A0A077ZBY3_TRITR Loading...

DUF2450 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZBY3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 110 aa.

						>A0A077ZBY3_TRITR|A0A077ZBY3
MSMVSRSDVVQITEKEVLESIESEYFSPILPTVLDINQINADRKKIRQQLAVITRKVSDLILEQHPSFSAQMQDVANLKGSVEEVHAACLAARQRLHTIPHFPYSEFCQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.1	Very low	54.2	Low	247 Å²	247	151.1 Å²	151.1	100%	1.217	82%	0.817	S	S	*	*				0	98.9	0	-76.6	157.8	108.5	0	0	107.4
2	S	50.3	Low	55.7	Low	112 Å²	112	147.8 Å²	147.8	78%	0.783	80%	0.797	S	S	*	*			trans	-91	120.4	-176.3	136.3	0	0	0	0	108.7	V4	S2-V4 PolarHBondContact O-N 2.93Å
3	M	50	Low	57.6	Low	183 Å²	183	141.9 Å²	141.9	90%	0.901	77%	0.769	S	S	*	*			trans	-70	111.9	171.9	-71	-173.2	162.3	0	0	108.8	S5	M3-S5 PolarHBondContact O-N 3.2Å
4	V	57.4	Low	59.4	Low	130 Å²	130	142.9 Å²	142.9	79%	0.788	77%	0.766	S	S	*	*			trans	-74.1	109.5	165.7	178.6	0	0	0	0	106.8	S2 R6	S2-V4 PolarHBondContact O-N 2.93Å; V4-R6 PolarHBondContact O-N 3Å
5	S	48.5	Very low	61.1	Low	96 Å²	96	142.7 Å²	142.7	67%	0.671	76%	0.755	S	S	*	*			trans	-54.4	119.5	173.8	-69.9	0	0	0	0	110.1	M3 S7	M3-S5 PolarHBondContact O-N 3.2Å; S5-S7 PolarHBondContact O-N 3.18Å
6	R	56.5	Low	62.7	Low	232 Å²	232	139.8 Å²	139.8	88%	0.875	74%	0.736	S	S	*	*	G	3₁₀ helix	trans	-68.9	10.7	178.8	-98.4	179.5	171.9	177.7	-2.9	114.5	V4 D8	V4-R6 PolarHBondContact O-N 3Å; R6-D8 PolarHBondContact O-N 3.45Å
7	S	53.8	Low	64.1	Low	103 Å²	103	135.5 Å²	135.5	72%	0.72	72%	0.717	S	S	*	*	G	3₁₀ helix	trans	-83.1	-6.8	-161.5	-51.6	0	0	0	0	115.9	S5	S5-S7 PolarHBondContact O-N 3.18Å
8	D	49	Very low	65.3	Low	155 Å²	155	132.8 Å²	132.8	83%	0.829	70%	0.702	S	S	*	*	G	3₁₀ helix	trans	-110.1	11.8	179.4	-62.6	-33.6	0	0	0	113.8	R6 V10	R6-D8 PolarHBondContact O-N 3.45Å; D8-V10 PolarHBondContact O-N 2.93Å
9	V	55.9	Low	66.4	Low	109 Å²	109	131.1 Å²	131.1	66%	0.661	69%	0.69	S	S	*	*			trans	-77.4	97.6	170.4	-174.2	0	0	0	0	107.4	Q11	V9-Q11 PolarHBondContact O-N 3.46Å
10	V	64.9	Low	67.3	Low	115 Å²	115	127.8 Å²	127.8	70%	0.697	68%	0.678	S	S	*	*			trans	-45.9	115.5	166.2	177.5	0	0	0	0	106.9	D8 I12	D8-V10 PolarHBondContact O-N 2.93Å; V10-I12 HydrophobicContact CG1-CG1 4.18Å; V10-I12 PolarHBondContact O-N 3.41Å
11	Q	66.9	Low	67.9	Low	180 Å²	180	125.4 Å²	125.4	84%	0.841	67%	0.665	S	S	*	*			trans	-70.7	79.6	177.3	-71.7	-169.1	-16.1	0	0	107.9	V9 T13	V9-Q11 PolarHBondContact O-N 3.46Å; Q11-T13 PolarHBondContact O-N 3.23Å; Q11-T13 VanDerWaalsContact O-N 3.13Å
12	I	71.8	Confident	69.7	Low	112 Å²	112	119.2 Å²	119.2	57%	0.574	63%	0.633	S	S	*	*			trans	-64.3	115	169.2	-54.2	175.8	0	0	0	105.6	V10 E16 V17	V10-I12 HydrophobicContact CG1-CG1 4.18Å; V10-I12 PolarHBondContact O-N 3.41Å; I12-E16 WeakPolarHBondContact CA-OE2 3.46Å; I12-E16 HydrophobicContact CG2-CB 3.86Å; I12-V17 HydrophobicContact CG2-CG2 3.6Å
13	T	80.6	Confident	71.1	Confident	71 Å²	71	117.9 Å²	117.9	44%	0.436	62%	0.624	S	S	.	*			trans	-69.3	149.6	178.6	60.6	0	0	0	0	109.4	Q11 K15 E16 V17	Q11-T13 PolarHBondContact O-N 3.23Å; Q11-T13 VanDerWaalsContact O-N 3.13Å; T13-K15 PolarHBondContact O-N 3.35Å; T13-K15 VanDerWaalsContact O-N 3.09Å; T13-E16 PolarHBondContact N-OE2 2.86Å; T13-E16 PolarHBondContact O-N 3.47Å; T13-E16 VanDerWaalsContact OG1-CD 3.31Å; T13-E16 VanDerWaalsContact OG1-CG 3.26Å; T13-E16 WeakPolarHBondContact OG1-CG 3.39Å; T13-E16 PolarHBondContact OG1-N 2.85Å; T13-E16 PolarHBondContact OG1-OE2 3.03Å; T13-V17 PolarHBondContact O-N 2.96Å; T13-V17 VanDerWaalsContact O-N 3.16Å
14	E	82.8	Confident	72.4	Confident	156 Å²	156	116.2 Å²	116.2	73%	0.729	61%	0.614	S	S	*	*	H	α-helix	trans	-51.2	-35.8	174	-177.7	178.9	176.8	0	0	111.5	V17 L18	E14-V17 PolarHBondContact O-N 3.2Å; E14-L18 HydrophobicContact CG-CD1 4.18Å; E14-L18 VanDerWaalsContact O-CG 3.31Å; E14-L18 WeakPolarHBondContact O-CG 3.04Å; E14-L18 PolarHBondContact O-N 3.43Å
15	K	85.6	Confident	72.8	Confident	139 Å²	139	118.5 Å²	118.5	60%	0.604	61%	0.609	S	S	*	*	H	α-helix	trans	-62.6	-44.3	176.5	-169.8	178.4	174.6	-170	0	113	T13 V17 L18 E19	T13-K15 PolarHBondContact O-N 3.35Å; T13-K15 VanDerWaalsContact O-N 3.09Å; K15-V17 VanDerWaalsContact C-N 3.33Å; K15-V17 PolarHBondContact O-N 3.38Å; K15-L18 PolarHBondContact O-N 2.85Å; K15-E19 WeakPolarHBondContact CE-OE1 3.34Å; K15-E19 IonicContact NZ-OE1 3.8Å; K15-E19 WeakPolarHBondContact O-CB 3.31Å; K15-E19 WeakPolarHBondContact O-CG 3.49Å; K15-E19 PolarHBondContact O-N 3.43Å
16	E	86.7	Confident	73.7	Confident	96 Å²	96	121.5 Å²	121.5	45%	0.449	61%	0.611	S	S	.	*	H	α-helix	trans	-65.5	-37.2	177	-73.9	163.2	159	0	0	111.9	I12 T13 S20	I12-E16 WeakPolarHBondContact CA-OE2 3.46Å; I12-E16 HydrophobicContact CG2-CB 3.86Å; T13-E16 PolarHBondContact N-OE2 2.86Å; T13-E16 PolarHBondContact O-N 3.47Å; T13-E16 VanDerWaalsContact OG1-CD 3.31Å; T13-E16 VanDerWaalsContact OG1-CG 3.26Å; T13-E16 WeakPolarHBondContact OG1-CG 3.39Å; T13-E16 PolarHBondContact OG1-N 2.85Å; T13-E16 PolarHBondContact OG1-OE2 3.03Å; E16-S20 WeakPolarHBondContact O-CB 3.39Å; E16-S20 PolarHBondContact O-N 2.82Å
17	V	85.4	Confident	74	Confident	67 Å²	67	113.5 Å²	113.5	41%	0.406	59%	0.59	S	S	.	*	H	α-helix	trans	-62.1	-47	173.6	179.4	0	0	0	0	110.3	I12 T13 E14 K15 S20 I21	I12-V17 HydrophobicContact CG2-CG2 3.6Å; T13-V17 PolarHBondContact O-N 2.96Å; T13-V17 VanDerWaalsContact O-N 3.16Å; E14-V17 PolarHBondContact O-N 3.2Å; K15-V17 VanDerWaalsContact C-N 3.33Å; K15-V17 PolarHBondContact O-N 3.38Å; V17-S20 PolarHBondContact O-N 3.16Å; V17-I21 HydrophobicContact CG1-CD1 3.87Å; V17-I21 WeakPolarHBondContact O-CD1 3.39Å; V17-I21 VanDerWaalsContact O-CG1 3.26Å; V17-I21 WeakPolarHBondContact O-CG1 3.47Å; V17-I21 PolarHBondContact O-N 3.23Å
18	L	86.4	Confident	74.4	Confident	88 Å²	88	114.5 Å²	114.5	46%	0.461	59%	0.594	S	S	.	*	H	α-helix	trans	-63.8	-46.3	179.2	-70.6	171.1	0	0	0	112	E14 K15 S20 I21 E22	E14-L18 HydrophobicContact CG-CD1 4.18Å; E14-L18 VanDerWaalsContact O-CG 3.31Å; E14-L18 WeakPolarHBondContact O-CG 3.04Å; E14-L18 PolarHBondContact O-N 3.43Å; K15-L18 PolarHBondContact O-N 2.85Å; L18-S20 VanDerWaalsContact C-N 3.33Å; L18-S20 PolarHBondContact O-N 3.3Å; L18-I21 PolarHBondContact O-N 2.87Å; L18-E22 WeakPolarHBondContact O-CG 3.26Å; L18-E22 PolarHBondContact O-N 3.49Å
