A0A077ZBZ6_TRITR Loading...

EGF domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZBZ6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 101 aa.

						>A0A077ZBZ6_TRITR|A0A077ZBZ6
MNDGTCLNVSDGFRCICKPYFKGIYCEQIEIVRPKEHSEYFPAQDAKPVMFATVIATISLFICCFVGMMIIQHTEYDKQDTEDNQQLTDMRLAQSGYDSYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.7	Low	83.5	Confident	154 Å²	154	104.3 Å²	104.3	76%	0.759	60%	0.602	S	S	*	*				0	118.2	0	-163.8	134.7	150.1	0	0	107.3	D3 G4 Y25 E27	M1-D3 PolarHBondContact O-N 2.74Å; M1-G4 PolarHBondContact O-N 3.41Å; M1-Y25 HydrophobicContact CE-CG 4.47Å; M1-E27 HydrophobicContact CE-CB 3.78Å
2	N	71.3	Confident	83.9	Confident	80 Å²	80	98.6 Å²	98.6	43%	0.428	58%	0.583	S	S	.	*	T	Hydrogen-bonded Turn	trans	40.6	32.2	178.7	-60.2	-21.8	0	0	0	117.9	G4 F21 C26	N2-G4 PolarHBondContact O-N 3.06Å; N2-G4 VanDerWaalsContact O-N 3.15Å; N2-F21 HydrophobicContact CB-CD1 4.36Å; N2-F21 HydrophobicContact CB-CE1 4.29Å; N2-C26 PolarHBondContact ND2-O 3.4Å
3	D	78.5	Confident	84.2	Confident	121 Å²	121	98.1 Å²	98.1	65%	0.647	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	54.4	29.9	177.4	-146.5	27.5	0	0	0	115	M1 K18	M1-D3 PolarHBondContact O-N 2.74Å; D3-K18 HydrophobicContact CB-CD 4.18Å; D3-K18 VanDerWaalsContact O-CE 3.32Å; D3-K18 WeakPolarHBondContact O-CE 3.37Å; D3-K18 VanDerWaalsContact OD2-CE 3.26Å; D3-K18 WeakPolarHBondContact OD2-CE 3.36Å; D3-K18 IonicContact OD2-NZ 2.56Å; D3-K18 PolarHBondContact OD2-NZ 3.14Å
4	G	82.3	Confident	84.7	Confident	23 Å²	23	102.9 Å²	102.9	24%	0.237	57%	0.573	C	S	.	*	P	Polyproline II helix	trans	-89.4	155.7	169.2	0	0	0	0	0	112.4	M1 N2 I16	M1-G4 PolarHBondContact O-N 3.41Å; N2-G4 PolarHBondContact O-N 3.06Å; N2-G4 VanDerWaalsContact O-N 3.15Å; G4-I16 CarbonylContact C-O 3.55Å; G4-I16 WeakPolarHBondContact CA-O 3.43Å
5	T	90.3	Very high	85.2	Confident	86 Å²	86	96.9 Å²	96.9	53%	0.528	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	117.6	179.4	-56.4	0	0	0	0	110.1	L7 C15 I16	T5-L7 HydrophobicContact CG2-CD2 4.06Å; T5-C15 WeakPolarHBondContact O-CA 3.24Å; T5-I16 PolarHBondContact N-O 3.33Å; T5-I16 PolarHBondContact O-N 2.96Å
6	C	91.8	Very high	85.6	Confident	76 Å²	76	96.4 Å²	96.4	51%	0.514	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	123.8	176.5	-56.7	0	0	0	0	111.1	C15	C6-C15 HydrophobicContact CB-CB 4.15Å; C6-C15 WeakPolarHBondContact CB-SG 3.36Å; C6-C15 WeakPolarHBondContact SG-CB 3.31Å; C6-C15 CovalentContact SG-SG 2.05Å; C6-C15 PolarHBondContact SG-SG 2.97Å
7	L	91	Very high	85.9	Confident	91 Å²	91	93 Å²	93	48%	0.476	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	139.2	-179.8	-58.6	175.4	0	0	0	109.6	T5 V9 F13 R14 I16	T5-L7 HydrophobicContact CG2-CD2 4.06Å; L7-V9 PolarHBondContact O-N 2.96Å; L7-F13 WeakPolarHBondContact O-CA 3.41Å; L7-R14 PolarHBondContact N-O 3.37Å; L7-R14 PolarHBondContact O-N 2.75Å; L7-I16 HydrophobicContact CD1-CD1 3.91Å
8	N	90.5	Very high	86.1	Confident	151 Å²	151	93.2 Å²	93.2	81%	0.807	51%	0.513	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.2	117.3	170.3	-156.8	5.4	0	0	0	108.1	G12	N8-G12 PolarHBondContact OD1-O 3.22Å
9	V	89.9	Confident	86.1	Confident	67 Å²	67	93.6 Å²	93.6	41%	0.406	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	163.2	178.3	-67.5	0	0	0	0	109	L7 D11 G12 R14	L7-V9 PolarHBondContact O-N 2.96Å; V9-D11 PolarHBondContact O-N 3.33Å; V9-G12 CarbonylContact C-O 3.42Å; V9-G12 VanDerWaalsContact CG2-O 3.28Å; V9-G12 WeakPolarHBondContact CG2-O 3.34Å; V9-G12 PolarHBondContact N-O 3.38Å; V9-G12 PolarHBondContact O-N 2.99Å; V9-G12 VanDerWaalsContact O-N 3.1Å; V9-R14 HydrophobicContact CG1-CB 4.27Å; V9-R14 HydrophobicContact CG2-CB 4.29Å
10	S	88.3	Confident	86.2	Confident	139 Å²	139	96 Å²	96	97%	0.972	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-22	-174.1	51.8	0	0	0	0	114.8
11	D	85.5	Confident	86.4	Confident	159 Å²	159	94.4 Å²	94.4	85%	0.85	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-118.2	28.9	-177.5	-163.8	33.1	0	0	0	112.6	V9	V9-D11 PolarHBondContact O-N 3.33Å
12	G	88.5	Confident	87.9	Confident	36 Å²	36	91.1 Å²	91.1	37%	0.371	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	127.1	-141.2	176.8	0	0	0	0	0	113.3	N8 V9	N8-G12 PolarHBondContact OD1-O 3.22Å; V9-G12 CarbonylContact C-O 3.42Å; V9-G12 VanDerWaalsContact CG2-O 3.28Å; V9-G12 WeakPolarHBondContact CG2-O 3.34Å; V9-G12 PolarHBondContact N-O 3.38Å; V9-G12 PolarHBondContact O-N 2.99Å; V9-G12 VanDerWaalsContact O-N 3.1Å
13	F	88.6	Confident	88.8	Confident	92 Å²	92	88.9 Å²	88.9	40%	0.404	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	146.8	178.2	72	-82.9	0	0	0	110.9	L7 I24 Y25	L7-F13 WeakPolarHBondContact O-CA 3.41Å; F13-I24 HydrophobicContact CE2-CG2 3.5Å; F13-I24 VanDerWaalsContact CE2-CG2 3.5Å; F13-I24 HydrophobicContact CZ-CG2 3.39Å; F13-Y25 HydrophobicContact CD2-CE1 4.31Å; F13-Y25 HydrophobicContact CE1-CE1 4.25Å; F13-Y25 AromaticContact CE2-CD1 3.7Å; F13-Y25 HydrophobicContact CE2-CD1 3.7Å; F13-Y25 AromaticContact CE2-CE1 3.27Å; F13-Y25 HydrophobicContact CE2-CE1 3.27Å; F13-Y25 AromaticContact CE2-CZ 3.83Å; F13-Y25 HydrophobicContact CZ-CD1 4.09Å; F13-Y25 AromaticContact CZ-CE1 3.25Å; F13-Y25 HydrophobicContact CZ-CE1 3.25Å; F13-Y25 HydrophobicContact CZ-CE2 4.17Å; F13-Y25 AromaticContact CZ-CZ 3.31Å; F13-Y25 VanDerWaalsContact CZ-OH 3.25Å; F13-Y25 WeakPolarHBondContact CZ-OH 3.39Å
14	R	90.3	Very high	89.3	Confident	166 Å²	166	88.5 Å²	88.5	63%	0.626	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-131	124	173.8	-170.4	174.7	-171.3	-81.5	-1.3	110	L7 V9	L7-R14 PolarHBondContact N-O 3.37Å; L7-R14 PolarHBondContact O-N 2.75Å; V9-R14 HydrophobicContact CG1-CB 4.27Å; V9-R14 HydrophobicContact CG2-CB 4.29Å
