A0A077ZC01_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZC01, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 129 aa.

						>A0A077ZC01_TRITR|A0A077ZC01
MTEPPSEDAIGPASKRLGGRGRMNFGFYKEQPHFQVLDEWIPRSMLQKRPGARFIGARALGWPMVWRTIRPTKRELSPYAYSIYPDTFDDEDYVNGNSIRADAKRAGGRYIPWNSVLPWARGYHLAHDY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.6	Very low	46.5	Very low	244 Å²	244	137.6 Å²	137.6	100%	1.202	80%	0.798	S	S	*	*				0	108.2	0	-69.5	177.9	176	0	0	105.7
2	T	43.9	Very low	46.4	Very low	143 Å²	143	136.7 Å²	136.7	88%	0.877	80%	0.799	S	S	*	*			trans	-122.8	104.4	-174.5	-33.4	0	0	0	0	105.9
3	E	43.8	Very low	46.7	Very low	183 Å²	183	133.8 Å²	133.8	86%	0.855	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-65.6	137.3	-177.6	-68.9	177.1	160.7	0	0	110.2
4	P	50.1	Low	46.6	Very low	115 Å²	115	131.4 Å²	131.4	75%	0.747	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-69.2	146.2	176.7	28.4	-33	0	0	0	110.8	S6	P4-S6 PolarHBondContact O-N 3.44Å
5	P	50.4	Low	46.4	Very low	125 Å²	125	135.9 Å²	135.9	81%	0.812	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-63.6	125.4	-173.8	25.8	-33.6	0	0	0	111
6	S	47.1	Very low	46.1	Very low	84 Å²	84	141.7 Å²	141.7	59%	0.587	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-61	133.3	179.4	52.7	0	0	0	0	111.6	P4 D8 A9	P4-S6 PolarHBondContact O-N 3.44Å; S6-D8 PolarHBondContact O-N 3.31Å; S6-A9 PolarHBondContact O-N 2.67Å
7	E	54.1	Low	45.7	Very low	175 Å²	175	143.5 Å²	143.5	82%	0.818	81%	0.809	S	S	*	*	G	3₁₀ helix	trans	-63.4	-12.1	-178.1	-65.5	-179	151.8	0	0	113.2	A9 I10	E7-A9 PolarHBondContact O-N 3.39Å; E7-I10 PolarHBondContact O-N 2.96Å
8	D	49.3	Very low	45.1	Very low	153 Å²	153	140.4 Å²	140.4	82%	0.818	81%	0.814	S	S	*	*	G	3₁₀ helix	trans	-66.8	-12.7	176.4	-66.3	-30.7	0	0	0	114	S6 I10	S6-D8 PolarHBondContact O-N 3.31Å; D8-I10 PolarHBondContact O-N 3.27Å
9	A	49.4	Very low	44.4	Very low	91 Å²	91	136.3 Å²	136.3	75%	0.752	80%	0.804	S	S	*	*	G	3₁₀ helix	trans	-72	-15.9	174.4	0	0	0	0	0	113	S6 E7 G11	S6-A9 PolarHBondContact O-N 2.67Å; E7-A9 PolarHBondContact O-N 3.39Å; A9-G11 PolarHBondContact O-N 3.07Å
10	I	45.8	Very low	44.4	Very low	148 Å²	148	142.3 Å²	142.3	76%	0.759	81%	0.813	S	S	*	*	S	Bend	trans	-97.7	72	-178.9	-48.4	176.2	0	0	0	108.2	E7 D8	E7-I10 PolarHBondContact O-N 2.96Å; D8-I10 PolarHBondContact O-N 3.27Å
11	G	40.8	Very low	44	Very low	53 Å²	53	138.7 Å²	138.7	55%	0.546	81%	0.806	S	S	.	*			trans	-51.3	146.9	172.2	0	0	0	0	0	111.6	A9 A13	A9-G11 PolarHBondContact O-N 3.07Å; G11-A13 PolarHBondContact O-N 3.21Å
12	P	45.1	Very low	44.2	Very low	126 Å²	126	137.9 Å²	137.9	82%	0.818	79%	0.79	S	S	*	*			trans	-61.6	138.8	-169.4	22.9	-32.8	0	0	0	112.1	S14	P12-S14 PolarHBondContact O-N 3.4Å
13	A	50.9	Low	43.8	Very low	99 Å²	99	138.7 Å²	138.7	82%	0.818	79%	0.786	S	S	*	*			trans	-54.5	95	-175.8	0	0	0	0	0	111.7	G11 K15	G11-A13 PolarHBondContact O-N 3.21Å; A13-K15 PolarHBondContact O-N 3.46Å
14	S	45.3	Very low	43.5	Very low	100 Å²	100	137.1 Å²	137.1	70%	0.699	78%	0.783	S	S	*	*			trans	-62.1	107.2	173	62.8	0	0	0	0	108.9	P12 R16	P12-S14 PolarHBondContact O-N 3.4Å; S14-R16 VanDerWaalsContact C-N 3.3Å; S14-R16 PolarHBondContact O-N 3.45Å
15	K	43	Very low	43	Very low	200 Å²	200	138.7 Å²	138.7	87%	0.87	78%	0.778	S	S	*	*			trans	-62.5	87.2	173.7	-75.1	176	177.1	175.8	0	109.4	A13 L17	A13-K15 PolarHBondContact O-N 3.46Å; K15-L17 PolarHBondContact O-N 2.88Å
16	R	42.2	Very low	42.2	Very low	228 Å²	228	135.6 Å²	135.6	86%	0.86	77%	0.77	S	S	*	*			trans	-83.2	93.7	167.1	-75.9	-173.4	158.5	-154.4	-5	109.3	S14 G18	S14-R16 VanDerWaalsContact C-N 3.3Å; S14-R16 PolarHBondContact O-N 3.45Å; R16-G18 PolarHBondContact O-N 3.37Å
17	L	39.3	Very low	41.7	Very low	173 Å²	173	138.1 Å²	138.1	91%	0.906	77%	0.77	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.1	126.1	161.8	-121.9	83.2	0	0	0	108.7	K15	K15-L17 PolarHBondContact O-N 2.88Å
18	G	34	Very low	41	Very low	88 Å²	88	139.1 Å²	139.1	91%	0.907	77%	0.768	S	S	*	*	T	Hydrogen-bonded Turn	trans	102.2	13.7	158.1	0	0	0	0	0	119.2	R16	R16-G18 PolarHBondContact O-N 3.37Å
19	G	32.7	Very low	40.8	Very low	61 Å²	61	142.3 Å²	142.3	63%	0.629	77%	0.774	S	S	*	*	S	Bend	trans	-119.6	118.6	170.7	0	0	0	0	0	110.2	G21	G19-G21 VanDerWaalsContact C-N 3.3Å; G19-G21 WeakPolarHBondContact O-CA 3.48Å; G19-G21 PolarHBondContact O-N 2.98Å