19	E	86.1	Confident	75.1	Confident	100 Å²	100	113.7 Å²	113.7	47%	0.467	59%	0.588	S	S	.	*	H	α-helix	trans	-62.1	-39.4	177.8	-75.6	177.9	176.8	0	0	111.9	K15 E22 S23	K15-E19 WeakPolarHBondContact CE-OE1 3.34Å; K15-E19 IonicContact NZ-OE1 3.8Å; K15-E19 WeakPolarHBondContact O-CB 3.31Å; K15-E19 WeakPolarHBondContact O-CG 3.49Å; K15-E19 PolarHBondContact O-N 3.43Å; E19-E22 PolarHBondContact O-N 2.89Å; E19-S23 WeakPolarHBondContact O-CB 3.39Å; E19-S23 PolarHBondContact O-N 2.99Å; E19-S23 PolarHBondContact O-OG 3.03Å
20	S	83.5	Confident	75.6	Confident	65 Å²	65	114.9 Å²	114.9	46%	0.455	59%	0.59	S	S	.	*	H	α-helix	trans	-61.7	-46.1	174.5	-173.6	0	0	0	0	111.3	E16 V17 L18 S23 E24	E16-S20 WeakPolarHBondContact O-CB 3.39Å; E16-S20 PolarHBondContact O-N 2.82Å; V17-S20 PolarHBondContact O-N 3.16Å; L18-S20 VanDerWaalsContact C-N 3.33Å; L18-S20 PolarHBondContact O-N 3.3Å; S20-S23 PolarHBondContact O-N 2.99Å; S20-S23 PolarHBondContact O-OG 2.97Å; S20-E24 PolarHBondContact O-N 3.42Å
21	I	81.4	Confident	75.7	Confident	77 Å²	77	113.2 Å²	113.2	40%	0.395	58%	0.582	S	S	.	*	H	α-helix	trans	-64	-44.4	178.4	-67.1	165.5	0	0	0	110.5	V17 L18 S23 E24 Y25	V17-I21 HydrophobicContact CG1-CD1 3.87Å; V17-I21 WeakPolarHBondContact O-CD1 3.39Å; V17-I21 VanDerWaalsContact O-CG1 3.26Å; V17-I21 WeakPolarHBondContact O-CG1 3.47Å; V17-I21 PolarHBondContact O-N 3.23Å; L18-I21 PolarHBondContact O-N 2.87Å; I21-S23 PolarHBondContact O-N 3.43Å; I21-E24 PolarHBondContact O-N 2.97Å; I21-Y25 HydrophobicContact CG2-CD2 4.07Å; I21-Y25 WeakPolarHBondContact O-CB 3.37Å; I21-Y25 WeakPolarHBondContact O-CD2 3.35Å; I21-Y25 PolarHBondContact O-N 3.28Å
22	E	81	Confident	75.9	Confident	118 Å²	118	112 Å²	112	55%	0.551	59%	0.587	S	S	*	*	H	α-helix	trans	-61.2	-44.4	178.4	-76.8	-177.3	179.9	0	0	111.8	L18 E19 E24 F26	L18-E22 WeakPolarHBondContact O-CG 3.26Å; L18-E22 PolarHBondContact O-N 3.49Å; E19-E22 PolarHBondContact O-N 2.89Å; E22-E24 VanDerWaalsContact C-N 3.31Å; E22-E24 PolarHBondContact O-N 3.06Å; E22-F26 HydrophobicContact CG-CD2 4.4Å; E22-F26 WeakPolarHBondContact O-CA 3.49Å; E22-F26 VanDerWaalsContact O-CB 3.31Å; E22-F26 WeakPolarHBondContact O-CB 3.36Å; E22-F26 PolarHBondContact O-N 3.09Å
23	S	79.8	Confident	76.1	Confident	84 Å²	84	112.2 Å²	112.2	59%	0.587	59%	0.593	S	S	*	*	H	α-helix	trans	-62.5	-36.8	-179.7	75.4	0	0	0	0	113.3	E19 S20 I21	E19-S23 WeakPolarHBondContact O-CB 3.39Å; E19-S23 PolarHBondContact O-N 2.99Å; E19-S23 PolarHBondContact O-OG 3.03Å; S20-S23 PolarHBondContact O-N 2.99Å; S20-S23 PolarHBondContact O-OG 2.97Å; I21-S23 PolarHBondContact O-N 3.43Å
24	E	75.7	Confident	76	Confident	147 Å²	147	114.2 Å²	114.2	69%	0.687	60%	0.601	S	S	*	*	H	α-helix	trans	-85.1	-32	-175	-168.4	145.2	-166.4	0	0	112.6	S20 I21 E22	S20-E24 PolarHBondContact O-N 3.42Å; I21-E24 PolarHBondContact O-N 2.97Å; E22-E24 VanDerWaalsContact C-N 3.31Å; E22-E24 PolarHBondContact O-N 3.06Å
25	Y	67.2	Low	76.2	Confident	179 Å²	179	110.4 Å²	110.4	70%	0.702	59%	0.585	S	S	*	*	H	α-helix	trans	-109.4	-19.6	-173.8	-68.1	-79.3	0	0	0	115.3	I21	I21-Y25 HydrophobicContact CG2-CD2 4.07Å; I21-Y25 WeakPolarHBondContact O-CB 3.37Å; I21-Y25 WeakPolarHBondContact O-CD2 3.35Å; I21-Y25 PolarHBondContact O-N 3.28Å
26	F	66.4	Low	76.5	Confident	159 Å²	159	109.2 Å²	109.2	70%	0.697	58%	0.584	S	S	*	*			trans	-113.7	9.9	-176.3	-68.6	-93.4	0	0	0	114.2	E22	E22-F26 HydrophobicContact CG-CD2 4.4Å; E22-F26 WeakPolarHBondContact O-CA 3.49Å; E22-F26 VanDerWaalsContact O-CB 3.31Å; E22-F26 WeakPolarHBondContact O-CB 3.36Å; E22-F26 PolarHBondContact O-N 3.09Å
27	S	62.1	Low	76.8	Confident	63 Å²	63	110.1 Å²	110.1	44%	0.441	59%	0.592	S	S	.	*			trans	-59	126.9	166.5	179.5	0	0	0	0	109.8	I29	S27-I29 PolarHBondContact O-N 3.16Å
28	P	62.8	Low	77.1	Confident	124 Å²	124	111.7 Å²	111.7	81%	0.805	60%	0.595	S	S	*	*	S	Bend	trans	-70	6.1	-175.2	28	-34.7	0	0	0	114.1	L30	P28-L30 PolarHBondContact O-N 3.33Å
29	I	64.5	Low	77.4	Confident	138 Å²	138	110.8 Å²	110.8	71%	0.708	59%	0.59	S	S	*	*			trans	-89.8	79	179.4	-49	173.6	0	0	0	108.3	S27	S27-I29 PolarHBondContact O-N 3.16Å
30	L	65	Low	77.8	Confident	134 Å²	134	110 Å²	110	70%	0.702	59%	0.589	S	S	*	*			trans	-56.6	134.6	157.4	-77.9	154	0	0	0	107.4	P28 T32	P28-L30 PolarHBondContact O-N 3.33Å; L30-T32 PolarHBondContact O-N 3.2Å
31	P	67.5	Low	78.3	Confident	81 Å²	81	109.3 Å²	109.3	53%	0.526	59%	0.587	S	S	.	*			trans	-54.7	130.6	175.1	20.7	-29.6	0	0	0	108.6	V33 L34	P31-V33 PolarHBondContact O-N 3.02Å; P31-L34 HydrophobicContact CG-CD2 4.19Å
32	T	71.4	Confident	79	Confident	153 Å²	153	108.9 Å²	108.9	94%	0.939	59%	0.586	S	S	*	*	S	Bend	trans	-56.6	-22.8	-177.7	33.1	0	0	0	0	112.6	L30	L30-T32 PolarHBondContact O-N 3.2Å
33	V	75.4	Confident	79.7	Confident	117 Å²	117	109.4 Å²	109.4	71%	0.709	58%	0.583	S	S	*	*	S	Bend	trans	-117.1	110.4	171.1	-175.6	0	0	0	0	108.8	P31 D35	P31-V33 PolarHBondContact O-N 3.02Å; V33-D35 PolarHBondContact O-N 3.04Å
34	L	80	Confident	80.5	Confident	113 Å²	113	112 Å²	112	59%	0.592	58%	0.583	S	S	*	*			trans	-82.7	106.8	168.5	-69	167.9	0	0	0	108.7	P31 I39	P31-L34 HydrophobicContact CG-CD2 4.19Å; L34-I39 HydrophobicContact CB-CD1 4.22Å; L34-I39 HydrophobicContact CD2-CD1 4.06Å
35	D	87.3	Confident	81.4	Confident	76 Å²	76	110.4 Å²	110.4	41%	0.406	57%	0.574	S	S	.	*			trans	-87.1	111.3	170.1	-179.8	6.3	0	0	0	110.1	V33 N37 Q38 I39	V33-D35 PolarHBondContact O-N 3.04Å; D35-N37 PolarHBondContact O-N 2.91Å; D35-N37 WeakPolarHBondContact OD1-CB 3.31Å; D35-N37 PolarHBondContact OD1-N 2.86Å; D35-N37 PolarHBondContact OD1-ND2 3.31Å; D35-Q38 HydrophobicContact CB-CB 3.94Å; D35-Q38 PolarHBondContact O-N 3.29Å; D35-I39 WeakPolarHBondContact O-CG1 3.26Å; D35-I39 PolarHBondContact O-N 2.83Å