15	C	92.5	Very high	89.6	Confident	12 Å²	12	93 Å²	93	8%	0.081	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	134.8	174.8	-58.1	0	0	0	0	111.5	T5 C6 I24	T5-C15 WeakPolarHBondContact O-CA 3.24Å; C6-C15 HydrophobicContact CB-CB 4.15Å; C6-C15 WeakPolarHBondContact CB-SG 3.36Å; C6-C15 WeakPolarHBondContact SG-CB 3.31Å; C6-C15 CovalentContact SG-SG 2.05Å; C6-C15 PolarHBondContact SG-SG 2.97Å; C15-I24 WeakPolarHBondContact CB-O 3.44Å; C15-I24 PolarHBondContact SG-O 2.99Å
16	I	91.2	Very high	89.7	Confident	90 Å²	90	89 Å²	89	46%	0.462	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	113.7	169	-57.8	175.5	0	0	0	106.9	G4 T5 L7	G4-I16 CarbonylContact C-O 3.55Å; G4-I16 WeakPolarHBondContact CA-O 3.43Å; T5-I16 PolarHBondContact N-O 3.33Å; T5-I16 PolarHBondContact O-N 2.96Å; L7-I16 HydrophobicContact CD1-CD1 3.91Å
17	C	91.6	Very high	89.6	Confident	38 Å²	38	89.3 Å²	89.3	26%	0.257	47%	0.465	S	S	.	.	P	Polyproline II helix	trans	-89.3	147.9	-178.9	-52.6	0	0	0	0	111.5	F21 C26	C17-F21 HydrophobicContact CB-CB 4.12Å; C17-F21 VanDerWaalsContact CB-O 3.27Å; C17-F21 WeakPolarHBondContact CB-O 3.47Å; C17-C26 WeakPolarHBondContact CA-SG 3.42Å; C17-C26 HydrophobicContact CB-CB 3.68Å; C17-C26 WeakPolarHBondContact CB-SG 3.43Å; C17-C26 WeakPolarHBondContact SG-CA 3.34Å; C17-C26 WeakPolarHBondContact SG-CB 3.5Å; C17-C26 CovalentContact SG-SG 2.03Å; C17-C26 PolarHBondContact SG-SG 3.34Å
18	K	88.7	Confident	89.6	Confident	96 Å²	96	89.7 Å²	89.7	42%	0.417	46%	0.464	S	S	.	.	P	Polyproline II helix	trans	-64.2	159.9	167.6	-76	-169.6	174.7	-175.2	0	110.8	D3 Y20 F21	D3-K18 HydrophobicContact CB-CD 4.18Å; D3-K18 VanDerWaalsContact O-CE 3.32Å; D3-K18 WeakPolarHBondContact O-CE 3.37Å; D3-K18 VanDerWaalsContact OD2-CE 3.26Å; D3-K18 WeakPolarHBondContact OD2-CE 3.36Å; D3-K18 IonicContact OD2-NZ 2.56Å; D3-K18 PolarHBondContact OD2-NZ 3.14Å; K18-Y20 PolarHBondContact O-N 3.34Å; K18-F21 HydrophobicContact CB-CD2 4.28Å; K18-F21 PolarHBondContact O-N 3.39Å; K18-F21 VanDerWaalsContact O-N 3.13Å
19	P	86.8	Confident	89.5	Confident	101 Å²	101	88.3 Å²	88.3	66%	0.656	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-48.1	144.7	169.5	-25.8	34.3	0	0	0	111	F21	P19-F21 VanDerWaalsContact C-N 3.27Å; P19-F21 WeakPolarHBondContact O-CD2 3.44Å; P19-F21 PolarHBondContact O-N 3.11Å
20	Y	87.6	Confident	89.3	Confident	142 Å²	142	88.8 Å²	88.8	56%	0.557	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.4	8.4	-176.4	-39.9	-75.3	0	0	0	116.2	K18 I29 E30 V32	K18-Y20 PolarHBondContact O-N 3.34Å; Y20-I29 CarbonylContact O-C 3.57Å; Y20-I29 WeakPolarHBondContact O-CA 3.23Å; Y20-E30 VanDerWaalsContact CA-O 3.28Å; Y20-E30 WeakPolarHBondContact CA-O 3.28Å; Y20-E30 WeakPolarHBondContact CB-O 3.35Å; Y20-E30 PolarHBondContact O-N 2.98Å; Y20-V32 HydrophobicContact CD1-CB 4.1Å; Y20-V32 HydrophobicContact CD1-CG2 4.19Å; Y20-V32 HydrophobicContact CE1-CB 4.12Å
21	F	90.1	Very high	89.1	Confident	62 Å²	62	89.2 Å²	89.2	27%	0.272	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	143.2	173.3	-66.6	-88.8	0	0	0	111.4	N2 C17 K18 P19 C26 Q28 I29	N2-F21 HydrophobicContact CB-CD1 4.36Å; N2-F21 HydrophobicContact CB-CE1 4.29Å; C17-F21 HydrophobicContact CB-CB 4.12Å; C17-F21 VanDerWaalsContact CB-O 3.27Å; C17-F21 WeakPolarHBondContact CB-O 3.47Å; K18-F21 HydrophobicContact CB-CD2 4.28Å; K18-F21 PolarHBondContact O-N 3.39Å; K18-F21 VanDerWaalsContact O-N 3.13Å; P19-F21 VanDerWaalsContact C-N 3.27Å; P19-F21 WeakPolarHBondContact O-CD2 3.44Å; P19-F21 PolarHBondContact O-N 3.11Å; F21-C26 HydrophobicContact CB-CB 4.31Å; F21-Q28 CarbonylContact C-O 3.53Å; F21-Q28 VanDerWaalsContact CA-O 3.26Å; F21-Q28 WeakPolarHBondContact CA-O 3.29Å; F21-I29 HydrophobicContact CD1-CG1 4.04Å; F21-I29 HydrophobicContact CE1-CD1 4.43Å; F21-I29 HydrophobicContact CE1-CG1 3.63Å; F21-I29 HydrophobicContact CZ-CG1 4.41Å
22	K	90.4	Very high	88.8	Confident	86 Å²	86	85.4 Å²	85.4	37%	0.374	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	174.7	176.1	68.2	180	171	-169	0	111.2	C26 E27 Q28 E30	K22-C26 CarbonylContact O-C 3.51Å; K22-C26 WeakPolarHBondContact O-CA 3.3Å; K22-E27 PolarHBondContact O-N 3.09Å; K22-Q28 HydrophobicContact CG-CB 3.82Å; K22-Q28 PolarHBondContact N-O 2.92Å; K22-Q28 WeakPolarHBondContact O-CA 3.39Å; K22-Q28 VanDerWaalsContact O-CB 3.31Å; K22-Q28 WeakPolarHBondContact O-CB 3.49Å; K22-Q28 PolarHBondContact O-N 3.38Å; K22-E30 HydrophobicContact CD-CB 4.04Å; K22-E30 HydrophobicContact CD-CG 4.37Å; K22-E30 HydrophobicContact CG-CB 4.18Å; K22-E30 IonicContact NZ-OE1 2.81Å; K22-E30 PolarHBondContact NZ-OE1 3.1Å
23	G	90.3	Very high	88.2	Confident	32 Å²	32	93.6 Å²	93.6	33%	0.33	45%	0.445	S	S	.	.	S	Bend	trans	109	170.2	-175.5	0	0	0	0	0	112.4	Y25 C26	G23-Y25 VanDerWaalsContact C-N 3.25Å; G23-Y25 PolarHBondContact O-N 2.69Å; G23-C26 PolarHBondContact O-N 3.27Å
24	I	89.1	Confident	87.2	Confident	114 Å²	114	94.8 Å²	94.8	59%	0.585	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.3	-34.5	-176.8	-66.7	173.9	0	0	0	110.6	F13 C15 E27	F13-I24 HydrophobicContact CE2-CG2 3.5Å; F13-I24 VanDerWaalsContact CE2-CG2 3.5Å; F13-I24 HydrophobicContact CZ-CG2 3.39Å; C15-I24 WeakPolarHBondContact CB-O 3.44Å; C15-I24 PolarHBondContact SG-O 2.99Å; I24-E27 PolarHBondContact N-OE2 3.48Å