20	R	43.7	Very low	40.4	Very low	257 Å²	257	146.4 Å²	146.4	97%	0.97	78%	0.778	S	S	*	*			trans	-38.3	91.3	177.8	-65.7	178	-171.2	-173.7	2.1	110.8	R22	R20-R22 PolarHBondContact O-N 2.81Å
21	G	35.6	Very low	40	Very low	66 Å²	66	144.6 Å²	144.6	68%	0.68	77%	0.766	S	S	*	*			trans	-67	108.2	-175.3	0	0	0	0	0	106.3	G19 M23	G19-G21 VanDerWaalsContact C-N 3.3Å; G19-G21 WeakPolarHBondContact O-CA 3.48Å; G19-G21 PolarHBondContact O-N 2.98Å; G21-M23 PolarHBondContact O-N 2.97Å
22	R	41.5	Very low	40	Very low	228 Å²	228	146.2 Å²	146.2	86%	0.86	77%	0.767	S	S	*	*			trans	-49	111.8	162.5	-67.7	-175.9	171.7	-142.9	-1.9	104.9	R20 N24	R20-R22 PolarHBondContact O-N 2.81Å; R22-N24 PolarHBondContact O-N 2.72Å
23	M	35.7	Very low	39.5	Very low	159 Å²	159	149.1 Å²	149.1	78%	0.783	77%	0.77	S	S	*	*			trans	-56.9	94.8	164.7	-81.7	170.3	149.8	0	0	104.5	G21 F25	G21-M23 PolarHBondContact O-N 2.97Å; M23-F25 HydrophobicContact CB-CD2 4.08Å; M23-F25 HydrophobicContact CB-CE2 3.96Å; M23-F25 PolarHBondContact O-N 2.86Å; M23-F25 HydrophobicContact SD-CE2 4.42Å
24	N	36.7	Very low	38.9	Very low	150 Å²	150	152 Å²	152	80%	0.802	76%	0.764	S	S	*	*			trans	-64.1	88.3	158.8	-76.3	-21.6	0	0	0	103	R22 G26	R22-N24 PolarHBondContact O-N 2.72Å; N24-G26 PolarHBondContact O-N 3.33Å
25	F	40.9	Very low	38.3	Very low	148 Å²	148	155 Å²	155	65%	0.649	77%	0.767	S	S	*	*			trans	-52.8	101.7	156	-79.7	-89.1	0	0	0	103.5	M23 F27	M23-F25 HydrophobicContact CB-CD2 4.08Å; M23-F25 HydrophobicContact CB-CE2 3.96Å; M23-F25 PolarHBondContact O-N 2.86Å; M23-F25 HydrophobicContact SD-CE2 4.42Å; F25-F27 HydrophobicContact CB-CD2 4.36Å; F25-F27 HydrophobicContact CB-CE2 4.26Å; F25-F27 WeakPolarHBondContact O-CD2 3.38Å; F25-F27 PolarHBondContact O-N 3.1Å
26	G	33.3	Very low	38.1	Very low	61 Å²	61	150.8 Å²	150.8	63%	0.629	76%	0.757	S	S	*	*			trans	-58.9	87.7	164.6	0	0	0	0	0	104.4	N24 Y28	N24-G26 PolarHBondContact O-N 3.33Å; G26-Y28 PolarHBondContact O-N 2.9Å
27	F	37.4	Very low	37.8	Very low	137 Å²	137	145.9 Å²	145.9	60%	0.601	75%	0.748	S	S	*	*			trans	-59.6	100.8	168	-84.3	-71.1	0	0	0	103.8	F25 K29 Q31	F25-F27 HydrophobicContact CB-CD2 4.36Å; F25-F27 HydrophobicContact CB-CE2 4.26Å; F25-F27 WeakPolarHBondContact O-CD2 3.38Å; F25-F27 PolarHBondContact O-N 3.1Å; F27-K29 PolarHBondContact O-N 2.96Å; F27-K29 VanDerWaalsContact O-N 3.12Å; F27-Q31 VanDerWaalsContact CD1-CD 3.49Å; F27-Q31 HydrophobicContact CD1-CG 4.42Å
28	Y	39.4	Very low	37.9	Very low	196 Å²	196	143.8 Å²	143.8	77%	0.769	74%	0.738	S	S	*	*			trans	-21.8	116.7	161.7	-60.3	-90.1	0	0	0	107.9	G26 E30 Q31	G26-Y28 PolarHBondContact O-N 2.9Å; Y28-E30 PolarHBondContact O-N 2.86Å; Y28-Q31 PolarHBondContact O-N 2.75Å
29	K	44.4	Very low	38.1	Very low	219 Å²	219	148.1 Å²	148.1	95%	0.952	73%	0.734	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.6	8.7	175.6	-78.6	-179.8	172.7	179.4	0	113.2	F27	F27-K29 PolarHBondContact O-N 2.96Å; F27-K29 VanDerWaalsContact O-N 3.12Å
30	E	40.9	Very low	38.3	Very low	177 Å²	177	154.1 Å²	154.1	83%	0.827	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.4	26.6	178.2	-60.6	-178	174.5	0	0	111.4	Y28 P32	Y28-E30 PolarHBondContact O-N 2.86Å; E30-P32 WeakPolarHBondContact O-CD 3.01Å
31	Q	37.7	Very low	38	Very low	110 Å²	110	147.5 Å²	147.5	51%	0.514	72%	0.72	S	S	.	*			trans	-60.3	121.6	160.3	-69	-163.9	-46.6	0	0	107.1	F27 Y28 H33	F27-Q31 VanDerWaalsContact CD1-CD 3.49Å; F27-Q31 HydrophobicContact CD1-CG 4.42Å; Y28-Q31 PolarHBondContact O-N 2.75Å; Q31-H33 PolarHBondContact O-N 2.88Å; Q31-H33 VanDerWaalsContact O-N 3.11Å
32	P	39.9	Very low	38.1	Very low	87 Å²	87	146.8 Å²	146.8	57%	0.565	70%	0.704	S	S	*	*			trans	-54.4	129.1	-179.4	22.6	-31.4	0	0	0	106.5	E30 F34	E30-P32 WeakPolarHBondContact O-CD 3.01Å; P32-F34 HydrophobicContact CG-CD2 4.43Å; P32-F34 HydrophobicContact CG-CE1 4.47Å; P32-F34 HydrophobicContact CG-CE2 3.81Å; P32-F34 HydrophobicContact CG-CZ 3.84Å; P32-F34 WeakPolarHBondContact O-CD2 3.25Å; P32-F34 PolarHBondContact O-N 2.73Å
33	H	36	Very low	38.5	Very low	188 Å²	188	147.9 Å²	147.9	87%	0.87	71%	0.708	S	S	*	*			trans	-53.3	91.2	165.8	-98.2	-105.5	0	0	0	106.1	Q31 Q35	Q31-H33 PolarHBondContact O-N 2.88Å; Q31-H33 VanDerWaalsContact O-N 3.11Å; H33-Q35 PolarHBondContact O-N 2.76Å