36	I	91.3	Very high	82.9	Confident	114 Å²	114	106.8 Å²	106.8	59%	0.585	57%	0.566	S	S	*	*	H	α-helix	trans	-60	-30.2	179.1	-159.6	164	0	0	0	112.6	N40	I36-N40 WeakPolarHBondContact O-CB 3.32Å; I36-N40 VanDerWaalsContact O-CG 3.23Å; I36-N40 PolarHBondContact O-N 3.45Å; I36-N40 PolarHBondContact O-ND2 3.08Å
37	N	93	Very high	84.3	Confident	116 Å²	116	106.6 Å²	106.6	62%	0.62	56%	0.561	S	S	*	*	H	α-helix	trans	-71.5	-44.2	178.6	-62.6	-51.3	0	0	0	110.7	D35 N40 A41	D35-N37 PolarHBondContact O-N 2.91Å; D35-N37 WeakPolarHBondContact OD1-CB 3.31Å; D35-N37 PolarHBondContact OD1-N 2.86Å; D35-N37 PolarHBondContact OD1-ND2 3.31Å; N37-N40 PolarHBondContact O-N 2.91Å; N37-A41 WeakPolarHBondContact O-CB 3.49Å; N37-A41 PolarHBondContact O-N 3.16Å
38	Q	91.5	Very high	85.9	Confident	99 Å²	99	109 Å²	109	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-61.9	-46.4	174.6	-174.3	55	46.3	0	0	111.3	D35 N40 A41 D42	D35-Q38 HydrophobicContact CB-CB 3.94Å; D35-Q38 PolarHBondContact O-N 3.29Å; Q38-N40 VanDerWaalsContact C-N 3.29Å; Q38-N40 PolarHBondContact O-N 3Å; Q38-A41 WeakPolarHBondContact O-CB 3.19Å; Q38-A41 PolarHBondContact O-N 2.94Å; Q38-A41 VanDerWaalsContact O-N 3.08Å; Q38-D42 VanDerWaalsContact NE2-CG 3.29Å; Q38-D42 PolarHBondContact NE2-OD1 2.78Å; Q38-D42 PolarHBondContact NE2-OD2 3.13Å; Q38-D42 PolarHBondContact O-N 3.18Å
39	I	92.3	Very high	87.5	Confident	69 Å²	69	107.9 Å²	107.9	35%	0.354	55%	0.549	S	S	.	.	H	α-helix	trans	-57.7	-43.2	175.9	-67.3	166	0	0	0	110.8	L34 D35 D42 R43	L34-I39 HydrophobicContact CB-CD1 4.22Å; L34-I39 HydrophobicContact CD2-CD1 4.06Å; D35-I39 WeakPolarHBondContact O-CG1 3.26Å; D35-I39 PolarHBondContact O-N 2.83Å; I39-D42 PolarHBondContact O-N 3.08Å; I39-R43 HydrophobicContact CG2-CG 4.43Å; I39-R43 WeakPolarHBondContact O-CB 3.42Å; I39-R43 WeakPolarHBondContact O-CG 3.29Å; I39-R43 PolarHBondContact O-N 3.06Å
40	N	95	Very high	89	Confident	84 Å²	84	106.4 Å²	106.4	45%	0.449	54%	0.542	S	S	.	.	H	α-helix	trans	-67.3	-36.2	177.4	-76.8	-35.3	0	0	0	112.7	I36 N37 Q38 K44	I36-N40 WeakPolarHBondContact O-CB 3.32Å; I36-N40 VanDerWaalsContact O-CG 3.23Å; I36-N40 PolarHBondContact O-N 3.45Å; I36-N40 PolarHBondContact O-ND2 3.08Å; N37-N40 PolarHBondContact O-N 2.91Å; Q38-N40 VanDerWaalsContact C-N 3.29Å; Q38-N40 PolarHBondContact O-N 3Å; N40-K44 WeakPolarHBondContact O-CB 3.48Å; N40-K44 PolarHBondContact O-N 2.83Å
41	A	94.5	Very high	90.5	Very high	50 Å²	50	102.9 Å²	102.9	41%	0.413	53%	0.532	S	S	.	.	H	α-helix	trans	-64.7	-45.7	174.1	0	0	0	0	0	111.5	N37 Q38 K44 K45	N37-A41 WeakPolarHBondContact O-CB 3.49Å; N37-A41 PolarHBondContact O-N 3.16Å; Q38-A41 WeakPolarHBondContact O-CB 3.19Å; Q38-A41 PolarHBondContact O-N 2.94Å; Q38-A41 VanDerWaalsContact O-N 3.08Å; A41-K44 WeakPolarHBondContact O-CB 3.42Å; A41-K44 PolarHBondContact O-N 3.33Å; A41-K45 PolarHBondContact O-N 3.19Å
42	D	94.6	Very high	91.9	Very high	68 Å²	68	102.9 Å²	102.9	36%	0.364	53%	0.53	S	S	.	.	H	α-helix	trans	-64.8	-42.8	177.5	-68.7	-31.1	0	0	0	111.4	Q38 I39 K44 K45 I46	Q38-D42 VanDerWaalsContact NE2-CG 3.29Å; Q38-D42 PolarHBondContact NE2-OD1 2.78Å; Q38-D42 PolarHBondContact NE2-OD2 3.13Å; Q38-D42 PolarHBondContact O-N 3.18Å; I39-D42 PolarHBondContact O-N 3.08Å; D42-K44 VanDerWaalsContact C-N 3.28Å; D42-K44 PolarHBondContact O-N 3.01Å; D42-K45 WeakPolarHBondContact O-CB 3.33Å; D42-K45 PolarHBondContact O-N 3.44Å; D42-K45 VanDerWaalsContact O-N 3.16Å; D42-I46 VanDerWaalsContact O-CG1 3.29Å; D42-I46 WeakPolarHBondContact O-CG1 3.32Å; D42-I46 PolarHBondContact O-N 2.9Å
43	R	96.1	Very high	93	Very high	130 Å²	130	100.3 Å²	100.3	49%	0.491	51%	0.51	S	S	.	.	H	α-helix	trans	-58.6	-39.6	172.8	-74.3	175.8	71.1	155.3	6.6	112.4	I39 R47	I39-R43 HydrophobicContact CG2-CG 4.43Å; I39-R43 WeakPolarHBondContact O-CB 3.42Å; I39-R43 WeakPolarHBondContact O-CG 3.29Å; I39-R43 PolarHBondContact O-N 3.06Å; R43-R47 WeakPolarHBondContact O-CG 3.37Å; R43-R47 PolarHBondContact O-N 3.4Å; R43-R47 VanDerWaalsContact O-N 3.08Å
44	K	96.7	Very high	94	Very high	137 Å²	137	98.2 Å²	98.2	60%	0.596	50%	0.498	S	S	*	.	H	α-helix	trans	-65.3	-45	175.9	-174.7	-179.5	178.9	-177.8	0	110.9	N40 A41 D42 R47 Q48	N40-K44 WeakPolarHBondContact O-CB 3.48Å; N40-K44 PolarHBondContact O-N 2.83Å; A41-K44 WeakPolarHBondContact O-CB 3.42Å; A41-K44 PolarHBondContact O-N 3.33Å; D42-K44 VanDerWaalsContact C-N 3.28Å; D42-K44 PolarHBondContact O-N 3.01Å; K44-R47 PolarHBondContact O-N 2.88Å; K44-Q48 WeakPolarHBondContact O-CG 3.47Å; K44-Q48 PolarHBondContact O-N 3.42Å
45	K	95.9	Very high	94.8	Very high	115 Å²	115	101.4 Å²	101.4	50%	0.5	50%	0.502	S	S	.	.	H	α-helix	trans	-60.7	-47.2	176.8	-175.5	-178.7	177.2	-174.3	0	111.9	A41 D42 R47 Q48 Q49	A41-K45 PolarHBondContact O-N 3.19Å; D42-K45 WeakPolarHBondContact O-CB 3.33Å; D42-K45 PolarHBondContact O-N 3.44Å; D42-K45 VanDerWaalsContact O-N 3.16Å; K45-R47 VanDerWaalsContact C-N 3.34Å; K45-R47 PolarHBondContact O-N 3.29Å; K45-Q48 WeakPolarHBondContact O-CB 3.45Å; K45-Q48 PolarHBondContact O-N 3.16Å; K45-Q48 VanDerWaalsContact O-N 3.16Å; K45-Q49 WeakPolarHBondContact O-CG 3.37Å; K45-Q49 PolarHBondContact O-N 3.42Å
46	I	96.7	Very high	95.2	Very high	102 Å²	102	104 Å²	104	52%	0.523	51%	0.51	S	S	.	.	H	α-helix	trans	-60	-44.1	177.7	-69.1	165.4	0	0	0	110.8	D42 Q48 Q49 L50	D42-I46 VanDerWaalsContact O-CG1 3.29Å; D42-I46 WeakPolarHBondContact O-CG1 3.32Å; D42-I46 PolarHBondContact O-N 2.9Å; I46-Q48 VanDerWaalsContact C-N 3.33Å; I46-Q48 PolarHBondContact O-N 3.05Å; I46-Q49 PolarHBondContact O-N 3.36Å; I46-L50 WeakPolarHBondContact O-CB 3.42Å; I46-L50 PolarHBondContact O-N 3.16Å
47	R	96.7	Very high	95.4	Very high	156 Å²	156	102.1 Å²	102.1	59%	0.589	50%	0.503	S	S	*	.	H	α-helix	trans	-62.3	-38.6	176.3	-75.6	175.3	179.8	152.2	-4.1	112.8	R43 K44 K45 A51	R43-R47 WeakPolarHBondContact O-CG 3.37Å; R43-R47 PolarHBondContact O-N 3.4Å; R43-R47 VanDerWaalsContact O-N 3.08Å; K44-R47 PolarHBondContact O-N 2.88Å; K45-R47 VanDerWaalsContact C-N 3.34Å; K45-R47 PolarHBondContact O-N 3.29Å; R47-A51 PolarHBondContact O-N 2.82Å
