A0A077ZC11_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZC11, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 86 aa.

						>A0A077ZC11_TRITR|A0A077ZC11
MNQHCLETNRFYWRRSGLKRRTVRRRIIVFERIEYRYKSIVTDLPTKKRSRLQVVRRGDLCLRVTSIESNIDRLAQSHLGEPSSSR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.1	Low	76.6	Confident	118 Å²	118	89.5 Å²	89.5	58%	0.581	44%	0.441	S	S	*	.				0	128.4	0	-148.7	141.1	83.8	0	0	107.2	C5 F30 E34	M1-C5 HydrophobicContact CG-CB 4.41Å; M1-F30 HydrophobicContact CE-CZ 4.1Å; M1-E34 HydrophobicContact CE-CG 4.11Å
2	N	67.3	Low	77.6	Confident	130 Å²	130	95.5 Å²	95.5	70%	0.695	46%	0.458	S	S	*	.			trans	-76.8	144.3	-168.5	-67.7	-30	0	0	0	111.5	H4 C5	N2-H4 PolarHBondContact O-N 3.05Å; N2-C5 WeakPolarHBondContact O-CB 3.46Å; N2-C5 PolarHBondContact O-N 3.49Å
3	Q	73	Confident	78	Confident	121 Å²	121	92.3 Å²	92.3	57%	0.565	44%	0.438	S	S	*	.	H	α-helix	trans	-45	-40.1	176.8	-162.4	82.4	-5.6	0	0	112.2	C5 L6 E7	Q3-C5 VanDerWaalsContact C-N 3.3Å; Q3-C5 PolarHBondContact O-N 3.01Å; Q3-L6 WeakPolarHBondContact O-CB 3.48Å; Q3-L6 PolarHBondContact O-N 2.97Å; Q3-E7 PolarHBondContact O-N 3.13Å
4	H	78.9	Confident	78.5	Confident	141 Å²	141	99.2 Å²	99.2	65%	0.653	46%	0.458	S	S	*	.	H	α-helix	trans	-51.6	-43.8	175.8	-172.1	-103.4	0	0	0	113.1	N2 L6 E7 T8	N2-H4 PolarHBondContact O-N 3.05Å; H4-L6 VanDerWaalsContact C-N 3.34Å; H4-L6 PolarHBondContact O-N 3.41Å; H4-E7 PolarHBondContact O-N 2.97Å; H4-T8 PolarHBondContact O-N 3.34Å; H4-T8 PolarHBondContact O-OG1 3.45Å
5	C	74.5	Confident	79	Confident	50 Å²	50	105.5 Å²	105.5	34%	0.338	48%	0.476	S	S	.	.	H	α-helix	trans	-68.3	-31.4	-176.3	-159.5	0	0	0	0	113	M1 N2 Q3 N9	M1-C5 HydrophobicContact CG-CB 4.41Å; N2-C5 WeakPolarHBondContact O-CB 3.46Å; N2-C5 PolarHBondContact O-N 3.49Å; Q3-C5 VanDerWaalsContact C-N 3.3Å; Q3-C5 PolarHBondContact O-N 3.01Å; C5-N9 WeakPolarHBondContact O-CB 3.35Å; C5-N9 PolarHBondContact O-N 3.3Å; C5-N9 VanDerWaalsContact O-N 3.11Å; C5-N9 PolarHBondContact O-ND2 3Å
6	L	73.4	Confident	79.2	Confident	9 Å²	9	101.8 Å²	101.8	5%	0.047	47%	0.466	C	S	.	.	H	α-helix	trans	-67.7	-43.3	172.6	-70.1	160.4	0	0	0	111.2	Q3 H4 N9 R10 F30 E34	Q3-L6 WeakPolarHBondContact O-CB 3.48Å; Q3-L6 PolarHBondContact O-N 2.97Å; H4-L6 VanDerWaalsContact C-N 3.34Å; H4-L6 PolarHBondContact O-N 3.41Å; L6-N9 PolarHBondContact O-N 2.83Å; L6-R10 WeakPolarHBondContact O-CB 3.31Å; L6-R10 PolarHBondContact O-N 3.28Å; L6-F30 HydrophobicContact CB-CE1 4.48Å; L6-F30 HydrophobicContact CD2-CD1 3.62Å; L6-F30 HydrophobicContact CD2-CE1 3.29Å; L6-F30 HydrophobicContact CD2-CZ 4.44Å; L6-F30 HydrophobicContact CG-CE1 4.18Å; L6-E34 WeakPolarHBondContact CD1-OE1 3.46Å; L6-E34 WeakPolarHBondContact CD1-OE2 3.36Å; L6-E34 HydrophobicContact CD2-CB 4.16Å; L6-E34 VanDerWaalsContact CD2-CD 3.45Å; L6-E34 HydrophobicContact CD2-CG 3.81Å; L6-E34 HydrophobicContact CG-CG 4.47Å