34	F	36.5	Very low	38.6	Very low	160 Å²	160	144.9 Å²	144.9	70%	0.702	70%	0.703	S	S	*	*			trans	-62.6	100	161.7	-67	-79.4	0	0	0	102.4	P32 V36	P32-F34 HydrophobicContact CG-CD2 4.43Å; P32-F34 HydrophobicContact CG-CE1 4.47Å; P32-F34 HydrophobicContact CG-CE2 3.81Å; P32-F34 HydrophobicContact CG-CZ 3.84Å; P32-F34 WeakPolarHBondContact O-CD2 3.25Å; P32-F34 PolarHBondContact O-N 2.73Å; F34-V36 PolarHBondContact O-N 2.67Å
35	Q	34.7	Very low	38.7	Very low	162 Å²	162	144.4 Å²	144.4	76%	0.757	70%	0.697	S	S	*	*			trans	-57.6	89.3	155.7	-73.6	179.5	3.4	0	0	103.5	H33 L37	H33-Q35 PolarHBondContact O-N 2.76Å; Q35-L37 PolarHBondContact O-N 2.88Å
36	V	37.5	Very low	38.7	Very low	111 Å²	111	144.8 Å²	144.8	67%	0.673	71%	0.705	S	S	*	*			trans	-54.7	101.4	156.7	176.8	0	0	0	0	101.3	F34 D38	F34-V36 PolarHBondContact O-N 2.67Å; V36-D38 PolarHBondContact O-N 2.91Å
37	L	37.2	Very low	39.2	Very low	126 Å²	126	151 Å²	151	66%	0.66	72%	0.718	S	S	*	*			trans	-59.2	87.6	176.1	-73.4	159.1	0	0	0	105	Q35 E39 W40	Q35-L37 PolarHBondContact O-N 2.88Å; L37-E39 PolarHBondContact O-N 2.83Å; L37-W40 PolarHBondContact O-N 2.98Å
38	D	39.9	Very low	39.5	Very low	129 Å²	129	153 Å²	153	69%	0.69	73%	0.726	S	S	*	*	G	3₁₀ helix	trans	-57.2	-10.9	173.2	-83	-23.5	0	0	0	110.6	V36 W40	V36-D38 PolarHBondContact O-N 2.91Å; D38-W40 VanDerWaalsContact C-N 3.32Å; D38-W40 PolarHBondContact O-N 3.22Å
39	E	39.5	Very low	39.6	Very low	178 Å²	178	154 Å²	154	83%	0.832	73%	0.729	S	S	*	*	G	3₁₀ helix	trans	-76.3	-2.1	177.9	-86.6	-172.9	154.2	0	0	116.3	L37	L37-E39 PolarHBondContact O-N 2.83Å
40	W	35.2	Very low	39.4	Very low	188 Å²	188	150 Å²	150	71%	0.712	73%	0.725	S	S	*	*	G	3₁₀ helix	trans	-136.1	43.5	173.6	-138.2	74.5	0	0	0	115.1	L37 D38 P42 W62	L37-W40 PolarHBondContact O-N 2.98Å; D38-W40 VanDerWaalsContact C-N 3.32Å; D38-W40 PolarHBondContact O-N 3.22Å; W40-P42 WeakPolarHBondContact O-CD 3.11Å; W40-W62 HydrophobicContact CE3-CH2 4.42Å; W40-W62 HydrophobicContact CZ3-CH2 4.34Å
41	I	39.1	Very low	39.3	Very low	117 Å²	117	145 Å²	145	60%	0.6	72%	0.722	S	S	*	*			trans	-81.5	102.6	150.9	-57.4	173.8	0	0	0	105.9	R43	I41-R43 PolarHBondContact O-N 2.89Å
42	P	36.7	Very low	39.4	Very low	51 Å²	51	143.5 Å²	143.5	33%	0.331	73%	0.728	S	S	.	*			trans	-58	116	171.9	23.5	-31.8	0	0	0	107.3	W40 S44 M45	W40-P42 WeakPolarHBondContact O-CD 3.11Å; P42-S44 PolarHBondContact O-N 2.99Å; P42-M45 PolarHBondContact O-N 3.18Å
43	R	48.9	Very low	39.5	Very low	251 Å²	251	150.2 Å²	150.2	95%	0.947	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.8	-8.3	176.6	-66.4	-179.7	179.4	-120.7	0.8	112.9	I41 M45	I41-R43 PolarHBondContact O-N 2.89Å; R43-M45 VanDerWaalsContact C-N 3.33Å
44	S	38.8	Very low	39.8	Very low	96 Å²	96	149.4 Å²	149.4	67%	0.671	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.8	7.2	172.1	61.1	0	0	0	0	114.8	P42 L46	P42-S44 PolarHBondContact O-N 2.99Å; S44-L46 PolarHBondContact O-N 3Å
45	M	38.6	Very low	39.9	Very low	141 Å²	141	150 Å²	150	70%	0.695	75%	0.745	S	S	*	*	S	Bend	trans	-70.8	79.7	167.2	-144.8	-176.2	-151.3	0	0	109	P42 R43 Q47	P42-M45 PolarHBondContact O-N 3.18Å; R43-M45 VanDerWaalsContact C-N 3.33Å; M45-Q47 PolarHBondContact O-N 2.99Å
46	L	40.4	Very low	40.1	Very low	155 Å²	155	145.6 Å²	145.6	81%	0.812	74%	0.743	S	S	*	*			trans	-10.8	107.1	169.5	-82.3	136.8	0	0	0	111.8	S44 K48	S44-L46 PolarHBondContact O-N 3Å; L46-K48 PolarHBondContact O-N 2.76Å
47	Q	45.1	Very low	40.2	Very low	191 Å²	191	143.4 Å²	143.4	89%	0.893	74%	0.736	S	S	*	*			trans	-37	104.6	165.2	-106.3	171.3	-8.7	0	0	108.8	M45 R49	M45-Q47 PolarHBondContact O-N 2.99Å; Q47-R49 PolarHBondContact O-N 2.89Å
48	K	43.3	Very low	40.2	Very low	180 Å²	180	148.2 Å²	148.2	78%	0.783	75%	0.746	S	S	*	*			trans	-58	111.9	-174.4	-66.9	174.7	178.7	175.8	0	108.2	L46 P50	L46-K48 PolarHBondContact O-N 2.76Å; K48-P50 WeakPolarHBondContact O-CD 3.42Å
49	R	41.4	Very low	40.5	Very low	217 Å²	217	146.7 Å²	146.7	82%	0.819	75%	0.751	S	S	*	*			trans	-70.5	121.3	167.3	-70.4	-174.3	179.4	-178.5	0.2	107.7	Q47 G51 A52	Q47-R49 PolarHBondContact O-N 2.89Å; R49-G51 PolarHBondContact O-N 3.01Å; R49-G51 VanDerWaalsContact O-N 3.15Å; R49-A52 PolarHBondContact O-N 2.84Å