48	Q	96.1	Very high	95.6	Very high	114 Å²	114	99.2 Å²	99.2	53%	0.533	49%	0.492	S	S	.	.	H	α-helix	trans	-65.8	-45.3	175.3	-72	172.3	-21.7	0	0	111.5	K44 K45 I46 A51 V52	K44-Q48 WeakPolarHBondContact O-CG 3.47Å; K44-Q48 PolarHBondContact O-N 3.42Å; K45-Q48 WeakPolarHBondContact O-CB 3.45Å; K45-Q48 PolarHBondContact O-N 3.16Å; K45-Q48 VanDerWaalsContact O-N 3.16Å; I46-Q48 VanDerWaalsContact C-N 3.33Å; I46-Q48 PolarHBondContact O-N 3.05Å; Q48-A51 PolarHBondContact O-N 3.21Å; Q48-V52 WeakPolarHBondContact O-CG2 3.43Å; Q48-V52 PolarHBondContact O-N 3.4Å
49	Q	96.6	Very high	95.8	Very high	100 Å²	100	97.8 Å²	97.8	47%	0.467	49%	0.487	S	S	.	.	H	α-helix	trans	-61.2	-44.6	176.1	-72.1	174.9	-43.2	0	0	111.4	K45 I46 A51 V52 I53	K45-Q49 WeakPolarHBondContact O-CG 3.37Å; K45-Q49 PolarHBondContact O-N 3.42Å; I46-Q49 PolarHBondContact O-N 3.36Å; Q49-A51 VanDerWaalsContact C-N 3.34Å; Q49-A51 PolarHBondContact O-N 3.02Å; Q49-V52 PolarHBondContact O-N 3.23Å; Q49-I53 WeakPolarHBondContact O-CG1 3.35Å; Q49-I53 PolarHBondContact O-N 2.86Å
50	L	95.6	Very high	95.9	Very high	106 Å²	106	98.7 Å²	98.7	56%	0.555	49%	0.492	S	S	*	.	H	α-helix	trans	-57	-47.7	175.1	-180	62.2	0	0	0	111.1	I46 V52 I53 T54	I46-L50 WeakPolarHBondContact O-CB 3.42Å; I46-L50 PolarHBondContact O-N 3.16Å; L50-V52 VanDerWaalsContact C-N 3.3Å; L50-V52 PolarHBondContact O-N 3.33Å; L50-I53 PolarHBondContact O-N 3.01Å; L50-T54 WeakPolarHBondContact O-CB 3.42Å; L50-T54 PolarHBondContact O-N 3.3Å; L50-T54 PolarHBondContact O-OG1 3.33Å
51	A	96.4	Very high	95.9	Very high	61 Å²	61	99.3 Å²	99.3	50%	0.504	49%	0.494	S	S	.	.	H	α-helix	trans	-59.4	-39.5	177.9	0	0	0	0	0	112.8	R47 Q48 Q49 R55	R47-A51 PolarHBondContact O-N 2.82Å; Q48-A51 PolarHBondContact O-N 3.21Å; Q49-A51 VanDerWaalsContact C-N 3.34Å; Q49-A51 PolarHBondContact O-N 3.02Å; A51-R55 WeakPolarHBondContact O-CB 3.33Å; A51-R55 PolarHBondContact O-N 2.98Å; A51-R55 VanDerWaalsContact O-N 3.1Å
52	V	96.1	Very high	95.9	Very high	80 Å²	80	102.7 Å²	102.7	49%	0.485	51%	0.505	S	S	.	.	H	α-helix	trans	-67.3	-44.7	175.8	173	0	0	0	0	111.4	Q48 Q49 L50 R55 K56	Q48-V52 WeakPolarHBondContact O-CG2 3.43Å; Q48-V52 PolarHBondContact O-N 3.4Å; Q49-V52 PolarHBondContact O-N 3.23Å; L50-V52 VanDerWaalsContact C-N 3.3Å; L50-V52 PolarHBondContact O-N 3.33Å; V52-R55 PolarHBondContact O-N 3.07Å; V52-K56 HydrophobicContact CG1-CD 4.29Å; V52-K56 WeakPolarHBondContact O-CG 3.27Å; V52-K56 PolarHBondContact O-N 3.1Å
53	I	96.2	Very high	95.9	Very high	99 Å²	99	106.2 Å²	106.2	51%	0.508	52%	0.519	S	S	.	.	H	α-helix	trans	-64.4	-48	179.2	-68.4	166.9	0	0	0	110.2	Q49 L50 R55 K56 V57	Q49-I53 WeakPolarHBondContact O-CG1 3.35Å; Q49-I53 PolarHBondContact O-N 2.86Å; L50-I53 PolarHBondContact O-N 3.01Å; I53-R55 VanDerWaalsContact C-N 3.28Å; I53-R55 PolarHBondContact O-N 3.28Å; I53-K56 PolarHBondContact O-N 2.99Å; I53-K56 VanDerWaalsContact O-N 3.16Å; I53-V57 HydrophobicContact CG2-CG2 4.21Å; I53-V57 WeakPolarHBondContact O-CG2 3.4Å; I53-V57 PolarHBondContact O-N 3.25Å
54	T	95.9	Very high	95.7	Very high	74 Å²	74	106 Å²	106	45%	0.454	52%	0.524	S	S	.	.	H	α-helix	trans	-55.2	-46	176.8	-60.5	0	0	0	0	110.8	L50 V57 S58	L50-T54 WeakPolarHBondContact O-CB 3.42Å; L50-T54 PolarHBondContact O-N 3.3Å; L50-T54 PolarHBondContact O-OG1 3.33Å; T54-V57 PolarHBondContact O-N 3.38Å; T54-S58 PolarHBondContact O-N 3.09Å; T54-S58 PolarHBondContact O-OG 2.94Å; T54-S58 VanDerWaalsContact O-OG 3.09Å
55	R	95.6	Very high	95.5	Very high	180 Å²	180	104.8 Å²	104.8	68%	0.679	52%	0.52	S	S	*	.	H	α-helix	trans	-60.3	-49.9	176.7	-172	178.8	-167.8	169.4	6.7	112.1	A51 V52 I53 V57 S58 D59	A51-R55 WeakPolarHBondContact O-CB 3.33Å; A51-R55 PolarHBondContact O-N 2.98Å; A51-R55 VanDerWaalsContact O-N 3.1Å; V52-R55 PolarHBondContact O-N 3.07Å; I53-R55 VanDerWaalsContact C-N 3.28Å; I53-R55 PolarHBondContact O-N 3.28Å; R55-V57 VanDerWaalsContact C-N 3.31Å; R55-V57 PolarHBondContact O-N 3.37Å; R55-S58 WeakPolarHBondContact O-CB 3.42Å; R55-S58 PolarHBondContact O-N 2.85Å; R55-D59 VanDerWaalsContact O-CG 3.24Å; R55-D59 PolarHBondContact O-N 3.17Å
56	K	96.7	Very high	95.3	Very high	131 Å²	131	103.3 Å²	103.3	57%	0.57	52%	0.522	S	S	*	.	H	α-helix	trans	-59.4	-41.1	178.7	-74.9	-178.1	174.8	-171.4	0	112.5	V52 I53 D59 L60	V52-K56 HydrophobicContact CG1-CD 4.29Å; V52-K56 WeakPolarHBondContact O-CG 3.27Å; V52-K56 PolarHBondContact O-N 3.1Å; I53-K56 PolarHBondContact O-N 2.99Å; I53-K56 VanDerWaalsContact O-N 3.16Å; K56-D59 PolarHBondContact O-N 3.42Å; K56-L60 WeakPolarHBondContact O-CB 3.49Å; K56-L60 VanDerWaalsContact O-CG 3.27Å; K56-L60 WeakPolarHBondContact O-CG 3.5Å; K56-L60 PolarHBondContact O-N 2.95Å
57	V	95.9	Very high	95.2	Very high	73 Å²	73	101.7 Å²	101.7	44%	0.442	52%	0.52	S	S	.	.	H	α-helix	trans	-65	-44.1	176.7	171.4	0	0	0	0	110.4	I53 T54 R55 L60 I61	I53-V57 HydrophobicContact CG2-CG2 4.21Å; I53-V57 WeakPolarHBondContact O-CG2 3.4Å; I53-V57 PolarHBondContact O-N 3.25Å; T54-V57 PolarHBondContact O-N 3.38Å; R55-V57 VanDerWaalsContact C-N 3.31Å; R55-V57 PolarHBondContact O-N 3.37Å; V57-L60 PolarHBondContact O-N 2.94Å; V57-I61 HydrophobicContact CG1-CD1 3.84Å; V57-I61 HydrophobicContact CG1-CG1 4.49Å; V57-I61 VanDerWaalsContact O-CG1 3.24Å; V57-I61 WeakPolarHBondContact O-CG1 3.4Å; V57-I61 PolarHBondContact O-N 3.44Å
58	S	96	Very high	95	Very high	55 Å²	55	100.1 Å²	100.1	39%	0.385	52%	0.518	S	S	.	.	H	α-helix	trans	-61.2	-44.6	174.8	-62.6	0	0	0	0	112.3	T54 R55 I61 L62	T54-S58 PolarHBondContact O-N 3.09Å; T54-S58 PolarHBondContact O-OG 2.94Å; T54-S58 VanDerWaalsContact O-OG 3.09Å; R55-S58 WeakPolarHBondContact O-CB 3.42Å; R55-S58 PolarHBondContact O-N 2.85Å; S58-I61 PolarHBondContact O-N 3.32Å; S58-L62 VanDerWaalsContact O-CG 3.31Å; S58-L62 WeakPolarHBondContact O-CG 3.24Å; S58-L62 PolarHBondContact O-N 3.41Å