7	E	81.9	Confident	79.5	Confident	108 Å²	108	100.5 Å²	100.5	51%	0.505	49%	0.487	S	S	.	.	H	α-helix	trans	-67.8	-43.6	-179	-70.5	176.2	178.5	0	0	110.9	Q3 H4 N9 R10 F11	Q3-E7 PolarHBondContact O-N 3.13Å; H4-E7 PolarHBondContact O-N 2.97Å; E7-N9 PolarHBondContact O-N 3.46Å; E7-R10 PolarHBondContact O-N 2.97Å; E7-F11 WeakPolarHBondContact O-CB 3.45Å; E7-F11 PolarHBondContact O-N 2.72Å
8	T	83.4	Confident	79.8	Confident	71 Å²	71	98.3 Å²	98.3	44%	0.436	48%	0.478	S	S	.	.	H	α-helix	trans	-60.1	-46.8	174.8	-36.3	0	0	0	0	111	H4 F11 Y12	H4-T8 PolarHBondContact O-N 3.34Å; H4-T8 PolarHBondContact O-OG1 3.45Å; T8-F11 PolarHBondContact O-N 2.99Å; T8-Y12 WeakPolarHBondContact O-CB 3.35Å; T8-Y12 PolarHBondContact O-N 3.07Å
9	N	81.6	Confident	80.2	Confident	47 Å²	47	102.3 Å²	102.3	25%	0.251	49%	0.492	S	S	.	.	H	α-helix	trans	-63.5	-45.9	178.1	-89.9	-69.8	0	0	0	111.9	C5 L6 E7 F11 Y12 W13 F30	C5-N9 WeakPolarHBondContact O-CB 3.35Å; C5-N9 PolarHBondContact O-N 3.3Å; C5-N9 VanDerWaalsContact O-N 3.11Å; C5-N9 PolarHBondContact O-ND2 3Å; L6-N9 PolarHBondContact O-N 2.83Å; E7-N9 PolarHBondContact O-N 3.46Å; N9-F11 VanDerWaalsContact C-N 3.29Å; N9-F11 PolarHBondContact O-N 3.48Å; N9-Y12 PolarHBondContact O-N 3.42Å; N9-W13 PolarHBondContact O-N 3.05Å; N9-F30 HydrophobicContact CB-CE1 4.17Å; N9-F30 HydrophobicContact CB-CZ 4.16Å
10	R	83.7	Confident	80.4	Confident	73 Å²	73	108.3 Å²	108.3	28%	0.275	51%	0.51	S	S	.	.	H	α-helix	trans	-57.2	-44.7	176.4	-97.2	-169.1	-84.4	-125.7	-2.9	111.9	L6 E7 R14 I27 E31	L6-R10 WeakPolarHBondContact O-CB 3.31Å; L6-R10 PolarHBondContact O-N 3.28Å; E7-R10 PolarHBondContact O-N 2.97Å; R10-R14 WeakPolarHBondContact O-CG 3.3Å; R10-R14 PolarHBondContact O-N 2.9Å; R10-I27 HydrophobicContact CG-CD1 4.15Å; R10-I27 HydrophobicContact CG-CG1 4.1Å; R10-I27 HydrophobicContact CG-CG2 4.26Å; R10-E31 IonicContact CZ-OE1 2.82Å; R10-E31 IonicContact NH1-OE1 2.86Å; R10-E31 PolarHBondContact NH1-OE1 3.11Å
11	F	86.2	Confident	80.7	Confident	116 Å²	116	113.2 Å²	113.2	51%	0.509	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-46.1	178.5	-173.1	-99	0	0	0	111.4	E7 T8 N9 W13 R14 R15	E7-F11 WeakPolarHBondContact O-CB 3.45Å; E7-F11 PolarHBondContact O-N 2.72Å; T8-F11 PolarHBondContact O-N 2.99Å; N9-F11 VanDerWaalsContact C-N 3.29Å; N9-F11 PolarHBondContact O-N 3.48Å; F11-W13 PolarHBondContact O-N 3.34Å; F11-R14 PolarHBondContact O-N 2.92Å; F11-R15 HydrophobicContact CE1-CG 4.48Å; F11-R15 VanDerWaalsContact CE1-NH1 3.32Å; F11-R15 VanDerWaalsContact CZ-CZ 3.5Å; F11-R15 VanDerWaalsContact CZ-NH1 3.29Å; F11-R15 PolarHBondContact O-N 3.38Å