50	P	40.5	Very low	40.5	Very low	135 Å²	135	145.7 Å²	145.7	88%	0.877	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	120	178.5	25.3	-32.8	0	0	0	108.7	K48	K48-P50 WeakPolarHBondContact O-CD 3.42Å
51	G	37.6	Very low	40.6	Very low	73 Å²	73	139.3 Å²	139.3	75%	0.753	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	119.2	-12.2	176.3	0	0	0	0	0	116.3	R49 R53	R49-G51 PolarHBondContact O-N 3.01Å; R49-G51 VanDerWaalsContact O-N 3.15Å; G51-R53 PolarHBondContact O-N 2.65Å
52	A	40.3	Very low	40.6	Very low	78 Å²	78	142.1 Å²	142.1	65%	0.645	75%	0.746	S	S	*	*			trans	-75.5	94.4	174.9	0	0	0	0	0	110.6	R49 F54	R49-A52 PolarHBondContact O-N 2.84Å; A52-F54 PolarHBondContact O-N 2.89Å
53	R	42.6	Very low	40.8	Very low	228 Å²	228	145 Å²	145	86%	0.86	77%	0.765	S	S	*	*			trans	-65.8	117.3	171	-64.3	172.2	77.7	168	2.6	107.8	G51 I55	G51-R53 PolarHBondContact O-N 2.65Å; R53-I55 PolarHBondContact O-N 2.67Å
54	F	42.5	Very low	40.4	Very low	171 Å²	171	140.4 Å²	140.4	75%	0.75	76%	0.756	S	S	*	*			trans	-57	91.4	179.7	-77.1	-85.2	0	0	0	111.7	A52 A57	A52-F54 PolarHBondContact O-N 2.89Å; F54-A57 HydrophobicContact CB-CB 4.43Å; F54-A57 HydrophobicContact CD1-CB 3.31Å; F54-A57 HydrophobicContact CE1-CB 3.83Å; F54-A57 HydrophobicContact CG-CB 4.23Å
55	I	38.9	Very low	40.3	Very low	172 Å²	172	140.6 Å²	140.6	88%	0.882	75%	0.753	S	S	*	*	S	Bend	trans	-89.8	101.7	160.6	-56.7	175.1	0	0	0	105.3	R53	R53-I55 PolarHBondContact O-N 2.67Å
56	G	37.9	Very low	40.5	Very low	70 Å²	70	144.5 Å²	144.5	72%	0.722	76%	0.76	S	S	*	*	S	Bend	trans	107.3	-2.1	166	0	0	0	0	0	117.6	R58	G56-R58 PolarHBondContact O-N 2.66Å
57	A	40.7	Very low	40.3	Very low	64 Å²	64	147.2 Å²	147.2	53%	0.529	76%	0.76	S	S	.	*			trans	-74.1	82.1	160.6	0	0	0	0	0	107.8	F54 A59	F54-A57 HydrophobicContact CB-CB 4.43Å; F54-A57 HydrophobicContact CD1-CB 3.31Å; F54-A57 HydrophobicContact CE1-CB 3.83Å; F54-A57 HydrophobicContact CG-CB 4.23Å; A57-A59 PolarHBondContact O-N 3.2Å; A57-A59 VanDerWaalsContact O-N 3.13Å
58	R	37.3	Very low	40.2	Very low	227 Å²	227	143.8 Å²	143.8	86%	0.857	75%	0.752	S	S	*	*			trans	-41.1	126	149.9	-76.6	179.3	172.7	179.6	-2.1	104.9	G56 L60	G56-R58 PolarHBondContact O-N 2.66Å; R58-L60 PolarHBondContact O-N 2.93Å
59	A	45.6	Very low	40.1	Very low	97 Å²	97	142 Å²	142	80%	0.802	75%	0.75	S	S	*	*			trans	-52.5	98.3	162.7	0	0	0	0	0	104.5	A57 G61	A57-A59 PolarHBondContact O-N 3.2Å; A57-A59 VanDerWaalsContact O-N 3.13Å; A59-G61 PolarHBondContact O-N 2.89Å
60	L	39.7	Very low	40.1	Very low	158 Å²	158	142 Å²	142	83%	0.827	75%	0.75	S	S	*	*			trans	-61.7	72	146.2	-71.7	166.1	0	0	0	101.8	R58 W62	R58-L60 PolarHBondContact O-N 2.93Å; L60-W62 VanDerWaalsContact O-CD1 3.26Å; L60-W62 PolarHBondContact O-N 3.41Å
61	G	37.4	Very low	40.1	Very low	54 Å²	54	139.1 Å²	139.1	56%	0.557	73%	0.731	S	S	*	*			trans	-56.6	103.8	169.1	0	0	0	0	0	100.3	A59 P63	A59-G61 PolarHBondContact O-N 2.89Å; G61-P63 VanDerWaalsContact O-CD 3.28Å; G61-P63 WeakPolarHBondContact O-CD 3.12Å
62	W	37.7	Very low	40.3	Very low	176 Å²	176	140 Å²	140	67%	0.667	72%	0.722	S	S	*	*			trans	-45.2	118.4	178	-76.8	51.9	0	0	0	103.7	W40 L60 M64	W40-W62 HydrophobicContact CE3-CH2 4.42Å; W40-W62 HydrophobicContact CZ3-CH2 4.34Å; L60-W62 VanDerWaalsContact O-CD1 3.26Å; L60-W62 PolarHBondContact O-N 3.41Å; W62-M64 PolarHBondContact O-N 3.46Å
63	P	41.6	Very low	40.5	Very low	112 Å²	112	145.6 Å²	145.6	73%	0.727	73%	0.732	S	S	*	*			trans	-62.7	97.1	166.1	27.5	-29.8	0	0	0	101.8	G61 V65	G61-P63 VanDerWaalsContact O-CD 3.28Å; G61-P63 WeakPolarHBondContact O-CD 3.12Å; P63-V65 HydrophobicContact CB-CG2 3.9Å; P63-V65 HydrophobicContact CG-CG2 4.38Å; P63-V65 PolarHBondContact O-N 2.7Å
64	M	41.4	Very low	40.6	Very low	153 Å²	153	146.2 Å²	146.2	75%	0.754	73%	0.734	S	S	*	*			trans	-60.4	75.6	154.2	-73.2	178.2	177.6	0	0	102.9	W62 W66	W62-M64 PolarHBondContact O-N 3.46Å; M64-W66 PolarHBondContact O-N 3.13Å
65	V	36.7	Very low	40.6	Very low	101 Å²	101	144.4 Å²	144.4	61%	0.612	73%	0.728	S	S	*	*			trans	-63.7	99.9	160.9	-177.4	0	0	0	0	99.9	P63 R67	P63-V65 HydrophobicContact CB-CG2 3.9Å; P63-V65 HydrophobicContact CG-CG2 4.38Å; P63-V65 PolarHBondContact O-N 2.7Å; V65-R67 HydrophobicContact CB-CG 4.49Å; V65-R67 HydrophobicContact CG1-CG 3.82Å; V65-R67 PolarHBondContact O-N 2.81Å