59	D	95.7	Very high	95	Very high	70 Å²	70	97.7 Å²	97.7	37%	0.374	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-46.5	178	-65.8	-22.1	0	0	0	110.7	R55 K56 I61 L62 E63	R55-D59 VanDerWaalsContact O-CG 3.24Å; R55-D59 PolarHBondContact O-N 3.17Å; K56-D59 PolarHBondContact O-N 3.42Å; D59-I61 PolarHBondContact O-N 3.48Å; D59-L62 PolarHBondContact O-N 2.86Å; D59-E63 WeakPolarHBondContact O-CB 3.31Å; D59-E63 WeakPolarHBondContact O-CG 3.25Å; D59-E63 PolarHBondContact O-N 3.17Å
60	L	96.2	Very high	95	Very high	87 Å²	87	95.2 Å²	95.2	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-60.4	-41.3	175.8	-75.8	169.8	0	0	0	112.9	K56 V57 L62 E63 Q64	K56-L60 WeakPolarHBondContact O-CB 3.49Å; K56-L60 VanDerWaalsContact O-CG 3.27Å; K56-L60 WeakPolarHBondContact O-CG 3.5Å; K56-L60 PolarHBondContact O-N 2.95Å; V57-L60 PolarHBondContact O-N 2.94Å; L60-L62 VanDerWaalsContact C-N 3.34Å; L60-E63 PolarHBondContact O-N 2.98Å; L60-Q64 WeakPolarHBondContact O-CB 3.31Å; L60-Q64 VanDerWaalsContact O-CG 3.31Å; L60-Q64 WeakPolarHBondContact O-CG 3.34Å; L60-Q64 PolarHBondContact O-N 2.89Å
61	I	94.4	Very high	95	Very high	97 Å²	97	95.5 Å²	95.5	50%	0.497	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-46.6	175.6	-71.4	164.9	0	0	0	109.8	V57 S58 D59 E63 Q64 H65	V57-I61 HydrophobicContact CG1-CD1 3.84Å; V57-I61 HydrophobicContact CG1-CG1 4.49Å; V57-I61 VanDerWaalsContact O-CG1 3.24Å; V57-I61 WeakPolarHBondContact O-CG1 3.4Å; V57-I61 PolarHBondContact O-N 3.44Å; S58-I61 PolarHBondContact O-N 3.32Å; D59-I61 PolarHBondContact O-N 3.48Å; I61-E63 VanDerWaalsContact C-N 3.34Å; I61-E63 PolarHBondContact O-N 3.41Å; I61-Q64 PolarHBondContact O-N 3.31Å; I61-H65 VanDerWaalsContact O-CB 3.25Å; I61-H65 WeakPolarHBondContact O-CB 3.41Å; I61-H65 PolarHBondContact O-N 2.99Å
62	L	94.4	Very high	95	Very high	122 Å²	122	97.3 Å²	97.3	64%	0.639	51%	0.508	S	S	*	.	H	α-helix	trans	-65.8	-36.2	-180	-69.6	173.6	0	0	0	112.4	S58 D59 L60 P66	S58-L62 VanDerWaalsContact O-CG 3.31Å; S58-L62 WeakPolarHBondContact O-CG 3.24Å; S58-L62 PolarHBondContact O-N 3.41Å; D59-L62 PolarHBondContact O-N 2.86Å; L60-L62 VanDerWaalsContact C-N 3.34Å; L62-P66 WeakPolarHBondContact O-CD 3.49Å
63	E	93.7	Very high	95.1	Very high	142 Å²	142	98.8 Å²	98.8	66%	0.664	51%	0.509	S	S	*	.	H	α-helix	trans	-66.6	-40	174.7	-75.2	174.6	-176.7	0	0	112.3	D59 L60 I61 P66	D59-E63 WeakPolarHBondContact O-CB 3.31Å; D59-E63 WeakPolarHBondContact O-CG 3.25Å; D59-E63 PolarHBondContact O-N 3.17Å; L60-E63 PolarHBondContact O-N 2.98Å; I61-E63 VanDerWaalsContact C-N 3.34Å; I61-E63 PolarHBondContact O-N 3.41Å; E63-P66 WeakPolarHBondContact O-CD 3.21Å
64	Q	93.3	Very high	95.1	Very high	126 Å²	126	98.9 Å²	98.9	59%	0.589	51%	0.511	S	S	*	.	H	α-helix	trans	-83.2	-27.4	-176.9	-69.4	-179.6	5.3	0	0	113.4	L60 I61 S67 F68	L60-Q64 WeakPolarHBondContact O-CB 3.31Å; L60-Q64 VanDerWaalsContact O-CG 3.31Å; L60-Q64 WeakPolarHBondContact O-CG 3.34Å; L60-Q64 PolarHBondContact O-N 2.89Å; I61-Q64 PolarHBondContact O-N 3.31Å; Q64-S67 PolarHBondContact O-N 3.23Å; Q64-S67 VanDerWaalsContact O-N 3.14Å; Q64-F68 PolarHBondContact O-N 3.14Å
65	H	91.9	Very high	95.2	Very high	111 Å²	111	99.7 Å²	99.7	51%	0.514	52%	0.516	S	S	.	.	H	α-helix	trans	-54.7	-42.1	-174.4	-172.4	-83	0	0	0	114	I61 S67 F68 S69	I61-H65 VanDerWaalsContact O-CB 3.25Å; I61-H65 WeakPolarHBondContact O-CB 3.41Å; I61-H65 PolarHBondContact O-N 2.99Å; H65-S67 PolarHBondContact O-N 3Å; H65-F68 PolarHBondContact O-N 3.5Å; H65-S69 WeakPolarHBondContact O-CB 3.35Å; H65-S69 PolarHBondContact O-N 2.94Å
66	P	92.4	Very high	95.3	Very high	83 Å²	83	93.5 Å²	93.5	54%	0.539	50%	0.503	S	S	.	.	H	α-helix	trans	-62.5	-42.8	177.2	-23.8	34.6	0	0	0	113.4	L62 E63 A70	L62-P66 WeakPolarHBondContact O-CD 3.49Å; E63-P66 WeakPolarHBondContact O-CD 3.21Å; P66-A70 WeakPolarHBondContact O-CB 3.34Å; P66-A70 PolarHBondContact O-N 3.25Å
67	S	93.6	Very high	95.4	Very high	68 Å²	68	91.4 Å²	91.4	48%	0.476	50%	0.498	S	S	.	.	H	α-helix	trans	-69.1	-42.9	179.1	-177.2	0	0	0	0	111.5	Q64 H65 A70 Q71	Q64-S67 PolarHBondContact O-N 3.23Å; Q64-S67 VanDerWaalsContact O-N 3.14Å; H65-S67 PolarHBondContact O-N 3Å; S67-A70 PolarHBondContact O-N 3.35Å; S67-Q71 WeakPolarHBondContact O-CG 3.44Å; S67-Q71 PolarHBondContact O-N 2.97Å; S67-Q71 PolarHBondContact OG-NE2 3.49Å
68	F	93.7	Very high	95.5	Very high	124 Å²	124	93.4 Å²	93.4	54%	0.544	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-44.3	175.7	-179.8	-101.8	0	0	0	111.7	Q64 H65 Q71 M72	Q64-F68 PolarHBondContact O-N 3.14Å; H65-F68 PolarHBondContact O-N 3.5Å; F68-Q71 PolarHBondContact O-N 3.12Å; F68-M72 HydrophobicContact CE1-CE 3.8Å; F68-M72 HydrophobicContact CE2-CE 4.06Å; F68-M72 HydrophobicContact CZ-CE 3.4Å; F68-M72 VanDerWaalsContact CZ-CE 3.4Å; F68-M72 WeakPolarHBondContact O-CB 3.18Å; F68-M72 PolarHBondContact O-N 2.96Å
69	S	95.3	Very high	95.6	Very high	62 Å²	62	96.6 Å²	96.6	43%	0.434	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-43	176.2	-173.7	0	0	0	0	112.1	H65 M72 Q73	H65-S69 WeakPolarHBondContact O-CB 3.35Å; H65-S69 PolarHBondContact O-N 2.94Å; S69-M72 WeakPolarHBondContact O-CB 3.44Å; S69-M72 PolarHBondContact O-N 2.97Å; S69-Q73 PolarHBondContact O-N 2.91Å
70	A	95.6	Very high	95.7	Very high	49 Å²	49	94.5 Å²	94.5	41%	0.405	51%	0.507	S	S	.	.	H	α-helix	trans	-61.5	-46.6	175.7	0	0	0	0	0	112	P66 S67 M72 Q73 D74	P66-A70 WeakPolarHBondContact O-CB 3.34Å; P66-A70 PolarHBondContact O-N 3.25Å; S67-A70 PolarHBondContact O-N 3.35Å; A70-M72 VanDerWaalsContact C-N 3.28Å; A70-M72 PolarHBondContact O-N 2.87Å; A70-Q73 WeakPolarHBondContact O-CB 3.5Å; A70-Q73 PolarHBondContact O-N 3.49Å; A70-Q73 VanDerWaalsContact O-N 3.12Å; A70-D74 PolarHBondContact O-N 3.35Å
71	Q	96	Very high	95.8	Very high	112 Å²	112	93.2 Å²	93.2	52%	0.523	51%	0.506	S	S	.	.	H	α-helix	trans	-61.2	-37.9	175.9	-71	174.2	51.5	0	0	112	S67 F68 Q73 D74 V75	S67-Q71 WeakPolarHBondContact O-CG 3.44Å; S67-Q71 PolarHBondContact O-N 2.97Å; S67-Q71 PolarHBondContact OG-NE2 3.49Å; F68-Q71 PolarHBondContact O-N 3.12Å; Q71-Q73 VanDerWaalsContact C-N 3.32Å; Q71-Q73 PolarHBondContact O-N 3.36Å; Q71-D74 PolarHBondContact O-N 3.44Å; Q71-V75 WeakPolarHBondContact O-CG2 3.45Å; Q71-V75 PolarHBondContact O-N 3.23Å
