61-Y65 WeakPolarHBondContact O-CB 3.47Å; V61-Y65 PolarHBondContact O-N 3.42Å; M62-Y65 PolarHBondContact O-N 3.12Å; D63-Y65 VanDerWaalsContact C-N 3.32Å; D63-Y65 PolarHBondContact O-N 3.33Å; Y65-V67 VanDerWaalsContact C-N 3.33Å; Y65-M68 PolarHBondContact O-N 3.35Å; Y65-H69 WeakPolarHBondContact O-CB 3.48Å; Y65-H69 PolarHBondContact O-N 2.98Å
66	S	54.9	Low	56.1	Low	67 Å²	67	118.4 Å²	118.4	47%	0.469	63%	0.627	S	S	.	*	H	α-helix	trans	-60.8	-42.7	173.1	176.8	0	0	0	0	111.3	M62 D63 W70	M62-S66 WeakPolarHBondContact O-CB 3.43Å; M62-S66 PolarHBondContact O-N 3.2Å; D63-S66 WeakPolarHBondContact O-CB 3.44Å; D63-S66 PolarHBondContact O-N 2.96Å; S66-W70 PolarHBondContact O-N 2.93Å
67	V	56.9	Low	55.9	Low	84 Å²	84	121.1 Å²	121.1	51%	0.509	63%	0.633	S	S	.	*	H	α-helix	trans	-67.6	-39.8	177.4	177.4	0	0	0	0	111.5	D63 A64 Y65 W70	D63-V67 WeakPolarHBondContact O-CG2 3.4Å; D63-V67 PolarHBondContact O-N 2.93Å; A64-V67 PolarHBondContact O-N 3.42Å; Y65-V67 VanDerWaalsContact C-N 3.33Å; V67-W70 PolarHBondContact O-N 3.42Å
68	M	55.7	Low	55.8	Low	148 Å²	148	119.9 Å²	119.9	73%	0.729	63%	0.63	S	S	*	*	H	α-helix	trans	-69	-34	177.6	-85.6	-86	179.8	0	0	113.5	A64 Y65 W70	A64-M68 WeakPolarHBondContact O-CB 3.36Å; A64-M68 PolarHBondContact O-N 3.47Å; Y65-M68 PolarHBondContact O-N 3.35Å; M68-W70 VanDerWaalsContact C-N 3.25Å; M68-W70 PolarHBondContact O-N 3.44Å
69	H	52.2	Low	55.7	Low	151 Å²	151	124.8 Å²	124.8	70%	0.699	64%	0.643	S	S	*	*	H	α-helix	trans	-74.1	-16.9	179.2	-173.8	-88.7	0	0	0	113.1	Y65	Y65-H69 WeakPolarHBondContact O-CB 3.48Å; Y65-H69 PolarHBondContact O-N 2.98Å
70	W	56.2	Low	55.4	Low	222 Å²	222	128.9 Å²	128.9	84%	0.841	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	-3	178.5	-89.3	92.3	0	0	0	114.4	S66 V67 M68	S66-W70 PolarHBondContact O-N 2.93Å; V67-W70 PolarHBondContact O-N 3.42Å; M68-W70 VanDerWaalsContact C-N 3.25Å; M68-W70 PolarHBondContact O-N 3.44Å
71	L	50.8	Low	55.2	Low	201 Å²	201	129.9 Å²	129.9	100%	1.052	65%	0.654	S	S	*	*			trans	-104.2	0	173.7	-89.4	161.2	0	0	0	110.9

Retrieved 71 of 71 residues in 12.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).