66	W	41.7	Very low	40.8	Very low	222 Å²	222	141.7 Å²	141.7	84%	0.841	72%	0.715	S	S	*	*			trans	-56.6	76.7	156.9	-58.9	88.2	0	0	0	104.7	M64 T68	M64-W66 PolarHBondContact O-N 3.13Å; W66-T68 PolarHBondContact O-N 2.65Å
67	R	37.1	Very low	40.7	Very low	212 Å²	212	141.3 Å²	141.3	80%	0.8	70%	0.701	S	S	*	*			trans	-62.1	104	164.1	-85.9	-170.1	172.7	-171.2	-1.4	101.1	V65 I69	V65-R67 HydrophobicContact CB-CG 4.49Å; V65-R67 HydrophobicContact CG1-CG 3.82Å; V65-R67 PolarHBondContact O-N 2.81Å; R67-I69 PolarHBondContact O-N 2.84Å
68	T	41.7	Very low	41.1	Very low	120 Å²	120	143.8 Å²	143.8	74%	0.736	71%	0.711	S	S	*	*			trans	-51.9	98.6	161.4	53.3	0	0	0	0	103.7	W66 R70	W66-T68 PolarHBondContact O-N 2.65Å; T68-R70 PolarHBondContact O-N 3.37Å
69	I	43.3	Very low	41.3	Very low	143 Å²	143	142 Å²	142	73%	0.733	71%	0.706	S	S	*	*			trans	-57.5	100.6	166.5	-65.1	169.4	0	0	0	100.9	R67 P71	R67-I69 PolarHBondContact O-N 2.84Å; I69-P71 WeakPolarHBondContact O-CD 3.5Å
70	R	39.7	Very low	40.9	Very low	215 Å²	215	140.2 Å²	140.2	81%	0.811	69%	0.692	S	S	*	*			trans	-56.6	113.3	171.8	-76.8	-173	179.5	-168.2	-0	102.7	T68 T72	T68-R70 PolarHBondContact O-N 3.37Å; R70-T72 PolarHBondContact O-N 3.45Å
71	P	41.2	Very low	40.7	Very low	75 Å²	75	141.8 Å²	141.8	49%	0.487	69%	0.688	S	S	.	*			trans	-57.3	116.6	179.3	22.1	-29.7	0	0	0	105	I69 K73	I69-P71 WeakPolarHBondContact O-CD 3.5Å; P71-K73 PolarHBondContact O-N 2.65Å
72	T	41.3	Very low	41	Very low	91 Å²	91	142.9 Å²	142.9	56%	0.558	69%	0.687	S	S	*	*			trans	-56.3	139.7	171.8	60	0	0	0	0	105.4	R70 R74 E75	R70-T72 PolarHBondContact O-N 3.45Å; T72-R74 PolarHBondContact O-N 3.11Å; T72-E75 PolarHBondContact O-N 2.83Å
73	K	45.6	Very low	41.1	Very low	197 Å²	197	142.2 Å²	142.2	86%	0.857	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.3	-14.6	-171.5	-72.5	-177.9	175.6	-176.8	0	114.9	P71	P71-K73 PolarHBondContact O-N 2.65Å
74	R	44.9	Very low	40.9	Very low	241 Å²	241	145.6 Å²	145.6	91%	0.909	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-19.5	174.7	-78.8	-176.3	161.5	175.8	-5.3	115.3	T72	T72-R74 PolarHBondContact O-N 3.11Å
75	E	41.8	Very low	40.9	Very low	133 Å²	133	142.9 Å²	142.9	62%	0.621	69%	0.688	S	S	*	*			trans	-104.5	4.5	-175.3	-68.9	-179.5	-168.8	0	0	114.2	T72 S77	T72-E75 PolarHBondContact O-N 2.83Å; E75-S77 PolarHBondContact O-N 2.69Å
76	L	42.7	Very low	41	Very low	115 Å²	115	143.9 Å²	143.9	60%	0.602	69%	0.69	S	S	*	*			trans	-71.6	73.1	167.3	-76.1	157.9	0	0	0	108.7
77	S	35.7	Very low	41.1	Very low	62 Å²	62	137.7 Å²	137.7	43%	0.434	68%	0.677	S	S	.	*			trans	-55.9	136.7	158.8	126.5	0	0	0	0	106.8	E75 Y79 A80	E75-S77 PolarHBondContact O-N 2.69Å; S77-Y79 PolarHBondContact O-N 2.71Å; S77-Y79 PolarHBondContact OG-N 2.8Å; S77-A80 WeakPolarHBondContact O-CB 3.47Å; S77-A80 PolarHBondContact O-N 2.94Å
78	P	49	Very low	41.2	Very low	115 Å²	115	136.7 Å²	136.7	75%	0.747	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.2	-11.5	178.1	-23.9	32.8	0	0	0	114.3
79	Y	41.6	Very low	41.2	Very low	190 Å²	190	137 Å²	137	75%	0.745	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.3	0.5	179.7	-54.2	-74	0	0	0	113.3	S77 Y81	S77-Y79 PolarHBondContact O-N 2.71Å; S77-Y79 PolarHBondContact OG-N 2.8Å; Y79-Y81 WeakPolarHBondContact O-CD2 3.28Å; Y79-Y81 PolarHBondContact O-N 3.27Å
80	A	38.5	Very low	41.2	Very low	60 Å²	60	135.5 Å²	135.5	50%	0.496	67%	0.669	S	S	.	*			trans	-75.3	69.8	170.8	0	0	0	0	0	109.1	S77 S82	S77-A80 WeakPolarHBondContact O-CB 3.47Å; S77-A80 PolarHBondContact O-N 2.94Å; A80-S82 PolarHBondContact O-N 2.72Å
81	Y	35.3	Very low	41.4	Very low	190 Å²	190	132.6 Å²	132.6	75%	0.745	67%	0.665	S	S	*	*			trans	-59.2	110.9	164	-70.7	-83.8	0	0	0	106.8	Y79 I83	Y79-Y81 WeakPolarHBondContact O-CD2 3.28Å; Y79-Y81 PolarHBondContact O-N 3.27Å; Y81-I83 VanDerWaalsContact C-N 3.31Å; Y81-I83 PolarHBondContact O-N 2.92Å
82	S	43.5	Very low	41.7	Very low	77 Å²	77	134.9 Å²	134.9	54%	0.538	67%	0.673	S	S	.	*			trans	-58	99.7	165.4	48.1	0	0	0	0	107.4	A80 Y84	A80-S82 PolarHBondContact O-N 2.72Å; S82-Y84 VanDerWaalsContact CB-CD2 3.46Å; S82-Y84 PolarHBondContact O-N 2.94Å; S82-Y84 VanDerWaalsContact OG-CD2 3.25Å; S82-Y84 WeakPolarHBondContact OG-CD2 3.41Å; S82-Y84 WeakPolarHBondContact OG-CE2 3.07Å