25	Y	88.7	Confident	86.1	Confident	118 Å²	118	95.7 Å²	95.7	46%	0.463	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-114.3	15.9	178.8	-58.6	-77	0	0	0	112.6	M1 F13 G23 E27	M1-Y25 HydrophobicContact CE-CG 4.47Å; F13-Y25 HydrophobicContact CD2-CE1 4.31Å; F13-Y25 HydrophobicContact CE1-CE1 4.25Å; F13-Y25 AromaticContact CE2-CD1 3.7Å; F13-Y25 HydrophobicContact CE2-CD1 3.7Å; F13-Y25 AromaticContact CE2-CE1 3.27Å; F13-Y25 HydrophobicContact CE2-CE1 3.27Å; F13-Y25 AromaticContact CE2-CZ 3.83Å; F13-Y25 HydrophobicContact CZ-CD1 4.09Å; F13-Y25 AromaticContact CZ-CE1 3.25Å; F13-Y25 HydrophobicContact CZ-CE1 3.25Å; F13-Y25 HydrophobicContact CZ-CE2 4.17Å; F13-Y25 AromaticContact CZ-CZ 3.31Å; F13-Y25 VanDerWaalsContact CZ-OH 3.25Å; F13-Y25 WeakPolarHBondContact CZ-OH 3.39Å; G23-Y25 VanDerWaalsContact C-N 3.25Å; G23-Y25 PolarHBondContact O-N 2.69Å; Y25-E27 VanDerWaalsContact C-OE2 3.31Å; Y25-E27 VanDerWaalsContact CA-OE2 3.31Å; Y25-E27 WeakPolarHBondContact CA-OE2 3.36Å; Y25-E27 WeakPolarHBondContact CB-OE2 3.45Å; Y25-E27 PolarHBondContact N-OE2 3.18Å; Y25-E27 PolarHBondContact O-N 3.01Å
26	C	91.7	Very high	84.7	Confident	2 Å²	2	104 Å²	104	1%	0.014	51%	0.508	C	S	.	.	S	Bend	trans	59	33	-173.7	-45.4	0	0	0	0	113.3	N2 C17 F21 K22 G23	N2-C26 PolarHBondContact ND2-O 3.4Å; C17-C26 WeakPolarHBondContact CA-SG 3.42Å; C17-C26 HydrophobicContact CB-CB 3.68Å; C17-C26 WeakPolarHBondContact CB-SG 3.43Å; C17-C26 WeakPolarHBondContact SG-CA 3.34Å; C17-C26 WeakPolarHBondContact SG-CB 3.5Å; C17-C26 CovalentContact SG-SG 2.03Å; C17-C26 PolarHBondContact SG-SG 3.34Å; F21-C26 HydrophobicContact CB-CB 4.31Å; K22-C26 CarbonylContact O-C 3.51Å; K22-C26 WeakPolarHBondContact O-CA 3.3Å; G23-C26 PolarHBondContact O-N 3.27Å
27	E	89.4	Confident	83	Confident	82 Å²	82	107.7 Å²	107.7	38%	0.383	52%	0.523	S	S	.	.			trans	-80.7	-17.5	-176.8	71.7	-74.5	175.7	0	0	113.8	M1 K22 I24 Y25	M1-E27 HydrophobicContact CE-CB 3.78Å; K22-E27 PolarHBondContact O-N 3.09Å; I24-E27 PolarHBondContact N-OE2 3.48Å; Y25-E27 VanDerWaalsContact C-OE2 3.31Å; Y25-E27 VanDerWaalsContact CA-OE2 3.31Å; Y25-E27 WeakPolarHBondContact CA-OE2 3.36Å; Y25-E27 WeakPolarHBondContact CB-OE2 3.45Å; Y25-E27 PolarHBondContact N-OE2 3.18Å; Y25-E27 PolarHBondContact O-N 3.01Å
28	Q	91	Very high	81.3	Confident	99 Å²	99	110.3 Å²	110.3	46%	0.463	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	133.7	-176.7	-52.8	-179.2	-17.6	0	0	110.4	F21 K22	F21-Q28 CarbonylContact C-O 3.53Å; F21-Q28 VanDerWaalsContact CA-O 3.26Å; F21-Q28 WeakPolarHBondContact CA-O 3.29Å; K22-Q28 HydrophobicContact CG-CB 3.82Å; K22-Q28 PolarHBondContact N-O 2.92Å; K22-Q28 WeakPolarHBondContact O-CA 3.39Å; K22-Q28 VanDerWaalsContact O-CB 3.31Å; K22-Q28 WeakPolarHBondContact O-CB 3.49Å; K22-Q28 PolarHBondContact O-N 3.38Å
29	I	89.6	Confident	79.6	Confident	121 Å²	121	115.3 Å²	115.3	62%	0.621	57%	0.567	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.5	126.1	170.2	-60.9	170	0	0	0	108.5	Y20 F21 I31	Y20-I29 CarbonylContact O-C 3.57Å; Y20-I29 WeakPolarHBondContact O-CA 3.23Å; F21-I29 HydrophobicContact CD1-CG1 4.04Å; F21-I29 HydrophobicContact CE1-CD1 4.43Å; F21-I29 HydrophobicContact CE1-CG1 3.63Å; F21-I29 HydrophobicContact CZ-CG1 4.41Å; I29-I31 HydrophobicContact CG2-CG1 4.37Å
30	E	86.3	Confident	78.3	Confident	78 Å²	78	120.1 Å²	120.1	36%	0.364	57%	0.573	S	S	.	*			trans	-101.9	105.4	169.2	-177.1	155.7	-119.3	0	0	110	Y20 K22 V32	Y20-E30 VanDerWaalsContact CA-O 3.28Å; Y20-E30 WeakPolarHBondContact CA-O 3.28Å; Y20-E30 WeakPolarHBondContact CB-O 3.35Å; Y20-E30 PolarHBondContact O-N 2.98Å; K22-E30 HydrophobicContact CD-CB 4.04Å; K22-E30 HydrophobicContact CD-CG 4.37Å; K22-E30 HydrophobicContact CG-CB 4.18Å; K22-E30 IonicContact NZ-OE1 2.81Å; K22-E30 PolarHBondContact NZ-OE1 3.1Å; E30-V32 VanDerWaalsContact C-N 3.32Å; E30-V32 HydrophobicContact CG-CG2 4.05Å; E30-V32 PolarHBondContact O-N 3.35Å
31	I	83.4	Confident	76.4	Confident	147 Å²	147	118.1 Å²	118.1	75%	0.754	57%	0.567	S	S	*	*			trans	-73.4	91.5	171.9	-53.2	175.2	0	0	0	107.7	I29 R33	I29-I31 HydrophobicContact CG2-CG1 4.37Å; I31-R33 PolarHBondContact O-N 2.91Å
32	V	78.6	Confident	74.5	Confident	79 Å²	79	121 Å²	121	48%	0.479	59%	0.593	S	S	.	*			trans	-72.7	100.2	169	-176	0	0	0	0	107.1	Y20 E30	Y20-V32 HydrophobicContact CD1-CB 4.1Å; Y20-V32 HydrophobicContact CD1-CG2 4.19Å; Y20-V32 HydrophobicContact CE1-CB 4.12Å; E30-V32 VanDerWaalsContact C-N 3.32Å; E30-V32 HydrophobicContact CG-CG2 4.05Å; E30-V32 PolarHBondContact O-N 3.35Å
33	R	77.1	Confident	72.9	Confident	208 Å²	208	120.5 Å²	120.5	79%	0.785	61%	0.605	S	S	*	*			trans	-63.1	135.6	161.5	-65.1	-153	-67.8	-122	3.7	107.4	I31 K35	I31-R33 PolarHBondContact O-N 2.91Å; R33-K35 PolarHBondContact O-N 3.31Å; R33-K35 VanDerWaalsContact O-N 3.1Å
34	P	67.7	Low	71.2	Confident	118 Å²	118	126.6 Å²	126.6	77%	0.766	63%	0.625	S	S	*	*			trans	-50.4	124.2	173.5	-21.7	30.4	0	0	0	108.6	E36	P34-E36 PolarHBondContact O-N 3.32Å
35	K	66.2	Low	69.7	Low	185 Å²	185	127.3 Å²	127.3	80%	0.804	63%	0.63	S	S	*	*			trans	-72.2	86.2	162.3	-70.6	-174.7	-179.7	177.4	0	105.3	R33 H37	R33-K35 PolarHBondContact O-N 3.31Å; R33-K35 VanDerWaalsContact O-N 3.1Å; K35-H37 PolarHBondContact O-N 3.11Å
36	E	62.5	Low	68.2	Low	185 Å²	185	124.4 Å²	124.4	86%	0.864	63%	0.63	S	S	*	*			trans	-57.7	104	172.8	-159.7	173.7	-173.8	0	0	107	P34 S38	P34-E36 PolarHBondContact O-N 3.32Å; E36-S38 PolarHBondContact O-N 3.49Å
37	H	55.7	Low	66.8	Low	169 Å²	169	133 Å²	133	78%	0.782	67%	0.667	S	S	*	*			trans	29.1	74.9	175.9	-73.2	-163	0	0	0	116.2	K35 E39	K35-H37 PolarHBondContact O-N 3.11Å; H37-E39 VanDerWaalsContact C-N 3.31Å; H37-E39 PolarHBondContact O-N 2.87Å
38	S	56.5	Low	65.4	Low	92 Å²	92	133 Å²	133	64%	0.643	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.7	14.2	175.9	179.1	0	0	0	0	114.5	E36	E36-S38 PolarHBondContact O-N 3.49Å
39	E	53.4	Low	64.4	Low	202 Å²	202	131.9 Å²	131.9	94%	0.944	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.8	-0.8	169.5	-114.5	171.2	159.3	0	0	112.9	H37	H37-E39 VanDerWaalsContact C-N 3.31Å; H37-E39 PolarHBondContact O-N 2.87Å