72	M	97.1	Very high	95.9	Very high	99 Å²	99	92.8 Å²	92.8	49%	0.488	51%	0.508	S	S	.	.	H	α-helix	trans	-63.4	-40.3	175.7	-164	63.1	63.1	0	0	111.6	F68 S69 A70 V75 A76	F68-M72 HydrophobicContact CE1-CE 3.8Å; F68-M72 HydrophobicContact CE2-CE 4.06Å; F68-M72 HydrophobicContact CZ-CE 3.4Å; F68-M72 VanDerWaalsContact CZ-CE 3.4Å; F68-M72 WeakPolarHBondContact O-CB 3.18Å; F68-M72 PolarHBondContact O-N 2.96Å; S69-M72 WeakPolarHBondContact O-CB 3.44Å; S69-M72 PolarHBondContact O-N 2.97Å; A70-M72 VanDerWaalsContact C-N 3.28Å; A70-M72 PolarHBondContact O-N 2.87Å; M72-V75 PolarHBondContact O-N 2.96Å; M72-A76 WeakPolarHBondContact O-CB 3.42Å; M72-A76 PolarHBondContact O-N 2.97Å
73	Q	97.4	Very high	96.1	Very high	110 Å²	110	91.9 Å²	91.9	51%	0.514	50%	0.5	S	S	.	.	H	α-helix	trans	-65.2	-41.5	175	-173.1	60.5	52.6	0	0	111.8	S69 A70 Q71 A76 N77	S69-Q73 PolarHBondContact O-N 2.91Å; A70-Q73 WeakPolarHBondContact O-CB 3.5Å; A70-Q73 PolarHBondContact O-N 3.49Å; A70-Q73 VanDerWaalsContact O-N 3.12Å; Q71-Q73 VanDerWaalsContact C-N 3.32Å; Q71-Q73 PolarHBondContact O-N 3.36Å; Q73-A76 PolarHBondContact O-N 3.35Å; Q73-N77 PolarHBondContact NE2-OD1 3.45Å; Q73-N77 PolarHBondContact O-N 3.44Å; Q73-N77 PolarHBondContact O-ND2 3.42Å; Q73-N77 PolarHBondContact O-OD1 3.25Å
74	D	97.5	Very high	96.3	Very high	102 Å²	102	91.9 Å²	91.9	55%	0.545	50%	0.5	S	S	.	.	H	α-helix	trans	-62.7	-43	177.1	-69	-23.3	0	0	0	111.7	A70 Q71 A76 N77 L78	A70-D74 PolarHBondContact O-N 3.35Å; Q71-D74 PolarHBondContact O-N 3.44Å; D74-A76 VanDerWaalsContact C-N 3.35Å; D74-N77 PolarHBondContact O-N 2.94Å; D74-L78 WeakPolarHBondContact O-CB 3.37Å; D74-L78 PolarHBondContact O-N 3.43Å
75	V	97.8	Very high	96.4	Very high	91 Å²	91	90.3 Å²	90.3	55%	0.552	50%	0.499	S	S	*	.	H	α-helix	trans	-62.7	-41.4	174.2	170.7	0	0	0	0	111.3	Q71 M72 L78 K79	Q71-V75 WeakPolarHBondContact O-CG2 3.45Å; Q71-V75 PolarHBondContact O-N 3.23Å; M72-V75 PolarHBondContact O-N 2.96Å; V75-L78 PolarHBondContact O-N 3.47Å; V75-K79 WeakPolarHBondContact O-CB 3.36Å; V75-K79 PolarHBondContact O-N 3Å
76	A	97.6	Very high	96.6	Very high	50 Å²	50	90.4 Å²	90.4	41%	0.413	50%	0.499	S	S	.	.	H	α-helix	trans	-63.9	-42.2	176.9	0	0	0	0	0	112.1	M72 Q73 D74 K79 G80	M72-A76 WeakPolarHBondContact O-CB 3.42Å; M72-A76 PolarHBondContact O-N 2.97Å; Q73-A76 PolarHBondContact O-N 3.35Å; D74-A76 VanDerWaalsContact C-N 3.35Å; A76-K79 PolarHBondContact O-N 3.41Å; A76-G80 PolarHBondContact O-N 2.94Å
77	N	97.8	Very high	96.8	Very high	87 Å²	87	89.1 Å²	89.1	47%	0.465	50%	0.495	S	S	.	.	H	α-helix	trans	-62.5	-47.5	175.8	-66.8	-19.5	0	0	0	111.1	Q73 D74 K79 G80 S81	Q73-N77 PolarHBondContact NE2-OD1 3.45Å; Q73-N77 PolarHBondContact O-N 3.44Å; Q73-N77 PolarHBondContact O-ND2 3.42Å; Q73-N77 PolarHBondContact O-OD1 3.25Å; D74-N77 PolarHBondContact O-N 2.94Å; N77-K79 VanDerWaalsContact C-N 3.34Å; N77-K79 PolarHBondContact O-N 2.93Å; N77-G80 PolarHBondContact O-N 3.31Å; N77-G80 VanDerWaalsContact O-N 3.15Å; N77-S81 PolarHBondContact O-N 3.13Å; N77-S81 PolarHBondContact O-OG 3.29Å
78	L	98	Very high	96.9	Very high	114 Å²	114	88.7 Å²	88.7	60%	0.597	50%	0.496	S	S	*	.	H	α-helix	trans	-60.6	-43.3	177.9	-179.7	61.7	0	0	0	111.7	D74 V75 G80 S81 V82	D74-L78 WeakPolarHBondContact O-CB 3.37Å; D74-L78 PolarHBondContact O-N 3.43Å; V75-L78 PolarHBondContact O-N 3.47Å; L78-G80 VanDerWaalsContact C-N 3.31Å; L78-G80 PolarHBondContact O-N 3.34Å; L78-S81 PolarHBondContact O-N 2.9Å; L78-V82 HydrophobicContact CD1-CG2 4.44Å; L78-V82 WeakPolarHBondContact O-CG2 3.36Å; L78-V82 PolarHBondContact O-N 3.49Å
79	K	98	Very high	96.9	Very high	122 Å²	122	86.4 Å²	86.4	53%	0.53	49%	0.494	S	S	.	.	H	α-helix	trans	-57.1	-45.8	174	178.5	177.1	-179.8	-72.4	0	111.2	V75 A76 N77 V82 E83	V75-K79 WeakPolarHBondContact O-CB 3.36Å; V75-K79 PolarHBondContact O-N 3Å; A76-K79 PolarHBondContact O-N 3.41Å; N77-K79 VanDerWaalsContact C-N 3.34Å; N77-K79 PolarHBondContact O-N 2.93Å; K79-V82 PolarHBondContact O-N 3.44Å; K79-E83 WeakPolarHBondContact CE-OE1 3.43Å; K79-E83 IonicContact NZ-OE1 2.65Å; K79-E83 PolarHBondContact NZ-OE1 2.97Å; K79-E83 IonicContact NZ-OE2 3.72Å; K79-E83 WeakPolarHBondContact O-CG 3.4Å; K79-E83 PolarHBondContact O-N 3.01Å
80	G	98	Very high	96.8	Very high	26 Å²	26	87.2 Å²	87.2	27%	0.268	49%	0.494	S	S	.	.	H	α-helix	trans	-57.7	-48.1	175.2	0	0	0	0	0	112.6	A76 N77 L78 V82 E83 E84	A76-G80 PolarHBondContact O-N 2.94Å; N77-G80 PolarHBondContact O-N 3.31Å; N77-G80 VanDerWaalsContact O-N 3.15Å; L78-G80 VanDerWaalsContact C-N 3.31Å; L78-G80 PolarHBondContact O-N 3.34Å; G80-V82 VanDerWaalsContact C-N 3.34Å; G80-V82 PolarHBondContact O-N 3.03Å; G80-E83 PolarHBondContact O-N 3.34Å; G80-E84 WeakPolarHBondContact O-CG 3.28Å; G80-E84 PolarHBondContact O-N 3.15Å
81	S	97.7	Very high	96.6	Very high	61 Å²	61	86.7 Å²	86.7	43%	0.427	49%	0.489	S	S	.	.	H	α-helix	trans	-61.9	-39.2	177.1	-58.7	0	0	0	0	113.1	N77 L78 E84 V85	N77-S81 PolarHBondContact O-N 3.13Å; N77-S81 PolarHBondContact O-OG 3.29Å; L78-S81 PolarHBondContact O-N 2.9Å; S81-E84 PolarHBondContact O-N 2.65Å; S81-V85 WeakPolarHBondContact O-CG2 3.34Å; S81-V85 PolarHBondContact O-N 3.4Å
82	V	97.6	Very high	96.4	Very high	88 Å²	88	83.6 Å²	83.6	53%	0.533	48%	0.483	S	S	.	.	H	α-helix	trans	-66.1	-40.9	176	171.5	0	0	0	0	111.1	L78 K79 G80 V85 H86	L78-V82 HydrophobicContact CD1-CG2 4.44Å; L78-V82 WeakPolarHBondContact O-CG2 3.36Å; L78-V82 PolarHBondContact O-N 3.49Å; K79-V82 PolarHBondContact O-N 3.44Å; G80-V82 VanDerWaalsContact C-N 3.34Å; G80-V82 PolarHBondContact O-N 3.03Å; V82-V85 PolarHBondContact O-N 2.95Å; V82-H86 VanDerWaalsContact O-CB 3.28Å; V82-H86 WeakPolarHBondContact O-CB 3.37Å; V82-H86 PolarHBondContact O-N 3.37Å
83	E	97.7	Very high	96	Very high	102 Å²	102	83.2 Å²	83.2	48%	0.477	48%	0.476	S	S	.	.	H	α-helix	trans	-63.7	-40.4	176.1	-74.9	173.1	170.3	0	0	112	K79 G80 H86 A87	K79-E83 WeakPolarHBondContact CE-OE1 3.43Å; K79-E83 IonicContact NZ-OE1 2.65Å; K79-E83 PolarHBondContact NZ-OE1 2.97Å; K79-E83 IonicContact NZ-OE2 3.72Å; K79-E83 WeakPolarHBondContact O-CG 3.4Å; K79-E83 PolarHBondContact O-N 3.01Å; G80-E83 PolarHBondContact O-N 3.34Å; E83-H86 PolarHBondContact O-N 2.88Å; E83-A87 WeakPolarHBondContact O-CB 3.4Å; E83-A87 PolarHBondContact O-N 3.44Å