83	I	39.9	Very low	41.7	Very low	162 Å²	162	140.5 Å²	140.5	83%	0.831	69%	0.685	S	S	*	*			trans	-68.4	75.5	166.2	-50.6	169.8	0	0	0	105.3	Y81 P85	Y81-I83 VanDerWaalsContact C-N 3.31Å; Y81-I83 PolarHBondContact O-N 2.92Å; I83-P85 WeakPolarHBondContact O-CD 3.45Å
84	Y	36.2	Very low	41.6	Very low	184 Å²	184	136.8 Å²	136.8	72%	0.722	68%	0.679	S	S	*	*			trans	-66.6	123.7	164.2	-72.4	-72.5	0	0	0	105.3	S82 D86	S82-Y84 VanDerWaalsContact CB-CD2 3.46Å; S82-Y84 PolarHBondContact O-N 2.94Å; S82-Y84 VanDerWaalsContact OG-CD2 3.25Å; S82-Y84 WeakPolarHBondContact OG-CD2 3.41Å; S82-Y84 WeakPolarHBondContact OG-CE2 3.07Å; Y84-D86 PolarHBondContact O-N 2.84Å
85	P	41.7	Very low	41.2	Very low	96 Å²	96	130.9 Å²	130.9	62%	0.623	67%	0.666	S	S	*	*			trans	-57.4	118.5	163.9	26.4	-30.8	0	0	0	105.2	I83 T87	I83-P85 WeakPolarHBondContact O-CD 3.45Å; P85-T87 HydrophobicContact CB-CG2 4.22Å; P85-T87 PolarHBondContact O-N 3.06Å; P85-T87 PolarHBondContact O-OG1 2.76Å
86	D	38.9	Very low	41.1	Very low	122 Å²	122	128 Å²	128	65%	0.652	67%	0.671	S	S	*	*			trans	-66.8	76.1	-179.5	-161.5	0.4	0	0	0	108.3	Y84 F88	Y84-D86 PolarHBondContact O-N 2.84Å; D86-F88 VanDerWaalsContact C-N 3.28Å
87	T	43	Very low	41	Very low	92 Å²	92	129 Å²	129	56%	0.564	68%	0.677	S	S	*	*			trans	-94.2	13.2	-179.1	48.6	0	0	0	0	111.5	P85	P85-T87 HydrophobicContact CB-CG2 4.22Å; P85-T87 PolarHBondContact O-N 3.06Å; P85-T87 PolarHBondContact O-OG1 2.76Å
88	F	40.6	Very low	41.2	Very low	190 Å²	190	131 Å²	131	83%	0.833	69%	0.691	S	S	*	*	S	Bend	trans	-110	-9	179.6	-80.1	-75.9	0	0	0	114.2	D86	D86-F88 VanDerWaalsContact C-N 3.28Å
89	D	41.4	Very low	41	Very low	128 Å²	128	129.7 Å²	129.7	68%	0.684	68%	0.677	S	S	*	*			trans	-95.4	5.8	177.3	-107.4	15	0	0	0	114.7	E91	D89-E91 VanDerWaalsContact C-N 3.26Å; D89-E91 PolarHBondContact O-N 3.12Å
90	D	43.2	Very low	41	Very low	110 Å²	110	130.7 Å²	130.7	59%	0.588	68%	0.679	S	S	*	*			trans	-78.3	81.7	166.2	-76.7	-13.7	0	0	0	108.4	D92 Y93	D90-D92 PolarHBondContact O-N 2.85Å; D90-Y93 WeakPolarHBondContact O-CB 3.17Å; D90-Y93 PolarHBondContact O-N 3.18Å
91	E	44.1	Very low	41.2	Very low	154 Å²	154	131.9 Å²	131.9	72%	0.72	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-52	-18.6	167	-74.7	-156.3	156.4	0	0	112.3	D89 Y93 V94	D89-E91 VanDerWaalsContact C-N 3.26Å; D89-E91 PolarHBondContact O-N 3.12Å; E91-Y93 PolarHBondContact O-N 3.29Å; E91-V94 PolarHBondContact O-N 2.83Å
92	D	46.3	Very low	41.4	Very low	123 Å²	123	129.4 Å²	129.4	66%	0.658	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-62.9	-21.8	171.4	-77	-12.3	0	0	0	113.6	D90	D90-D92 PolarHBondContact O-N 2.85Å
93	Y	42.1	Very low	41.2	Very low	209 Å²	209	129.1 Å²	129.1	82%	0.82	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-76.3	-24.7	173.3	-136.2	-86.1	0	0	0	112.4	D90 E91	D90-Y93 WeakPolarHBondContact O-CB 3.17Å; D90-Y93 PolarHBondContact O-N 3.18Å; E91-Y93 PolarHBondContact O-N 3.29Å
94	V	42.6	Very low	41.3	Very low	119 Å²	119	127.1 Å²	127.1	72%	0.721	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-34	-177.7	-178.1	0	0	0	0	111.3	E91 G96	E91-V94 PolarHBondContact O-N 2.83Å; V94-G96 PolarHBondContact O-N 2.7Å
95	N	37.2	Very low	41.5	Very low	118 Å²	118	129.5 Å²	129.5	63%	0.631	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.2	20.2	-170.6	-81	-11	0	0	0	115.9	N97	N95-N97 PolarHBondContact O-N 3.05Å
96	G	40.1	Very low	41.2	Very low	71 Å²	71	129.2 Å²	129.2	73%	0.732	69%	0.69	S	S	*	*			trans	59	0.4	162.6	0	0	0	0	0	116.5	V94 S98	V94-G96 PolarHBondContact O-N 2.7Å; G96-S98 VanDerWaalsContact C-N 3.31Å; G96-S98 PolarHBondContact O-N 2.81Å
97	N	39.3	Very low	40.9	Very low	137 Å²	137	127.5 Å²	127.5	73%	0.733	70%	0.701	S	S	*	*			trans	-83.2	86.8	-178.4	-81.3	-18.5	0	0	0	106.8	N95 I99	N95-N97 PolarHBondContact O-N 3.05Å; N97-I99 PolarHBondContact O-N 3Å
98	S	41.1	Very low	40.4	Very low	105 Å²	105	125.9 Å²	125.9	73%	0.734	70%	0.703	S	S	*	*			trans	-27.2	103.5	168.4	57.4	0	0	0	0	110.5	G96 R100	G96-S98 VanDerWaalsContact C-N 3.31Å; G96-S98 PolarHBondContact O-N 2.81Å; S98-R100 PolarHBondContact O-N 2.82Å