40	Y	58.2	Low	63.8	Low	201 Å²	201	132 Å²	132	79%	0.788	67%	0.673	S	S	*	*	S	Bend	trans	-114.5	59.2	168.9	-168	-103.2	0	0	0	110.7
41	F	48.1	Very low	63.8	Low	100 Å²	100	135.6 Å²	135.6	44%	0.439	69%	0.688	S	S	.	*			trans	-157.8	117.5	167.5	-150.3	-126.9	0	0	0	112.4	A43 Q44 A46	F41-A43 VanDerWaalsContact CZ-C 3.47Å; F41-Q44 WeakPolarHBondContact CE2-O 3.47Å; F41-Q44 WeakPolarHBondContact CZ-O 3.41Å; F41-A46 HydrophobicContact CE2-CB 4.42Å
42	P	51.5	Low	63.9	Low	123 Å²	123	131.4 Å²	131.4	80%	0.799	68%	0.676	S	S	*	*	S	Bend		-78.6	126.7	127	32.4	-22.4	0	0	0	107.9
43	A	56.5	Low	64.3	Low	76 Å²	76	130.9 Å²	130.9	63%	0.628	67%	0.672	S	S	*	*	S	Bend	trans	-0.6	138.2	167.1	0	0	0	0	0	120.5	F41	F41-A43 VanDerWaalsContact CZ-C 3.47Å
44	Q	54.4	Low	65	Low	160 Å²	160	124.4 Å²	124.4	75%	0.748	66%	0.656	S	S	*	*	S	Bend	trans	87.1	127.2	168.6	-53.6	170.1	12.3	0	0	119	F41	F41-Q44 WeakPolarHBondContact CE2-O 3.47Å; F41-Q44 WeakPolarHBondContact CZ-O 3.41Å
45	D	56.3	Low	66.2	Low	129 Å²	129	123.9 Å²	123.9	69%	0.69	65%	0.645	S	S	*	*			trans	-49.2	125.6	-151.8	-53	-80.6	0	0	0	117.6	K47 P48	D45-K47 PolarHBondContact O-N 3.01Å; D45-P48 WeakPolarHBondContact O-CD 3.35Å
46	A	57.7	Low	67.5	Low	57 Å²	57	117.4 Å²	117.4	47%	0.471	63%	0.626	S	S	.	*	H	α-helix	trans	-82.1	11.1	-170.5	0	0	0	0	0	117	F41	F41-A46 HydrophobicContact CE2-CB 4.42Å
47	K	62.5	Low	69	Low	183 Å²	183	112.7 Å²	112.7	80%	0.796	61%	0.611	S	S	*	*	H	α-helix	trans	-83.1	-46.1	176.4	-68.1	179.1	-176.3	170.9	0	113.8	D45 F51	D45-K47 PolarHBondContact O-N 3.01Å; K47-F51 WeakPolarHBondContact O-CD2 3.28Å
48	P	60.4	Low	71	Confident	82 Å²	82	108.8 Å²	108.8	53%	0.532	60%	0.595	S	S	.	*	H	α-helix	trans	-75.5	-23	175	27.7	-36.2	0	0	0	114.2	D45 M50 F51 A52	D45-P48 WeakPolarHBondContact O-CD 3.35Å; P48-M50 VanDerWaalsContact C-N 3.32Å; P48-M50 PolarHBondContact O-N 3.49Å; P48-F51 PolarHBondContact O-N 3.23Å; P48-A52 PolarHBondContact O-N 3.32Å
49	V	70.3	Confident	72.9	Confident	75 Å²	75	107.1 Å²	107.1	46%	0.455	58%	0.583	S	S	.	*	H	α-helix	trans	-63.1	-37.8	-176.4	-178.9	0	0	0	0	111.7	F51 A52 T53	V49-F51 PolarHBondContact O-N 3.47Å; V49-A52 PolarHBondContact O-N 3.4Å; V49-T53 HydrophobicContact CG1-CG2 4.23Å; V49-T53 WeakPolarHBondContact O-CG2 3.2Å; V49-T53 PolarHBondContact O-N 2.88Å; V49-T53 PolarHBondContact O-OG1 3.47Å
50	M	75.9	Confident	75	Confident	124 Å²	124	103.1 Å²	103.1	61%	0.611	57%	0.567	S	S	*	*	H	α-helix	trans	-63.4	-40.8	177	-64.3	-57.3	-66	0	0	112.5	P48 T53 V54	P48-M50 VanDerWaalsContact C-N 3.32Å; P48-M50 PolarHBondContact O-N 3.49Å; M50-T53 PolarHBondContact O-OG1 2.85Å; M50-V54 WeakPolarHBondContact O-CB 3.34Å; M50-V54 WeakPolarHBondContact O-CG2 3.4Å; M50-V54 PolarHBondContact O-N 3.45Å; M50-V54 VanDerWaalsContact O-N 3.14Å
51	F	86.4	Confident	76.8	Confident	152 Å²	152	100.9 Å²	100.9	67%	0.667	56%	0.562	S	S	*	*	H	α-helix	trans	-68.6	-41.6	176.4	-66.4	-73.9	0	0	0	111.3	K47 P48 V49 T53 V54 I55	K47-F51 WeakPolarHBondContact O-CD2 3.28Å; P48-F51 PolarHBondContact O-N 3.23Å; V49-F51 PolarHBondContact O-N 3.47Å; F51-T53 PolarHBondContact O-N 2.93Å; F51-V54 PolarHBondContact O-N 3.02Å; F51-I55 WeakPolarHBondContact O-CB 3.22Å; F51-I55 WeakPolarHBondContact O-CD1 3.39Å; F51-I55 WeakPolarHBondContact O-CG1 3.43Å; F51-I55 PolarHBondContact O-N 3.03Å
52	A	86.9	Confident	79.2	Confident	60 Å²	60	100.6 Å²	100.6	50%	0.496	56%	0.564	S	S	.	*	H	α-helix	trans	-62.1	-43.9	178.7	0	0	0	0	0	112.1	P48 V49 I55 A56	P48-A52 PolarHBondContact O-N 3.32Å; V49-A52 PolarHBondContact O-N 3.4Å; A52-I55 PolarHBondContact O-N 3.41Å; A52-A56 WeakPolarHBondContact O-CB 3.29Å; A52-A56 PolarHBondContact O-N 3.43Å
53	T	86.2	Confident	81.4	Confident	67 Å²	67	99 Å²	99	41%	0.411	56%	0.555	S	S	.	*	H	α-helix	trans	-66.4	-41.2	177.9	55.9	0	0	0	0	111.8	V49 M50 F51 A56 T57	V49-T53 HydrophobicContact CG1-CG2 4.23Å; V49-T53 WeakPolarHBondContact O-CG2 3.2Å; V49-T53 PolarHBondContact O-N 2.88Å; V49-T53 PolarHBondContact O-OG1 3.47Å; M50-T53 PolarHBondContact O-OG1 2.85Å; F51-T53 PolarHBondContact O-N 2.93Å; T53-A56 PolarHBondContact O-N 3Å; T53-T57 WeakPolarHBondContact O-CG2 3.42Å; T53-T57 PolarHBondContact O-N 3.49Å; T53-T57 PolarHBondContact O-OG1 2.92Å
54	V	91.4	Very high	83.4	Confident	73 Å²	73	99.2 Å²	99.2	44%	0.442	55%	0.551	S	S	.	*	H	α-helix	trans	-65.1	-43.2	176.8	171.8	0	0	0	0	111.9	M50 F51 A56 T57 I58	M50-V54 WeakPolarHBondContact O-CB 3.34Å; M50-V54 WeakPolarHBondContact O-CG2 3.4Å; M50-V54 PolarHBondContact O-N 3.45Å; M50-V54 VanDerWaalsContact O-N 3.14Å; F51-V54 PolarHBondContact O-N 3.02Å; V54-A56 VanDerWaalsContact C-N 3.31Å; V54-A56 PolarHBondContact O-N 3.43Å; V54-T57 PolarHBondContact O-N 2.85Å; V54-T57 PolarHBondContact O-OG1 2.94Å; V54-I58 HydrophobicContact CG1-CD1 3.77Å; V54-I58 VanDerWaalsContact O-CG1 3.26Å; V54-I58 WeakPolarHBondContact O-CG1 3.29Å; V54-I58 PolarHBondContact O-N 3.2Å
55	I	93.4	Very high	85.5	Confident	106 Å²	106	97.1 Å²	97.1	54%	0.544	54%	0.539	S	S	.	.	H	α-helix	trans	-63.5	-40.9	176.5	-68.5	164.6	0	0	0	110.5	F51 A52 I58 S59	F51-I55 WeakPolarHBondContact O-CB 3.22Å; F51-I55 WeakPolarHBondContact O-CD1 3.39Å; F51-I55 WeakPolarHBondContact O-CG1 3.43Å; F51-I55 PolarHBondContact O-N 3.03Å; A52-I55 PolarHBondContact O-N 3.41Å; I55-I58 PolarHBondContact O-N 3.26Å; I55-S59 VanDerWaalsContact O-CB 3.29Å; I55-S59 WeakPolarHBondContact O-CB 3.22Å; I55-S59 PolarHBondContact O-N 2.93Å; I55-S59 PolarHBondContact O-OG 2.93Å
56	A	94.2	Very high	87.5	Confident	49 Å²	49	94.5 Å²	94.5	41%	0.405	53%	0.528	S	S	.	.	H	α-helix	trans	-63.3	-43.8	178.5	0	0	0	0	0	112.1	A52 T53 V54 S59 L60	A52-A56 WeakPolarHBondContact O-CB 3.29Å; A52-A56 PolarHBondContact O-N 3.43Å; T53-A56 PolarHBondContact O-N 3Å; V54-A56 VanDerWaalsContact C-N 3.31Å; V54-A56 PolarHBondContact O-N 3.43Å; A56-S59 PolarHBondContact O-N 3Å; A56-L60 WeakPolarHBondContact O-CG 3.46Å; A56-L60 PolarHBondContact O-N 3.44Å