84	E	97.5	Very high	95.6	Very high	143 Å²	143	84.4 Å²	84.4	67%	0.668	48%	0.482	S	S	*	.	H	α-helix	trans	-62	-47.4	173.9	-74.1	176.3	-176.1	0	0	112.1	G80 S81 A87 A88	G80-E84 WeakPolarHBondContact O-CG 3.28Å; G80-E84 PolarHBondContact O-N 3.15Å; S81-E84 PolarHBondContact O-N 2.65Å; E84-A87 PolarHBondContact O-N 3.31Å; E84-A88 WeakPolarHBondContact O-CB 3.37Å; E84-A88 PolarHBondContact O-N 3.49Å
85	V	96.9	Very high	95.1	Very high	92 Å²	92	88.5 Å²	88.5	56%	0.558	49%	0.489	S	S	*	.	H	α-helix	trans	-62.1	-45.3	177	171.1	0	0	0	0	110.5	S81 V82 A87 A88 C89	S81-V85 WeakPolarHBondContact O-CG2 3.34Å; S81-V85 PolarHBondContact O-N 3.4Å; V82-V85 PolarHBondContact O-N 2.95Å; V85-A87 VanDerWaalsContact C-N 3.35Å; V85-A87 PolarHBondContact O-N 2.89Å; V85-A88 PolarHBondContact O-N 3.29Å; V85-C89 WeakPolarHBondContact O-CB 3.44Å; V85-C89 PolarHBondContact O-N 2.87Å; V85-C89 PolarHBondContact O-SG 3.21Å
86	H	96.3	Very high	94.5	Very high	114 Å²	114	87.6 Å²	87.6	53%	0.528	48%	0.481	S	S	.	.	H	α-helix	trans	-59.4	-44.6	176.8	175.8	-105.1	0	0	0	111.7	V82 E83 A88 C89 L90	V82-H86 VanDerWaalsContact O-CB 3.28Å; V82-H86 WeakPolarHBondContact O-CB 3.37Å; V82-H86 PolarHBondContact O-N 3.37Å; E83-H86 PolarHBondContact O-N 2.88Å; H86-A88 PolarHBondContact O-N 3.3Å; H86-C89 PolarHBondContact O-N 3.22Å; H86-L90 WeakPolarHBondContact CE1-CD1 3.42Å; H86-L90 WeakPolarHBondContact O-CG 3.49Å; H86-L90 PolarHBondContact O-N 2.88Å
87	A	95.8	Very high	93.7	Very high	55 Å²	55	89.8 Å²	89.8	46%	0.455	48%	0.483	S	S	.	.	H	α-helix	trans	-62.7	-41.7	175.7	0	0	0	0	0	112.4	E83 E84 V85 L90 A91	E83-A87 WeakPolarHBondContact O-CB 3.4Å; E83-A87 PolarHBondContact O-N 3.44Å; E84-A87 PolarHBondContact O-N 3.31Å; V85-A87 VanDerWaalsContact C-N 3.35Å; V85-A87 PolarHBondContact O-N 2.89Å; A87-L90 PolarHBondContact O-N 3.28Å; A87-A91 WeakPolarHBondContact O-CB 3.41Å; A87-A91 PolarHBondContact O-N 3.48Å
88	A	95	Very high	92.8	Very high	60 Å²	60	91 Å²	91	50%	0.496	49%	0.493	S	S	.	.	H	α-helix	trans	-63.3	-41.7	175.3	0	0	0	0	0	112	E84 V85 H86 A91 A92	E84-A88 WeakPolarHBondContact O-CB 3.37Å; E84-A88 PolarHBondContact O-N 3.49Å; V85-A88 PolarHBondContact O-N 3.29Å; H86-A88 PolarHBondContact O-N 3.3Å; A88-A91 PolarHBondContact O-N 2.93Å; A88-A92 WeakPolarHBondContact O-CB 3.43Å; A88-A92 PolarHBondContact O-N 3.44Å
89	C	94.1	Very high	91.7	Very high	75 Å²	75	89.2 Å²	89.2	51%	0.507	48%	0.483	S	S	.	.	H	α-helix	trans	-62.2	-44.7	174.6	-71.5	0	0	0	0	112	V85 H86 A92 R93	V85-C89 WeakPolarHBondContact O-CB 3.44Å; V85-C89 PolarHBondContact O-N 2.87Å; V85-C89 PolarHBondContact O-SG 3.21Å; H86-C89 PolarHBondContact O-N 3.22Å; C89-A92 PolarHBondContact O-N 3.39Å; C89-R93 WeakPolarHBondContact O-CB 3.13Å; C89-R93 PolarHBondContact O-N 2.94Å
90	L	92.7	Very high	89.9	Confident	80 Å²	80	88.8 Å²	88.8	42%	0.419	49%	0.493	S	S	.	.	H	α-helix	trans	-62	-44.9	175.2	-73.1	179.5	0	0	0	111.9	H86 A87 A92 R93 Q94	H86-L90 WeakPolarHBondContact CE1-CD1 3.42Å; H86-L90 WeakPolarHBondContact O-CG 3.49Å; H86-L90 PolarHBondContact O-N 2.88Å; A87-L90 PolarHBondContact O-N 3.28Å; L90-A92 VanDerWaalsContact C-N 3.35Å; L90-A92 PolarHBondContact O-N 3.05Å; L90-R93 PolarHBondContact O-N 3.32Å; L90-Q94 WeakPolarHBondContact O-CG 3.09Å; L90-Q94 PolarHBondContact O-N 3Å
91	A	92	Very high	88.4	Confident	38 Å²	38	96.9 Å²	96.9	31%	0.314	52%	0.523	S	S	.	.	H	α-helix	trans	-62.9	-41.3	177.4	0	0	0	0	0	111.8	A87 A88 Q94 R95	A87-A91 WeakPolarHBondContact O-CB 3.41Å; A87-A91 PolarHBondContact O-N 3.48Å; A88-A91 PolarHBondContact O-N 2.93Å; A91-Q94 PolarHBondContact O-N 3.37Å; A91-R95 WeakPolarHBondContact O-CG 3.44Å; A91-R95 PolarHBondContact O-N 3.38Å
92	A	90.9	Very high	86.6	Confident	47 Å²	47	98.5 Å²	98.5	39%	0.388	52%	0.523	S	S	.	.	H	α-helix	trans	-63.1	-44.6	174.4	0	0	0	0	0	111.5	A88 C89 L90 Q94 R95 L96	A88-A92 WeakPolarHBondContact O-CB 3.43Å; A88-A92 PolarHBondContact O-N 3.44Å; C89-A92 PolarHBondContact O-N 3.39Å; L90-A92 VanDerWaalsContact C-N 3.35Å; L90-A92 PolarHBondContact O-N 3.05Å; A92-Q94 PolarHBondContact O-N 2.88Å; A92-R95 PolarHBondContact O-N 2.91Å; A92-L96 WeakPolarHBondContact O-CG 3.36Å; A92-L96 PolarHBondContact O-N 3.34Å
93	R	89	Confident	85	Confident	91 Å²	91	98.9 Å²	98.9	34%	0.343	53%	0.528	S	S	.	.	H	α-helix	trans	-60.3	-44	176.8	-170.7	170.9	-177.4	158.3	-5.2	111.7	C89 L90 L96 H97 C108	C89-R93 WeakPolarHBondContact O-CB 3.13Å; C89-R93 PolarHBondContact O-N 2.94Å; L90-R93 PolarHBondContact O-N 3.32Å; R93-L96 PolarHBondContact O-N 2.91Å; R93-H97 PolarHBondContact O-CD2 3.22Å; R93-H97 PolarHBondContact O-N 3.27Å; R93-C108 PolarHBondContact NH2-SG 2.91Å
94	Q	89	Confident	83.1	Confident	135 Å²	135	97.7 Å²	97.7	63%	0.631	52%	0.519	S	S	*	.	H	α-helix	trans	-61	-45.4	174.9	-73.5	175.1	-2	0	0	112.3	L90 A91 A92 L96 H97 T98	L90-Q94 WeakPolarHBondContact O-CG 3.09Å; L90-Q94 PolarHBondContact O-N 3Å; A91-Q94 PolarHBondContact O-N 3.37Å; A92-Q94 PolarHBondContact O-N 2.88Å; Q94-L96 VanDerWaalsContact C-N 3.34Å; Q94-L96 PolarHBondContact O-N 2.48Å; Q94-H97 PolarHBondContact O-N 3.1Å; Q94-T98 PolarHBondContact O-N 3.11Å
95	R	88	Confident	81.2	Confident	188 Å²	188	96 Å²	96	71%	0.709	52%	0.523	S	S	*	.	H	α-helix	trans	-61.2	-43.5	175.8	-73.2	175.7	-177.2	172.6	2.2	111.7	A91 A92 H97 T98	A91-R95 WeakPolarHBondContact O-CG 3.44Å; A91-R95 PolarHBondContact O-N 3.38Å; A92-R95 PolarHBondContact O-N 2.91Å; R95-H97 VanDerWaalsContact C-N 3.3Å; R95-H97 PolarHBondContact O-N 3.41Å; R95-T98 PolarHBondContact O-N 3.31Å; R95-T98 VanDerWaalsContact O-N 3.12Å; R95-T98 PolarHBondContact O-OG1 3.11Å