99	I	44.1	Very low	40.4	Very low	86 Å²	86	125.9 Å²	125.9	44%	0.441	70%	0.697	S	S	.	*			trans	-51.2	106.8	172.4	-65.3	165.9	0	0	0	105.3	N97 A101 K104	N97-I99 PolarHBondContact O-N 3Å; I99-A101 PolarHBondContact O-N 3.49Å; I99-K104 HydrophobicContact CG2-CG 4.41Å
100	R	41.6	Very low	40.7	Very low	212 Å²	212	127.2 Å²	127.2	80%	0.8	69%	0.694	S	S	*	*			trans	-49.6	118.3	-179.2	-73.2	178.6	173	168.2	-2.2	106.2	S98 D102 A103	S98-R100 PolarHBondContact O-N 2.82Å; R100-D102 PolarHBondContact O-N 3.15Å; R100-A103 PolarHBondContact O-N 2.73Å
101	A	42.9	Very low	40.7	Very low	85 Å²	85	128.1 Å²	128.1	70%	0.702	70%	0.697	S	S	*	*	G	3₁₀ helix	trans	-54.4	-16.5	-170	0	0	0	0	0	113.4	I99 A103	I99-A101 PolarHBondContact O-N 3.49Å; A101-A103 VanDerWaalsContact C-N 3.35Å
102	D	40.2	Very low	40.6	Very low	137 Å²	137	124.9 Å²	124.9	73%	0.733	69%	0.69	S	S	*	*	G	3₁₀ helix	trans	-70.5	-26.1	176.4	-59.4	-36.3	0	0	0	113.7	R100 K104	R100-D102 PolarHBondContact O-N 3.15Å; D102-K104 VanDerWaalsContact C-N 3.34Å; D102-K104 PolarHBondContact O-N 2.8Å
103	A	39.6	Very low	40.4	Very low	72 Å²	72	127.5 Å²	127.5	60%	0.595	69%	0.69	S	S	*	*	G	3₁₀ helix	trans	-74.8	-20	-177	0	0	0	0	0	113.7	R100 A101 R105	R100-A103 PolarHBondContact O-N 2.73Å; A101-A103 VanDerWaalsContact C-N 3.35Å; A103-R105 VanDerWaalsContact C-N 3.34Å; A103-R105 PolarHBondContact O-N 2.9Å
104	K	40.5	Very low	40.2	Very low	120 Å²	120	121.8 Å²	121.8	52%	0.522	67%	0.674	S	S	.	*	G	3₁₀ helix	trans	-88.8	8.9	-179.5	-67.9	-164.3	178.1	-174.3	0	114.5	I99 D102	I99-K104 HydrophobicContact CG2-CG 4.41Å; D102-K104 VanDerWaalsContact C-N 3.34Å; D102-K104 PolarHBondContact O-N 2.8Å
105	R	40.5	Very low	40.3	Very low	234 Å²	234	120 Å²	120	88%	0.883	67%	0.667	S	S	*	*	G	3₁₀ helix	trans	-85	-5.2	175	-90.6	-175.1	175.6	-172.9	0.4	115.1	A103	A103-R105 VanDerWaalsContact C-N 3.34Å; A103-R105 PolarHBondContact O-N 2.9Å
106	A	36.1	Very low	40.7	Very low	89 Å²	89	118.3 Å²	118.3	74%	0.736	66%	0.661	S	S	*	*	S	Bend	trans	-96.9	114.6	174.4	0	0	0	0	0	111	G108	A106-G108 PolarHBondContact O-N 2.7Å
107	G	31.6	Very low	40.6	Very low	86 Å²	86	116.7 Å²	116.7	89%	0.887	64%	0.635	S	S	*	*	S	Bend	trans	89.5	4.1	151.8	0	0	0	0	0	118.3
108	G	33.7	Very low	40.9	Very low	59 Å²	59	115.5 Å²	115.5	61%	0.608	64%	0.635	S	S	*	*			trans	86.2	107.6	167	0	0	0	0	0	113.6	A106	A106-G108 PolarHBondContact O-N 2.7Å
109	R	40.7	Very low	41	Very low	189 Å²	189	118.5 Å²	118.5	71%	0.713	63%	0.63	S	S	*	*			trans	175.5	148.1	135.8	-94.4	162.4	159.7	-147.4	-1.1	109.8
110	Y	47.9	Very low	40.8	Very low	156 Å²	156	115.3 Å²	115.3	61%	0.612	62%	0.616	S	S	*	*			trans	81.3	77.9	167	-44.3	-67	0	0	0	116.5	P112	Y110-P112 WeakPolarHBondContact O-CD 3.5Å
111	I	43.1	Very low	40.7	Very low	130 Å²	130	114.1 Å²	114.1	67%	0.667	61%	0.612	S	S	*	*			trans	-69.8	117.9	147.3	-61.2	169.6	0	0	0	105.7	W113 S115 V116	I111-W113 PolarHBondContact O-N 3Å; I111-S115 WeakPolarHBondContact CG2-OG 3.47Å; I111-V116 HydrophobicContact CG2-CG2 4.04Å
112	P	41.7	Very low	40.4	Very low	86 Å²	86	112.4 Å²	112.4	56%	0.558	60%	0.603	S	S	*	*			trans	-60.3	125.7	175.1	23.7	-30.7	0	0	0	108.4	Y110 N114 S115	Y110-P112 WeakPolarHBondContact O-CD 3.5Å; P112-N114 PolarHBondContact O-N 3.26Å; P112-S115 PolarHBondContact O-N 3.45Å; P112-S115 PolarHBondContact O-OG 2.96Å
113	W	41.5	Very low	40.4	Very low	177 Å²	177	114.4 Å²	114.4	67%	0.67	60%	0.601	S	S	*	*	G	3₁₀ helix	trans	-52.4	-25.2	-176.3	-163.8	-96.5	0	0	0	112.8	I111 S115 V116 L117	I111-W113 PolarHBondContact O-N 3Å; W113-S115 PolarHBondContact O-N 2.84Å; W113-V116 PolarHBondContact O-N 3.3Å; W113-L117 HydrophobicContact CZ2-CD1 4.19Å
114	N	38.8	Very low	40.3	Very low	89 Å²	89	118.5 Å²	118.5	48%	0.476	61%	0.608	S	S	.	*	G	3₁₀ helix	trans	-59.2	-23.1	175.8	-48.8	8	0	0	0	113.5	P112	P112-N114 PolarHBondContact O-N 3.26Å
115	S	44.1	Very low	40.2	Very low	81 Å²	81	119.9 Å²	119.9	57%	0.566	62%	0.62	S	S	*	*	G	3₁₀ helix	trans	-85.8	-18.6	175	67.8	0	0	0	0	113.3	I111 P112 W113	I111-S115 WeakPolarHBondContact CG2-OG 3.47Å; P112-S115 PolarHBondContact O-N 3.45Å; P112-S115 PolarHBondContact O-OG 2.96Å; W113-S115 PolarHBondContact O-N 2.84Å