57	T	94	Very high	89.4	Confident	87 Å²	87	93.2 Å²	93.2	53%	0.534	52%	0.52	S	S	.	.	H	α-helix	trans	-67.3	-40.2	177.9	55.8	0	0	0	0	112.3	T53 V54 L60 F61	T53-T57 WeakPolarHBondContact O-CG2 3.42Å; T53-T57 PolarHBondContact O-N 3.49Å; T53-T57 PolarHBondContact O-OG1 2.92Å; V54-T57 PolarHBondContact O-N 2.85Å; V54-T57 PolarHBondContact O-OG1 2.94Å; T57-L60 PolarHBondContact O-N 3.45Å; T57-F61 WeakPolarHBondContact O-CB 3.47Å; T57-F61 PolarHBondContact O-N 2.91Å
58	I	96.2	Very high	91.1	Very high	87 Å²	87	89.5 Å²	89.5	45%	0.446	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-43.5	174.9	-68.8	168.8	0	0	0	110.6	V54 I55 L60 F61 I62	V54-I58 HydrophobicContact CG1-CD1 3.77Å; V54-I58 VanDerWaalsContact O-CG1 3.26Å; V54-I58 WeakPolarHBondContact O-CG1 3.29Å; V54-I58 PolarHBondContact O-N 3.2Å; I55-I58 PolarHBondContact O-N 3.26Å; I58-L60 PolarHBondContact O-N 2.9Å; I58-F61 PolarHBondContact O-N 3.45Å; I58-I62 HydrophobicContact CG2-CD1 3.59Å; I58-I62 HydrophobicContact CG2-CG1 4.23Å; I58-I62 VanDerWaalsContact O-CG1 3.29Å; I58-I62 WeakPolarHBondContact O-CG1 3.34Å; I58-I62 PolarHBondContact O-N 3.2Å
59	S	96.8	Very high	92.8	Very high	57 Å²	57	89.6 Å²	89.6	40%	0.399	50%	0.501	S	S	.	.	H	α-helix	trans	-62.2	-45	179.7	-62	0	0	0	0	111.4	I55 A56 F61 I62 C63	I55-S59 VanDerWaalsContact O-CB 3.29Å; I55-S59 WeakPolarHBondContact O-CB 3.22Å; I55-S59 PolarHBondContact O-N 2.93Å; I55-S59 PolarHBondContact O-OG 2.93Å; A56-S59 PolarHBondContact O-N 3Å; S59-F61 VanDerWaalsContact C-N 3.35Å; S59-F61 PolarHBondContact O-N 3.15Å; S59-I62 PolarHBondContact O-N 3.24Å; S59-C63 WeakPolarHBondContact O-CB 3.45Å; S59-C63 PolarHBondContact O-N 2.94Å; S59-C63 PolarHBondContact O-SG 3.22Å
60	L	97	Very high	94.1	Very high	118 Å²	118	90.9 Å²	90.9	62%	0.618	50%	0.504	S	S	*	.	H	α-helix	trans	-60.5	-43.9	173.5	-71.9	172.9	0	0	0	111.9	A56 T57 I58 C63 C64	A56-L60 WeakPolarHBondContact O-CG 3.46Å; A56-L60 PolarHBondContact O-N 3.44Å; T57-L60 PolarHBondContact O-N 3.45Å; I58-L60 PolarHBondContact O-N 2.9Å; L60-C63 PolarHBondContact O-N 2.91Å; L60-C64 WeakPolarHBondContact O-CB 3.26Å; L60-C64 PolarHBondContact O-N 3.3Å; L60-C64 PolarHBondContact O-SG 2.84Å
61	F	97.7	Very high	95	Very high	154 Å²	154	89.5 Å²	89.5	68%	0.675	50%	0.498	S	S	*	.	H	α-helix	trans	-63.2	-44	179.3	-169.1	-98.2	0	0	0	112.2	T57 I58 S59 C64 F65	T57-F61 WeakPolarHBondContact O-CB 3.47Å; T57-F61 PolarHBondContact O-N 2.91Å; I58-F61 PolarHBondContact O-N 3.45Å; S59-F61 VanDerWaalsContact C-N 3.35Å; S59-F61 PolarHBondContact O-N 3.15Å; F61-C64 PolarHBondContact O-N 2.91Å; F61-F65 WeakPolarHBondContact O-CB 3.35Å; F61-F65 PolarHBondContact O-N 2.73Å
62	I	97.9	Very high	95.4	Very high	93 Å²	93	87.3 Å²	87.3	48%	0.477	49%	0.49	S	S	.	.	H	α-helix	trans	-64.5	-46.2	176.3	-67.2	170.6	0	0	0	110.5	I58 S59 C64 F65 V66	I58-I62 HydrophobicContact CG2-CD1 3.59Å; I58-I62 HydrophobicContact CG2-CG1 4.23Å; I58-I62 VanDerWaalsContact O-CG1 3.29Å; I58-I62 WeakPolarHBondContact O-CG1 3.34Å; I58-I62 PolarHBondContact O-N 3.2Å; S59-I62 PolarHBondContact O-N 3.24Å; I62-C64 VanDerWaalsContact C-N 3.33Å; I62-C64 PolarHBondContact O-N 3.45Å; I62-F65 PolarHBondContact O-N 3.4Å; I62-V66 HydrophobicContact CG2-CG2 4.28Å; I62-V66 WeakPolarHBondContact O-CB 3.39Å; I62-V66 WeakPolarHBondContact O-CG2 3.43Å; I62-V66 PolarHBondContact O-N 3.36Å
63	C	97.9	Very high	95.8	Very high	89 Å²	89	90.8 Å²	90.8	60%	0.601	50%	0.496	S	S	*	.	H	α-helix	trans	-59.2	-43.5	176.5	-73.1	0	0	0	0	111.8	S59 L60 G67	S59-C63 WeakPolarHBondContact O-CB 3.45Å; S59-C63 PolarHBondContact O-N 2.94Å; S59-C63 PolarHBondContact O-SG 3.22Å; L60-C63 PolarHBondContact O-N 2.91Å; C63-G67 PolarHBondContact O-N 3.49Å
64	C	97.9	Very high	96.2	Very high	81 Å²	81	91.1 Å²	91.1	55%	0.547	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-45	175.1	-72.7	0	0	0	0	111.6	L60 F61 I62 G67 M68	L60-C64 WeakPolarHBondContact O-CB 3.26Å; L60-C64 PolarHBondContact O-N 3.3Å; L60-C64 PolarHBondContact O-SG 2.84Å; F61-C64 PolarHBondContact O-N 2.91Å; I62-C64 VanDerWaalsContact C-N 3.33Å; I62-C64 PolarHBondContact O-N 3.45Å; C64-G67 PolarHBondContact O-N 2.88Å; C64-M68 WeakPolarHBondContact O-CB 3.33Å; C64-M68 VanDerWaalsContact O-CG 3.22Å; C64-M68 WeakPolarHBondContact O-CG 3.32Å; C64-M68 PolarHBondContact O-N 3.48Å
65	F	98.1	Very high	96.4	Very high	117 Å²	117	93 Å²	93	51%	0.513	50%	0.502	S	S	.	.	H	α-helix	trans	-64.4	-46.3	-179.8	-172.7	-99	0	0	0	112	F61 I62 M68 M69	F61-F65 WeakPolarHBondContact O-CB 3.35Å; F61-F65 PolarHBondContact O-N 2.73Å; I62-F65 PolarHBondContact O-N 3.4Å; F65-M68 PolarHBondContact O-N 2.88Å; F65-M69 HydrophobicContact CD1-CG 4.01Å; F65-M69 HydrophobicContact CE1-CG 3.71Å; F65-M69 HydrophobicContact CE1-SD 4.21Å; F65-M69 HydrophobicContact CZ-CE 4.36Å; F65-M69 HydrophobicContact CZ-CG 4.03Å; F65-M69 HydrophobicContact CZ-SD 4.07Å; F65-M69 WeakPolarHBondContact O-CB 3.12Å; F65-M69 WeakPolarHBondContact O-CG 3.42Å; F65-M69 PolarHBondContact O-N 3.46Å
66	V	98.4	Very high	96.4	Very high	74 Å²	74	95.8 Å²	95.8	45%	0.448	51%	0.507	S	S	.	.	H	α-helix	trans	-63.8	-42.4	176.3	173.5	0	0	0	0	111	I62 M69 I70	I62-V66 HydrophobicContact CG2-CG2 4.28Å; I62-V66 WeakPolarHBondContact O-CB 3.39Å; I62-V66 WeakPolarHBondContact O-CG2 3.43Å; I62-V66 PolarHBondContact O-N 3.36Å; V66-M69 PolarHBondContact O-N 2.96Å; V66-I70 HydrophobicContact CG1-CD1 3.81Å; V66-I70 HydrophobicContact CG1-CG1 4.41Å; V66-I70 VanDerWaalsContact O-CG1 3.29Å; V66-I70 WeakPolarHBondContact O-CG1 3.45Å; V66-I70 PolarHBondContact O-N 3.34Å