12	Y	88.2	Confident	82.1	Confident	162 Å²	162	110.4 Å²	110.4	64%	0.635	51%	0.513	S	S	*	.	H	α-helix	trans	-58.7	-47.6	178.3	-155.8	-89.5	0	0	0	111.6	T8 N9 R14 R15 S16	T8-Y12 WeakPolarHBondContact O-CB 3.35Å; T8-Y12 PolarHBondContact O-N 3.07Å; N9-Y12 PolarHBondContact O-N 3.42Å; Y12-R14 VanDerWaalsContact C-N 3.32Å; Y12-R14 PolarHBondContact O-N 3.04Å; Y12-R15 PolarHBondContact O-N 3.43Å; Y12-R15 VanDerWaalsContact O-N 3.11Å; Y12-S16 WeakPolarHBondContact O-CB 3.17Å; Y12-S16 PolarHBondContact O-N 3.48Å
13	W	83.5	Confident	83	Confident	54 Å²	54	104.9 Å²	104.9	21%	0.205	48%	0.484	C	S	.	.	H	α-helix	trans	-64.5	-35.4	177.8	-66.8	120	0	0	0	112.8	N9 F11 R15 S16 L18 V23	N9-W13 PolarHBondContact O-N 3.05Å; F11-W13 PolarHBondContact O-N 3.34Å; W13-R15 VanDerWaalsContact C-N 3.32Å; W13-R15 PolarHBondContact O-N 3.32Å; W13-S16 PolarHBondContact O-OG 3.49Å; W13-L18 HydrophobicContact CE3-CD1 4.12Å; W13-L18 HydrophobicContact CZ3-CD1 4.16Å; W13-V23 HydrophobicContact CB-CG1 4.12Å; W13-V23 VanDerWaalsContact O-CG2 3.3Å; W13-V23 WeakPolarHBondContact O-CG2 3.32Å
14	R	84.4	Confident	83.7	Confident	189 Å²	189	108 Å²	108	71%	0.713	49%	0.491	S	S	*	.	H	α-helix	trans	-67.1	-31.7	174.4	-75	-174.2	-174.9	-160.4	5.3	112.9	R10 F11 Y12 V23	R10-R14 WeakPolarHBondContact O-CG 3.3Å; R10-R14 PolarHBondContact O-N 2.9Å; F11-R14 PolarHBondContact O-N 2.92Å; Y12-R14 VanDerWaalsContact C-N 3.32Å; Y12-R14 PolarHBondContact O-N 3.04Å; R14-V23 HydrophobicContact CG-CG1 4.25Å
15	R	85.8	Confident	84.2	Confident	194 Å²	194	110.3 Å²	110.3	73%	0.732	49%	0.494	S	S	*	.	H	α-helix	trans	-86.5	-18.1	179.4	-96.5	-168.4	169.9	158.4	1.2	115.3	F11 Y12 W13 G17	F11-R15 HydrophobicContact CE1-CG 4.48Å; F11-R15 VanDerWaalsContact CE1-NH1 3.32Å; F11-R15 VanDerWaalsContact CZ-CZ 3.5Å; F11-R15 VanDerWaalsContact CZ-NH1 3.29Å; F11-R15 PolarHBondContact O-N 3.38Å; Y12-R15 PolarHBondContact O-N 3.43Å; Y12-R15 VanDerWaalsContact O-N 3.11Å; W13-R15 VanDerWaalsContact C-N 3.32Å; W13-R15 PolarHBondContact O-N 3.32Å; R15-G17 PolarHBondContact O-N 3.42Å
16	S	82.1	Confident	85	Confident	46 Å²	46	113.1 Å²	113.1	32%	0.322	50%	0.497	S	S	.	.	S	Bend	trans	-67.3	10.7	-172.1	60.9	0	0	0	0	117.4	Y12 W13 L18	Y12-S16 WeakPolarHBondContact O-CB 3.17Å; Y12-S16 PolarHBondContact O-N 3.48Å; W13-S16 PolarHBondContact O-OG 3.49Å; S16-L18 PolarHBondContact O-N 3.2Å; S16-L18 WeakPolarHBondContact OG-CD1 3.35Å
17	G	84.8	Confident	85.6	Confident	79 Å²	79	113.9 Å²	113.9	81%	0.814	50%	0.501	S	S	*	.			trans	66.3	0.6	-179.8	0	0	0	0	0	115.4	R15	R15-G17 PolarHBondContact O-N 3.42Å
18	L	85.3	Confident	86	Confident	62 Å²	62	113.8 Å²	113.8	33%	0.325	50%	0.503	S	S	.	.			trans	-66.9	143.7	179.1	-88.4	136	0	0	0	111.7	W13 S16 R20 T22 V23	W13-L18 HydrophobicContact CE3-CD1 4.12Å; W13-L18 HydrophobicContact CZ3-CD1 4.16Å; S16-L18 PolarHBondContact O-N 3.2Å; S16-L18 WeakPolarHBondContact OG-CD1 3.35Å; L18-R20 PolarHBondContact O-N 2.91Å; L18-T22 HydrophobicContact CD2-CG2 3.47Å; L18-T22 VanDerWaalsContact CD2-CG2 3.47Å; L18-V23 HydrophobicContact CB-CG2 3.69Å