96	L	84.7	Confident	79.4	Confident	71 Å²	71	99.6 Å²	99.6	37%	0.372	53%	0.534	S	S	.	.	H	α-helix	trans	-58.9	-43.9	176.2	-72.1	174.5	0	0	0	110.4	A92 R93 Q94 T98 I99 F102 Y104	A92-L96 WeakPolarHBondContact O-CG 3.36Å; A92-L96 PolarHBondContact O-N 3.34Å; R93-L96 PolarHBondContact O-N 2.91Å; Q94-L96 VanDerWaalsContact C-N 3.34Å; Q94-L96 PolarHBondContact O-N 2.48Å; L96-T98 PolarHBondContact O-N 3.47Å; L96-T98 VanDerWaalsContact O-N 3.11Å; L96-I99 HydrophobicContact CD2-CD1 4.09Å; L96-I99 PolarHBondContact O-N 2.68Å; L96-I99 VanDerWaalsContact O-N 3.1Å; L96-F102 HydrophobicContact CD2-CE1 4.38Å; L96-F102 HydrophobicContact CD2-CE2 4.33Å; L96-F102 HydrophobicContact CD2-CZ 4.21Å; L96-Y104 VanDerWaalsContact C-OH 3.32Å; L96-Y104 HydrophobicContact CB-CE1 4.38Å; L96-Y104 WeakPolarHBondContact O-CE1 3.18Å; L96-Y104 PolarHBondContact O-OH 3.24Å
97	H	80.1	Confident	77.5	Confident	97 Å²	97	102.4 Å²	102.4	45%	0.449	55%	0.545	S	S	.	.	H	α-helix	trans	-58.9	-18.9	177	-78.9	-63.3	0	0	0	115.3	R93 Q94 R95 Y104	R93-H97 PolarHBondContact O-CD2 3.22Å; R93-H97 PolarHBondContact O-N 3.27Å; Q94-H97 PolarHBondContact O-N 3.1Å; R95-H97 VanDerWaalsContact C-N 3.3Å; R95-H97 PolarHBondContact O-N 3.41Å; H97-Y104 VanDerWaalsContact C-OH 3.28Å; H97-Y104 VanDerWaalsContact CA-CE1 3.46Å; H97-Y104 WeakPolarHBondContact CA-OH 3.27Å; H97-Y104 HydrophobicContact CB-CE1 4.29Å; H97-Y104 AromaticContact CE1-CD1 3.56Å; H97-Y104 AromaticContact CE1-CE1 3.98Å; H97-Y104 AromaticContact CG-CE1 3.9Å; H97-Y104 AromaticContact ND1-CD1 3.43Å; H97-Y104 WeakPolarHBondContact ND1-CD1 3.35Å; H97-Y104 AromaticContact ND1-CE1 3.41Å; H97-Y104 WeakPolarHBondContact ND1-CE1 3.38Å; H97-Y104 AromaticContact ND1-CZ 3.98Å; H97-Y104 PolarHBondContact O-OH 3.02Å
98	T	79.5	Confident	75.5	Confident	112 Å²	112	102.9 Å²	102.9	69%	0.687	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.5	-7.4	177.8	63	0	0	0	0	114.4	Q94 R95 L96 P100	Q94-T98 PolarHBondContact O-N 3.11Å; R95-T98 PolarHBondContact O-N 3.31Å; R95-T98 VanDerWaalsContact O-N 3.12Å; R95-T98 PolarHBondContact O-OG1 3.11Å; L96-T98 PolarHBondContact O-N 3.47Å; L96-T98 VanDerWaalsContact O-N 3.11Å; T98-P100 VanDerWaalsContact O-CD 3.27Å; T98-P100 WeakPolarHBondContact O-CD 3.37Å
99	I	74.8	Confident	73.3	Confident	76 Å²	76	109.2 Å²	109.2	39%	0.39	56%	0.563	S	S	.	*	S	Bend	trans	-85.3	111.3	-178.9	-57.4	174.1	0	0	0	109.7	L96 H101 F102 Y104	L96-I99 HydrophobicContact CD2-CD1 4.09Å; L96-I99 PolarHBondContact O-N 2.68Å; L96-I99 VanDerWaalsContact O-N 3.1Å; I99-H101 PolarHBondContact O-N 3.12Å; I99-F102 HydrophobicContact CD1-CD2 4.46Å; I99-F102 HydrophobicContact CG2-CD2 4.43Å; I99-F102 PolarHBondContact O-N 2.88Å; I99-Y104 PolarHBondContact O-OH 3.45Å; I99-Y104 VanDerWaalsContact O-OH 3.11Å
100	P	61.4	Low	71.1	Confident	114 Å²	114	116.3 Å²	116.3	74%	0.74	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.7	126.7	171.4	27.7	-30.5	0	0	0	108.7	T98	T98-P100 VanDerWaalsContact O-CD 3.27Å; T98-P100 WeakPolarHBondContact O-CD 3.37Å
101	H	66.5	Low	70	Confident	195 Å²	195	118.2 Å²	118.2	90%	0.903	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	94.9	8.3	-174.7	-74.6	-74.3	0	0	0	119.7	I99	I99-H101 PolarHBondContact O-N 3.12Å
102	F	59	Low	68.8	Low	95 Å²	95	122.4 Å²	122.4	42%	0.417	62%	0.619	S	S	.	*			trans	-83	131.4	171.6	-134	-92.7	0	0	0	112.5	L96 I99 Y104	L96-F102 HydrophobicContact CD2-CE1 4.38Å; L96-F102 HydrophobicContact CD2-CE2 4.33Å; L96-F102 HydrophobicContact CD2-CZ 4.21Å; I99-F102 HydrophobicContact CD1-CD2 4.46Å; I99-F102 HydrophobicContact CG2-CD2 4.43Å; I99-F102 PolarHBondContact O-N 2.88Å; F102-Y104 HydrophobicContact CB-CE1 4.19Å; F102-Y104 HydrophobicContact CB-CE2 4.14Å; F102-Y104 WeakPolarHBondContact O-CD2 3.48Å; F102-Y104 WeakPolarHBondContact O-CE2 3.4Å; F102-Y104 PolarHBondContact O-N 3.48Å
103	P	63.5	Low	67.6	Low	97 Å²	97	126.6 Å²	126.6	63%	0.63	63%	0.632	S	S	*	*			trans	-79.8	104.1	176	30.2	-30.7	0	0	0	110.5	S105	P103-S105 PolarHBondContact O-N 3.45Å
104	Y	58.3	Low	66.3	Low	77 Å²	77	128.6 Å²	128.6	30%	0.302	65%	0.649	S	S	.	*			trans	-82.6	4.3	-173.3	-64	-78.3	0	0	0	116.4	L96 H97 I99 F102	L96-Y104 VanDerWaalsContact C-OH 3.32Å; L96-Y104 HydrophobicContact CB-CE1 4.38Å; L96-Y104 WeakPolarHBondContact O-CE1 3.18Å; L96-Y104 PolarHBondContact O-OH 3.24Å; H97-Y104 VanDerWaalsContact C-OH 3.28Å; H97-Y104 VanDerWaalsContact CA-CE1 3.46Å; H97-Y104 WeakPolarHBondContact CA-OH 3.27Å; H97-Y104 HydrophobicContact CB-CE1 4.29Å; H97-Y104 AromaticContact CE1-CD1 3.56Å; H97-Y104 AromaticContact CE1-CE1 3.98Å; H97-Y104 AromaticContact CG-CE1 3.9Å; H97-Y104 AromaticContact ND1-CD1 3.43Å; H97-Y104 WeakPolarHBondContact ND1-CD1 3.35Å; H97-Y104 AromaticContact ND1-CE1 3.41Å; H97-Y104 WeakPolarHBondContact ND1-CE1 3.38Å; H97-Y104 AromaticContact ND1-CZ 3.98Å; H97-Y104 PolarHBondContact O-OH 3.02Å; I99-Y104 PolarHBondContact O-OH 3.45Å; I99-Y104 VanDerWaalsContact O-OH 3.11Å; F102-Y104 HydrophobicContact CB-CE1 4.19Å; F102-Y104 HydrophobicContact CB-CE2 4.14Å; F102-Y104 WeakPolarHBondContact O-CD2 3.48Å; F102-Y104 WeakPolarHBondContact O-CE2 3.4Å; F102-Y104 PolarHBondContact O-N 3.48Å
105	S	58.5	Low	64.9	Low	106 Å²	106	128.3 Å²	128.3	74%	0.741	65%	0.65	S	S	*	*	S	Bend	trans	-79.6	-20.5	-165.8	54.1	0	0	0	0	115.6	P103	P103-S105 PolarHBondContact O-N 3.45Å
106	E	58.4	Low	63.4	Low	169 Å²	169	124.3 Å²	124.3	79%	0.79	65%	0.646	S	S	*	*	S	Bend	trans	-103.3	-15.6	-170.8	-70.4	-172.3	161.8	0	0	115.3
107	F	56.2	Low	61.8	Low	173 Å²	173	128.1 Å²	128.1	76%	0.759	67%	0.666	S	S	*	*	S	Bend	trans	-100.7	8.8	-172.2	-77.9	-83.8	0	0	0	115.1	Q109	F107-Q109 PolarHBondContact O-N 3.42Å
108	C	52.8	Low	60.4	Low	64 Å²	64	130.5 Å²	130.5	43%	0.432	68%	0.682	S	S	.	*			trans	-89.3	11.9	-173.1	-73.8	0	0	0	0	116.4	R93	R93-C108 PolarHBondContact NH2-SG 2.91Å
109	Q	50.4	Low	58.9	Low	194 Å²	194	132 Å²	132	91%	0.907	68%	0.682	S	S	*	*			trans	-117	20.5	-170.7	-69.4	-170.9	-8.6	0	0	117.3	F107	F107-Q109 PolarHBondContact O-N 3.42Å
110	L	46.4	Very low	57.4	Low	224 Å²	224	137.1 Å²	137.1	100%	1.173	71%	0.708	S	S	*	*			trans	-116.5	0	164.2	-76.3	159.4	0	0	0	109.1

Retrieved 110 of 110 residues in 104 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).