67	G	98.1	Very high	96.5	Very high	29 Å²	29	97.9 Å²	97.9	30%	0.299	51%	0.511	S	S	.	.	H	α-helix	trans	-59.3	-47.7	175.2	0	0	0	0	0	112.3	C63 C64 M69 I70 I71	C63-G67 PolarHBondContact O-N 3.49Å; C64-G67 PolarHBondContact O-N 2.88Å; G67-M69 PolarHBondContact O-N 2.88Å; G67-I70 PolarHBondContact O-N 3.41Å; G67-I71 WeakPolarHBondContact O-CD1 3.17Å; G67-I71 VanDerWaalsContact O-CG1 3.23Å; G67-I71 WeakPolarHBondContact O-CG1 3.28Å; G67-I71 PolarHBondContact O-N 3.22Å
68	M	97.5	Very high	96.6	Very high	106 Å²	106	99.1 Å²	99.1	52%	0.522	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-42	175.9	-69.9	-61.1	-66.2	0	0	112.1	C64 F65 I71 Q72	C64-M68 WeakPolarHBondContact O-CB 3.33Å; C64-M68 VanDerWaalsContact O-CG 3.22Å; C64-M68 WeakPolarHBondContact O-CG 3.32Å; C64-M68 PolarHBondContact O-N 3.48Å; F65-M68 PolarHBondContact O-N 2.88Å; M68-I71 PolarHBondContact O-N 2.86Å; M68-Q72 WeakPolarHBondContact O-CB 3.44Å; M68-Q72 VanDerWaalsContact O-CG 3.28Å; M68-Q72 WeakPolarHBondContact O-CG 3.12Å; M68-Q72 PolarHBondContact O-N 3.43Å
69	M	97	Very high	96.6	Very high	84 Å²	84	99.4 Å²	99.4	41%	0.414	51%	0.509	S	S	.	.	H	α-helix	trans	-60.9	-44.4	176	-73.8	-73.5	97.8	0	0	112.2	F65 V66 G67 Q72 H73	F65-M69 HydrophobicContact CD1-CG 4.01Å; F65-M69 HydrophobicContact CE1-CG 3.71Å; F65-M69 HydrophobicContact CE1-SD 4.21Å; F65-M69 HydrophobicContact CZ-CE 4.36Å; F65-M69 HydrophobicContact CZ-CG 4.03Å; F65-M69 HydrophobicContact CZ-SD 4.07Å; F65-M69 WeakPolarHBondContact O-CB 3.12Å; F65-M69 WeakPolarHBondContact O-CG 3.42Å; F65-M69 PolarHBondContact O-N 3.46Å; V66-M69 PolarHBondContact O-N 2.96Å; G67-M69 PolarHBondContact O-N 2.88Å; M69-Q72 PolarHBondContact O-N 3.4Å; M69-H73 WeakPolarHBondContact O-CB 3.47Å; M69-H73 PolarHBondContact O-N 3.36Å
70	I	97.2	Very high	96.6	Very high	102 Å²	102	99.9 Å²	99.9	52%	0.523	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-48.1	176.6	-68.2	166.6	0	0	0	110.1	V66 G67 Q72 H73 T74	V66-I70 HydrophobicContact CG1-CD1 3.81Å; V66-I70 HydrophobicContact CG1-CG1 4.41Å; V66-I70 VanDerWaalsContact O-CG1 3.29Å; V66-I70 WeakPolarHBondContact O-CG1 3.45Å; V66-I70 PolarHBondContact O-N 3.34Å; G67-I70 PolarHBondContact O-N 3.41Å; I70-Q72 PolarHBondContact O-N 2.88Å; I70-H73 PolarHBondContact O-N 2.75Å; I70-T74 WeakPolarHBondContact O-CG2 3.26Å; I70-T74 PolarHBondContact O-N 3.23Å; I70-T74 PolarHBondContact O-OG1 3.22Å
71	I	96	Very high	96.6	Very high	94 Å²	94	97.9 Å²	97.9	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-59.3	-47.4	178.8	-67.9	164.3	0	0	0	110.6	G67 M68 H73 T74 E75	G67-I71 WeakPolarHBondContact O-CD1 3.17Å; G67-I71 VanDerWaalsContact O-CG1 3.23Å; G67-I71 WeakPolarHBondContact O-CG1 3.28Å; G67-I71 PolarHBondContact O-N 3.22Å; M68-I71 PolarHBondContact O-N 2.86Å; I71-H73 VanDerWaalsContact C-N 3.34Å; I71-H73 PolarHBondContact O-N 3.39Å; I71-T74 WeakPolarHBondContact CA-OG1 3.4Å; I71-T74 PolarHBondContact O-N 2.87Å; I71-T74 PolarHBondContact O-OG1 3.46Å; I71-E75 WeakPolarHBondContact O-CG 3.27Å; I71-E75 PolarHBondContact O-N 3.36Å
72	Q	94.5	Very high	96.6	Very high	107 Å²	107	94.6 Å²	94.6	50%	0.5	49%	0.486	S	S	.	.	H	α-helix	trans	-62.8	-40.1	178.8	-75	-177.4	-43.3	0	0	112.3	M68 M69 I70 E75 Y76	M68-Q72 WeakPolarHBondContact O-CB 3.44Å; M68-Q72 VanDerWaalsContact O-CG 3.28Å; M68-Q72 WeakPolarHBondContact O-CG 3.12Å; M68-Q72 PolarHBondContact O-N 3.43Å; M69-Q72 PolarHBondContact O-N 3.4Å; I70-Q72 PolarHBondContact O-N 2.88Å; Q72-E75 PolarHBondContact O-N 3Å; Q72-Y76 VanDerWaalsContact O-CB 3.28Å; Q72-Y76 WeakPolarHBondContact O-CB 3.31Å; Q72-Y76 PolarHBondContact O-N 2.89Å
73	H	95.1	Very high	96.6	Very high	132 Å²	132	93.5 Å²	93.5	61%	0.611	48%	0.482	S	S	*	.	H	α-helix	trans	-65.8	-38.4	176.5	-169	-65.5	0	0	0	111.9	M69 I70 I71 Y76 D77	M69-H73 WeakPolarHBondContact O-CB 3.47Å; M69-H73 PolarHBondContact O-N 3.36Å; I70-H73 PolarHBondContact O-N 2.75Å; I71-H73 VanDerWaalsContact C-N 3.34Å; I71-H73 PolarHBondContact O-N 3.39Å; H73-Y76 PolarHBondContact O-N 3.46Å; H73-D77 WeakPolarHBondContact O-CB 3.48Å; H73-D77 PolarHBondContact O-N 2.9Å
74	T	94.3	Very high	96.6	Very high	75 Å²	75	92.9 Å²	92.9	46%	0.46	47%	0.472	S	S	.	.	H	α-helix	trans	-67.2	-40	176.8	50.4	0	0	0	0	112.5	I70 I71 K78	I70-T74 WeakPolarHBondContact O-CG2 3.26Å; I70-T74 PolarHBondContact O-N 3.23Å; I70-T74 PolarHBondContact O-OG1 3.22Å; I71-T74 WeakPolarHBondContact CA-OG1 3.4Å; I71-T74 PolarHBondContact O-N 2.87Å; I71-T74 PolarHBondContact O-OG1 3.46Å; T74-K78 WeakPolarHBondContact O-CB 3.46Å; T74-K78 PolarHBondContact O-N 2.88Å; T74-K78 VanDerWaalsContact O-N 3.15Å
75	E	94.9	Very high	96.5	Very high	113 Å²	113	94.8 Å²	94.8	53%	0.528	47%	0.473	S	S	.	.	H	α-helix	trans	-69	-36.7	175.4	-65.5	-61.9	149.6	0	0	111.4	I71 Q72 K78 Q79	I71-E75 WeakPolarHBondContact O-CG 3.27Å; I71-E75 PolarHBondContact O-N 3.36Å; Q72-E75 PolarHBondContact O-N 3Å; E75-K78 PolarHBondContact O-N 3.49Å; E75-Q79 WeakPolarHBondContact O-CB 3.42Å; E75-Q79 PolarHBondContact O-N 3.42Å
76	Y	94.8	Very high	96.5	Very high	163 Å²	163	94.5 Å²	94.5	64%	0.639	47%	0.473	S	S	*	.	H	α-helix	trans	-63.2	-47.2	176.1	-179.6	-98.4	0	0	0	112.4	Q72 H73 K78 Q79 D80	Q72-Y76 VanDerWaalsContact O-CB 3.28Å; Q72-Y76 WeakPolarHBondContact O-CB 3.31Å; Q72-Y76 PolarHBondContact O-N 2.89Å; H73-Y76 PolarHBondContact O-N 3.46Å; Y76-K78 VanDerWaalsContact C-N 3.3Å; Y76-K78 PolarHBondContact O-N 2.92Å; Y76-Q79 PolarHBondContact O-N 3.04Å; Y76-D80 PolarHBondContact O-N 3.38Å