116	V	45.2	Very low	40.2	Very low	84 Å²	84	111.9 Å²	111.9	51%	0.509	60%	0.604	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87	-23.6	-176.4	-175.8	0	0	0	0	111.3	I111 W113	I111-V116 HydrophobicContact CG2-CG2 4.04Å; W113-V116 PolarHBondContact O-N 3.3Å
117	L	38.1	Very low	40.2	Very low	37 Å²	37	115.7 Å²	115.7	19%	0.194	61%	0.606	C	S	.	*			trans	-136.1	107.2	-172.2	-62.5	163.2	0	0	0	110.9	W113 W119 A120	W113-L117 HydrophobicContact CZ2-CD1 4.19Å; L117-W119 HydrophobicContact CB-CD2 4.14Å; L117-W119 HydrophobicContact CB-CG 4.41Å; L117-W119 HydrophobicContact CB-CZ2 4.19Å; L117-W119 HydrophobicContact CD1-CH2 3.85Å; L117-W119 HydrophobicContact CD1-CZ2 3.46Å; L117-W119 VanDerWaalsContact CD1-CZ2 3.46Å; L117-W119 HydrophobicContact CD2-CZ2 3.77Å; L117-W119 HydrophobicContact CG-CZ2 3.98Å; L117-W119 PolarHBondContact O-N 2.8Å; L117-W119 VanDerWaalsContact O-N 3.1Å; L117-A120 HydrophobicContact CB-CB 4.15Å; L117-A120 WeakPolarHBondContact O-CB 3.49Å; L117-A120 PolarHBondContact O-N 3.49Å
118	P	45.8	Very low	40.3	Very low	111 Å²	111	118.7 Å²	118.7	72%	0.721	60%	0.602	S	S	*	*	G	3₁₀ helix	trans	-54.9	-29.8	177.4	-24.7	32	0	0	0	113.5	A120 R121	P118-A120 VanDerWaalsContact C-N 3.34Å; P118-R121 PolarHBondContact O-N 3.21Å
119	W	42.7	Very low	40.4	Very low	168 Å²	168	129.9 Å²	129.9	64%	0.636	63%	0.628	S	S	*	*	G	3₁₀ helix	trans	-77	-15.3	178.7	52.5	-94.5	0	0	0	114.1	L117 R121 G122 Y123	L117-W119 HydrophobicContact CB-CD2 4.14Å; L117-W119 HydrophobicContact CB-CG 4.41Å; L117-W119 HydrophobicContact CB-CZ2 4.19Å; L117-W119 HydrophobicContact CD1-CH2 3.85Å; L117-W119 HydrophobicContact CD1-CZ2 3.46Å; L117-W119 VanDerWaalsContact CD1-CZ2 3.46Å; L117-W119 HydrophobicContact CD2-CZ2 3.77Å; L117-W119 HydrophobicContact CG-CZ2 3.98Å; L117-W119 PolarHBondContact O-N 2.8Å; L117-W119 VanDerWaalsContact O-N 3.1Å; W119-R121 VanDerWaalsContact C-N 3.26Å; W119-R121 PolarHBondContact O-N 3.37Å; W119-G122 PolarHBondContact O-N 3.18Å; W119-Y123 HydrophobicContact CE3-CE2 4.48Å
120	A	41.5	Very low	40.4	Very low	19 Å²	19	126.9 Å²	126.9	16%	0.157	62%	0.624	C	S	.	*	G	3₁₀ helix	trans	-72.8	-20	173.9	0	0	0	0	0	112.4	L117 P118 G122 Y123	L117-A120 HydrophobicContact CB-CB 4.15Å; L117-A120 WeakPolarHBondContact O-CB 3.49Å; L117-A120 PolarHBondContact O-N 3.49Å; P118-A120 VanDerWaalsContact C-N 3.34Å; A120-G122 PolarHBondContact O-N 3.27Å; A120-Y123 PolarHBondContact O-N 3.31Å
121	R	39.3	Very low	40	Very low	188 Å²	188	125.4 Å²	125.4	71%	0.709	62%	0.624	S	S	*	*	G	3₁₀ helix	trans	-63	-20.8	173.8	-72.2	-171.5	-177.7	-179.1	-0.2	113.3	P118 W119	P118-R121 PolarHBondContact O-N 3.21Å; W119-R121 VanDerWaalsContact C-N 3.26Å; W119-R121 PolarHBondContact O-N 3.37Å
122	G	36.5	Very low	39.9	Very low	49 Å²	49	125.1 Å²	125.1	51%	0.505	62%	0.622	S	S	.	*	G	3₁₀ helix	trans	-73.5	-25.5	-179.1	0	0	0	0	0	114.5	W119 A120 H124	W119-G122 PolarHBondContact O-N 3.18Å; A120-G122 PolarHBondContact O-N 3.27Å; G122-H124 VanDerWaalsContact C-N 3.34Å; G122-H124 PolarHBondContact O-N 3.07Å
123	Y	39.3	Very low	39.7	Very low	179 Å²	179	127.4 Å²	127.4	70%	0.702	63%	0.626	S	S	*	*	G	3₁₀ helix	trans	-80.8	-11.6	-173.5	-72.4	-79.1	0	0	0	114.3	W119 A120	W119-Y123 HydrophobicContact CE3-CE2 4.48Å; A120-Y123 PolarHBondContact O-N 3.31Å
124	H	38.2	Very low	39.6	Very low	157 Å²	157	124.3 Å²	124.3	73%	0.727	62%	0.623	S	S	*	*	G	3₁₀ helix	trans	-92.1	-11.7	178.3	-111	-75.4	0	0	0	114.3	G122	G122-H124 VanDerWaalsContact C-N 3.34Å; G122-H124 PolarHBondContact O-N 3.07Å
125	L	37.7	Very low	39.7	Very low	149 Å²	149	126.7 Å²	126.7	78%	0.78	63%	0.632	S	S	*	*	S	Bend	trans	-96.8	-3.9	-179.8	-94.2	139.6	0	0	0	113.6
126	A	40.1	Very low	39.4	Very low	67 Å²	67	129.9 Å²	129.9	55%	0.554	64%	0.637	S	S	*	*	S	Bend	trans	-91.9	-0.2	-174.8	0	0	0	0	0	114.6
127	H	35.9	Very low	38.9	Very low	169 Å²	169	133.5 Å²	133.5	78%	0.782	65%	0.647	S	S	*	*	S	Bend	trans	-118	10.9	-176	-89.2	-66	0	0	0	115.8
128	D	35.1	Very low	39	Very low	148 Å²	148	141.5 Å²	141.5	79%	0.791	69%	0.685	S	S	*	*			trans	-104.1	74.3	166.6	-67.4	-25.5	0	0	0	109.5
129	Y	36	Very low	38.4	Very low	294 Å²	294	144.3 Å²	144.3	100%	1.153	68%	0.682	S	S	*	*			trans	-129.5	0	157.8	-91.3	-78.6	0	0	0	107.3

Retrieved 129 of 129 residues in 60.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).