77	D	95.6	Very high	96.4	Very high	93 Å²	93	93.8 Å²	93.8	50%	0.497	47%	0.467	S	S	.	.	H	α-helix	trans	-63	-38.7	177.9	-172.3	52	0	0	0	112	H73 D80 T81	H73-D77 WeakPolarHBondContact O-CB 3.48Å; H73-D77 PolarHBondContact O-N 2.9Å; D77-D80 PolarHBondContact O-N 3.49Å; D77-T81 WeakPolarHBondContact O-CB 2.99Å; D77-T81 PolarHBondContact O-N 3.49Å; D77-T81 PolarHBondContact O-OG1 2.99Å
78	K	95.6	Very high	96.4	Very high	114 Å²	114	95.5 Å²	95.5	50%	0.496	47%	0.471	S	S	.	.	H	α-helix	trans	-62.8	-46.3	173.8	-173.4	-175.7	171.9	-163.7	0	111.5	T74 E75 Y76 T81 E82	T74-K78 WeakPolarHBondContact O-CB 3.46Å; T74-K78 PolarHBondContact O-N 2.88Å; T74-K78 VanDerWaalsContact O-N 3.15Å; E75-K78 PolarHBondContact O-N 3.49Å; Y76-K78 VanDerWaalsContact C-N 3.3Å; Y76-K78 PolarHBondContact O-N 2.92Å; K78-T81 PolarHBondContact O-N 3.47Å; K78-E82 WeakPolarHBondContact CE-OE1 3.31Å; K78-E82 WeakPolarHBondContact O-CG 3.24Å; K78-E82 PolarHBondContact O-N 3.31Å
79	Q	96.4	Very high	96.4	Very high	93 Å²	93	94.7 Å²	94.7	44%	0.435	47%	0.469	S	S	.	.	H	α-helix	trans	-63	-43.9	178.2	-173.9	65	48.3	0	0	111.7	E75 Y76 T81 E82 D83	E75-Q79 WeakPolarHBondContact O-CB 3.42Å; E75-Q79 PolarHBondContact O-N 3.42Å; Y76-Q79 PolarHBondContact O-N 3.04Å; Q79-T81 VanDerWaalsContact C-N 3.29Å; Q79-T81 PolarHBondContact O-N 3.02Å; Q79-E82 PolarHBondContact O-N 3.01Å; Q79-D83 PolarHBondContact NE2-OD1 3.37Å; Q79-D83 WeakPolarHBondContact O-CB 3.32Å; Q79-D83 VanDerWaalsContact O-CG 3.23Å; Q79-D83 PolarHBondContact O-N 3.16Å
80	D	96.8	Very high	96.4	Very high	67 Å²	67	96.3 Å²	96.3	36%	0.358	48%	0.477	S	S	.	.	H	α-helix	trans	-62.6	-37.8	177.6	-175	68.2	0	0	0	111.8	Y76 D77 D83 N84	Y76-D80 PolarHBondContact O-N 3.38Å; D77-D80 PolarHBondContact O-N 3.49Å; D80-D83 PolarHBondContact O-N 2.93Å; D80-N84 VanDerWaalsContact O-CB 3.24Å; D80-N84 WeakPolarHBondContact O-CB 3.26Å; D80-N84 VanDerWaalsContact O-CG 3.27Å; D80-N84 PolarHBondContact O-N 3.23Å; D80-N84 PolarHBondContact O-ND2 3.32Å; D80-N84 PolarHBondContact OD2-ND2 3.02Å
81	T	96.9	Very high	96.4	Very high	75 Å²	75	98.8 Å²	98.8	46%	0.46	48%	0.48	S	S	.	.	H	α-helix	trans	-63.8	-44.8	174.5	-57.5	0	0	0	0	111.5	D77 K78 Q79 N84 Q85	D77-T81 WeakPolarHBondContact O-CB 2.99Å; D77-T81 PolarHBondContact O-N 3.49Å; D77-T81 PolarHBondContact O-OG1 2.99Å; K78-T81 PolarHBondContact O-N 3.47Å; Q79-T81 VanDerWaalsContact C-N 3.29Å; Q79-T81 PolarHBondContact O-N 3.02Å; T81-N84 PolarHBondContact O-N 3.38Å; T81-Q85 WeakPolarHBondContact O-CB 3.12Å; T81-Q85 PolarHBondContact O-N 3.2Å
82	E	97.4	Very high	96.4	Very high	85 Å²	85	99.6 Å²	99.6	40%	0.397	49%	0.485	S	S	.	.	H	α-helix	trans	-63.2	-43.4	176.6	-71.2	177	178.1	0	0	111.5	K78 Q79 Q85 Q86	K78-E82 WeakPolarHBondContact CE-OE1 3.31Å; K78-E82 WeakPolarHBondContact O-CG 3.24Å; K78-E82 PolarHBondContact O-N 3.31Å; Q79-E82 PolarHBondContact O-N 3.01Å; E82-Q85 PolarHBondContact O-N 3.23Å; E82-Q86 VanDerWaalsContact O-CG 3.3Å; E82-Q86 WeakPolarHBondContact O-CG 2.99Å; E82-Q86 PolarHBondContact O-N 3.47Å
83	D	97.7	Very high	96.5	Very high	71 Å²	71	97.9 Å²	97.9	38%	0.38	49%	0.489	S	S	.	.	H	α-helix	trans	-65.8	-42	177.8	-69.1	-14.4	0	0	0	111.6	Q79 D80 Q86 L87	Q79-D83 PolarHBondContact NE2-OD1 3.37Å; Q79-D83 WeakPolarHBondContact O-CB 3.32Å; Q79-D83 VanDerWaalsContact O-CG 3.23Å; Q79-D83 PolarHBondContact O-N 3.16Å; D80-D83 PolarHBondContact O-N 2.93Å; D83-Q86 PolarHBondContact O-N 3.42Å; D83-L87 VanDerWaalsContact O-CB 3.31Å; D83-L87 WeakPolarHBondContact O-CB 3.49Å; D83-L87 PolarHBondContact O-N 3.1Å
84	N	97.5	Very high	96.5	Very high	75 Å²	75	96.7 Å²	96.7	40%	0.401	48%	0.484	S	S	.	.	H	α-helix	trans	-64.5	-40.5	175.3	-80.4	-45.8	0	0	0	111.7	D80 T81 L87 T88	D80-N84 VanDerWaalsContact O-CB 3.24Å; D80-N84 WeakPolarHBondContact O-CB 3.26Å; D80-N84 VanDerWaalsContact O-CG 3.27Å; D80-N84 PolarHBondContact O-N 3.23Å; D80-N84 PolarHBondContact O-ND2 3.32Å; D80-N84 PolarHBondContact OD2-ND2 3.02Å; T81-N84 PolarHBondContact O-N 3.38Å; N84-L87 PolarHBondContact O-N 3.14Å; N84-T88 WeakPolarHBondContact O-CG2 3.21Å; N84-T88 PolarHBondContact O-N 3Å; N84-T88 PolarHBondContact O-OG1 2.93Å
85	Q	96.9	Very high	96.6	Very high	121 Å²	121	96.2 Å²	96.2	57%	0.565	48%	0.483	S	S	*	.	H	α-helix	trans	-64.1	-46	176.2	-172.9	171.8	-35.2	0	0	111	T81 E82 L87 T88 D89	T81-Q85 WeakPolarHBondContact O-CB 3.12Å; T81-Q85 PolarHBondContact O-N 3.2Å; E82-Q85 PolarHBondContact O-N 3.23Å; Q85-L87 VanDerWaalsContact C-N 3.3Å; Q85-L87 PolarHBondContact O-N 3.28Å; Q85-T88 WeakPolarHBondContact CA-OG1 3.36Å; Q85-T88 PolarHBondContact O-N 2.92Å; Q85-T88 PolarHBondContact O-OG1 2.91Å; Q85-D89 PolarHBondContact O-N 2.92Å
86	Q	97.3	Very high	96.6	Very high	111 Å²	111	92.6 Å²	92.6	52%	0.519	48%	0.476	S	S	.	.	H	α-helix	trans	-59.3	-41.5	173.8	-72.1	176.6	10.6	0	0	111.9	E82 D83 T88 D89 M90	E82-Q86 VanDerWaalsContact O-CG 3.3Å; E82-Q86 WeakPolarHBondContact O-CG 2.99Å; E82-Q86 PolarHBondContact O-N 3.47Å; D83-Q86 PolarHBondContact O-N 3.42Å; Q86-T88 PolarHBondContact O-N 2.73Å; Q86-D89 PolarHBondContact O-N 2.82Å; Q86-M90 WeakPolarHBondContact O-CG 3.14Å; Q86-M90 PolarHBondContact O-N 3.06Å
87	L	97.2	Very high	96.5	Very high	60 Å²	60	91.7 Å²	91.7	31%	0.314	47%	0.473	S	S	.	.	H	α-helix	trans	-64.2	-38.9	177	-177.2	61.2	0	0	0	112.4	D83 N84 Q85 M90 R91	D83-L87 VanDerWaalsContact O-CB 3.31Å; D83-L87 WeakPolarHBondContact O-CB 3.49Å; D83-L87 PolarHBondContact O-N 3.1Å; N84-L87 PolarHBondContact O-N 3.14Å; Q85-L87 VanDerWaalsContact C-N 3.3Å; Q85-L87 PolarHBondContact O-N 3.28Å; L87-M90 HydrophobicContact CB-CE 4.45Å; L87-M90 HydrophobicContact CD1-CE 4.24Å; L87-R91 VanDerWaalsContact CD2-NH2 3.31Å; L87-R91 WeakPolarHBondContact O-CG 3.25Å; L87-R91 PolarHBondContact O-N 2.81Å; L87-R91 VanDerWaalsContact O-N 3.11Å
88	T	97.4	Very high	96.5	Very high	64 Å²	64	91.6 Å²	91.6	39%	0.393	47%	0.472	S	S	.	.	H	α-helix	trans	-65.7	-41	174.5	50.5	0	0	0	0	112.2	N84 Q85 Q86 M90 R91 L92	N84-T88 WeakPolarHBondContact O-CG2 3.21Å; N84-T88 PolarHBondContact O-N 3Å; N84-T88 PolarHBondContact O-OG1 2.93Å; Q85-T88 WeakPolarHBondContact CA-OG1 3.36Å; Q85-T88 PolarHBondContact O-N 2.92Å; Q85-T88 PolarHBondContact O-OG1 2.91Å; Q86-T88 PolarHBondContact O-N 2.73Å; T88-M90 VanDerWaalsContact C-N 3.35Å; T88-M90 PolarHBondContact O-N 3.36Å; T88-R91 PolarHBondContact O-N 2.99Å; T88-L92 WeakPolarHBondContact O-CG 3.28Å; T88-L92 PolarHBondContact O-N 3.37Å
89	D	97.5	Very high	96.4	Very high	89 Å²	89	91 Å²	91	48%	0.476	48%	0.482	S	S	.	.	H	α-helix	trans	-64.4	-40.6	178.1	-68.1	-24.4	0	0	0	111.5	Q85 Q86 R91 L92 A93	Q85-D89 PolarHBondContact O-N 2.92Å; Q86-D89 PolarHBondContact O-N 2.82Å; D89-R91 PolarHBondContact O-N 3.4Å; D89-L92 PolarHBondContact O-N 2.82Å; D89-A93 PolarHBondContact O-N 3.3Å
90	M	96.7	Very high	96.2	Very high	119 Å²	119	96.1 Å²	96.1	59%	0.586	50%	0.499	S	S	*	.	H	α-helix	trans	-62.2	-41.2	174.2	-72.8	-172.9	-75.7	0	0	112.5	Q86 L87 T88 A93 Q94	Q86-M90 WeakPolarHBondContact O-CG 3.14Å; Q86-M90 PolarHBondContact O-N 3.06Å; L87-M90 HydrophobicContact CB-CE 4.45Å; L87-M90 HydrophobicContact CD1-CE 4.24Å; T88-M90 VanDerWaalsContact C-N 3.35Å; T88-M90 PolarHBondContact O-N 3.36Å; M90-A93 PolarHBondContact O-N 2.89Å; M90-Q94 PolarHBondContact O-N 2.56Å; M90-Q94 VanDerWaalsContact O-N 3.09Å
91	R	97.6	Very high	95.5	Very high	153 Å²	153	99.2 Å²	99.2	58%	0.577	53%	0.526	S	S	*	.	H	α-helix	trans	-67.5	-39.3	177.1	-72.4	172.8	-178.1	151.9	-1	112.3	L87 T88 D89 Q94 S95	L87-R91 VanDerWaalsContact CD2-NH2 3.31Å; L87-R91 WeakPolarHBondContact O-CG 3.25Å; L87-R91 PolarHBondContact O-N 2.81Å; L87-R91 VanDerWaalsContact O-N 3.11Å; T88-R91 PolarHBondContact O-N 2.99Å; D89-R91 PolarHBondContact O-N 3.4Å; R91-Q94 PolarHBondContact O-N 3.13Å; R91-S95 PolarHBondContact O-N 3.5Å
92	L	96.2	Very high	95.4	Very high	112 Å²	112	100.4 Å²	100.4	59%	0.586	53%	0.529	S	S	*	.	H	α-helix	trans	-64.3	-44.1	176	-70.9	173.3	0	0	0	111.2	T88 D89 Q94 S95 G96	T88-L92 WeakPolarHBondContact O-CG 3.28Å; T88-L92 PolarHBondContact O-N 3.37Å; D89-L92 PolarHBondContact O-N 2.82Å; L92-Q94 VanDerWaalsContact C-N 3.29Å; L92-Q94 PolarHBondContact O-N 3.35Å; L92-S95 PolarHBondContact O-N 3.4Å; L92-S95 PolarHBondContact O-OG 3.38Å; L92-G96 PolarHBondContact O-N 2.03Å
93	A	96.2	Very high	95.3	Very high	71 Å²	71	101.2 Å²	101.2	59%	0.587	54%	0.536	S	S	*	.	H	α-helix	trans	-57.8	-42.4	174.6	0	0	0	0	0	112	D89 M90 G96 Y97	D89-A93 PolarHBondContact O-N 3.3Å; M90-A93 PolarHBondContact O-N 2.89Å; A93-G96 PolarHBondContact O-N 3.04Å; A93-Y97 PolarHBondContact O-N 3.15Å; A93-Y97 VanDerWaalsContact O-N 3.1Å
94	Q	96.1	Very high	95.2	Very high	107 Å²	107	102.9 Å²	102.9	50%	0.5	55%	0.545	S	S	.	.	H	α-helix	trans	-64.1	-45.2	176	-173.6	65.8	4.4	0	0	112.2	M90 R91 L92 G96 Y97 D98	M90-Q94 PolarHBondContact O-N 2.56Å; M90-Q94 VanDerWaalsContact O-N 3.09Å; R91-Q94 PolarHBondContact O-N 3.13Å; L92-Q94 VanDerWaalsContact C-N 3.29Å; L92-Q94 PolarHBondContact O-N 3.35Å; Q94-G96 VanDerWaalsContact C-N 3.28Å; Q94-G96 PolarHBondContact O-N 2.78Å; Q94-Y97 WeakPolarHBondContact O-CB 3.38Å; Q94-Y97 PolarHBondContact O-N 3.31Å; Q94-Y97 VanDerWaalsContact O-N 3.11Å; Q94-D98 PolarHBondContact O-N 2.79Å
95	S	96.1	Very high	95	Very high	65 Å²	65	104.5 Å²	104.5	46%	0.455	55%	0.553	S	S	.	*	H	α-helix	trans	-62.4	-35.2	178.1	70	0	0	0	0	113	R91 L92 S99	R91-S95 PolarHBondContact O-N 3.5Å; L92-S95 PolarHBondContact O-N 3.4Å; L92-S95 PolarHBondContact O-OG 3.38Å; S95-S99 PolarHBondContact O-N 2.05Å; S95-S99 VanDerWaalsContact O-N 3.14Å
96	G	94.1	Very high	94.9	Very high	37 Å²	37	103.5 Å²	103.5	38%	0.381	55%	0.552	S	S	.	*	H	α-helix	trans	-65.4	-40.6	173.6	0	0	0	0	0	112.1	L92 A93 Q94 S99 Y100	L92-G96 PolarHBondContact O-N 2.03Å; A93-G96 PolarHBondContact O-N 3.04Å; Q94-G96 VanDerWaalsContact C-N 3.28Å; Q94-G96 PolarHBondContact O-N 2.78Å; G96-S99 PolarHBondContact O-N 2.86Å; G96-S99 PolarHBondContact O-OG 3.1Å; G96-Y100 PolarHBondContact O-N 2.88Å
97	Y	93.7	Very high	94.8	Very high	143 Å²	143	103 Å²	103	56%	0.561	56%	0.555	S	S	*	*	H	α-helix	trans	-63.9	-44.9	175.2	179.8	-97.7	0	0	0	112.6	A93 Q94 S99 Y100 S101	A93-Y97 PolarHBondContact O-N 3.15Å; A93-Y97 VanDerWaalsContact O-N 3.1Å; Q94-Y97 WeakPolarHBondContact O-CB 3.38Å; Q94-Y97 PolarHBondContact O-N 3.31Å; Q94-Y97 VanDerWaalsContact O-N 3.11Å; Y97-S99 PolarHBondContact O-N 2.97Å; Y97-Y100 PolarHBondContact O-N 2.96Å; Y97-S101 PolarHBondContact O-N 3.5Å
98	D	95.6	Very high	94.6	Very high	92 Å²	92	106.1 Å²	106.1	49%	0.492	57%	0.572	S	S	.	*	H	α-helix	trans	-64.3	-30	178.8	-65.4	-26.7	0	0	0	112.2	Q94 Y100	Q94-D98 PolarHBondContact O-N 2.79Å; D98-Y100 VanDerWaalsContact C-N 3.3Å
99	S	93.6	Very high	94.4	Very high	101 Å²	101	109.3 Å²	109.3	71%	0.706	59%	0.586	S	S	*	*	H	α-helix	trans	-75	-16.2	174.7	72.6	0	0	0	0	114.5	S95 G96 Y97	S95-S99 PolarHBondContact O-N 2.05Å; S95-S99 VanDerWaalsContact O-N 3.14Å; G96-S99 PolarHBondContact O-N 2.86Å; G96-S99 PolarHBondContact O-OG 3.1Å; Y97-S99 PolarHBondContact O-N 2.97Å
100	Y	90.9	Very high	94.1	Very high	201 Å²	201	111 Å²	111	79%	0.788	60%	0.595	S	S	*	*	H	α-helix	trans	-93.7	-24.2	-179.3	-178.6	-98.2	0	0	0	113.4	G96 Y97 D98	G96-Y100 PolarHBondContact O-N 2.88Å; Y97-Y100 PolarHBondContact O-N 2.96Å; D98-Y100 VanDerWaalsContact C-N 3.3Å
101	S	82.5	Confident	93.9	Very high	131 Å²	131	110.3 Å²	110.3	92%	0.916	60%	0.595	S	S	*	*			trans	-81.2	0	177.9	-63.5	0	0	0	0	112.3	Y97	Y97-S101 PolarHBondContact O-N 3.5Å

Retrieved 101 of 101 residues in 52.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).