19	K	87.7	Confident	86.3	Confident	173 Å²	173	114.5 Å²	114.5	75%	0.752	51%	0.507	S	S	*	.			trans	-52.2	138.4	173.8	-67.9	-173.2	-179.8	-179.9	0	109.9	R21 T22 V23	K19-R21 PolarHBondContact O-N 3.44Å; K19-T22 WeakPolarHBondContact O-CA 3.49Å; K19-T22 WeakPolarHBondContact O-CB 3.38Å; K19-T22 PolarHBondContact O-N 3.04Å; K19-V23 PolarHBondContact O-N 3.06Å; K19-V23 VanDerWaalsContact O-N 3.13Å
20	R	83.2	Confident	86.6	Confident	222 Å²	222	114.6 Å²	114.6	84%	0.838	51%	0.505	S	S	*	.	H	α-helix	trans	-48.2	-38.5	-178.4	-80.6	-172.4	-178.2	163.4	0.7	113.5	L18 V23 R24	L18-R20 PolarHBondContact O-N 2.91Å; R20-V23 PolarHBondContact O-N 3.01Å; R20-R24 PolarHBondContact O-N 2.91Å
21	R	87.2	Confident	86.8	Confident	213 Å²	213	115.1 Å²	115.1	80%	0.804	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-43	177.3	-71	-175.1	-180	160.4	0.4	112	K19 R24 R25	K19-R21 PolarHBondContact O-N 3.44Å; R21-R24 PolarHBondContact O-N 3.25Å; R21-R25 WeakPolarHBondContact O-CG 3.41Å; R21-R25 PolarHBondContact O-N 3.11Å
22	T	87.2	Confident	87	Confident	58 Å²	58	117.7 Å²	117.7	36%	0.356	52%	0.517	S	S	.	.	H	α-helix	trans	-69.1	-41.6	179.4	-45.5	0	0	0	0	111.4	L18 K19 R25 R26	L18-T22 HydrophobicContact CD2-CG2 3.47Å; L18-T22 VanDerWaalsContact CD2-CG2 3.47Å; K19-T22 WeakPolarHBondContact O-CA 3.49Å; K19-T22 WeakPolarHBondContact O-CB 3.38Å; K19-T22 PolarHBondContact O-N 3.04Å; T22-R25 PolarHBondContact O-N 3.5Å; T22-R26 PolarHBondContact O-N 3.27Å
23	V	86.9	Confident	87	Confident	15 Å²	15	115 Å²	115	9%	0.091	51%	0.512	C	S	.	.	H	α-helix	trans	-60.1	-47.4	175.2	177.8	0	0	0	0	110.8	W13 R14 L18 K19 R20 R25 R26 I27	W13-V23 HydrophobicContact CB-CG1 4.12Å; W13-V23 VanDerWaalsContact O-CG2 3.3Å; W13-V23 WeakPolarHBondContact O-CG2 3.32Å; R14-V23 HydrophobicContact CG-CG1 4.25Å; L18-V23 HydrophobicContact CB-CG2 3.69Å; K19-V23 PolarHBondContact O-N 3.06Å; K19-V23 VanDerWaalsContact O-N 3.13Å; R20-V23 PolarHBondContact O-N 3.01Å; V23-R25 PolarHBondContact O-N 2.9Å; V23-R26 PolarHBondContact O-N 3.38Å; V23-I27 HydrophobicContact CG1-CD1 3.91Å; V23-I27 WeakPolarHBondContact O-CG1 3.32Å; V23-I27 PolarHBondContact O-N 3.18Å
24	R	88	Confident	87	Confident	186 Å²	186	113.1 Å²	113.1	70%	0.702	51%	0.506	S	S	*	.	H	α-helix	trans	-58.2	-47.8	176	-96.1	-175.8	172.3	148.7	-1.6	112.4	R20 R21 R26 I27 I28	R20-R24 PolarHBondContact O-N 2.91Å; R21-R24 PolarHBondContact O-N 3.25Å; R24-R26 VanDerWaalsContact C-N 3.32Å; R24-R26 PolarHBondContact O-N 2.6Å; R24-I27 PolarHBondContact O-N 3.11Å; R24-I28 WeakPolarHBondContact O-CG1 3.45Å; R24-I28 PolarHBondContact O-N 3.26Å; R24-I28 VanDerWaalsContact O-N 3.07Å
25	R	89.7	Confident	87	Confident	190 Å²	190	112.6 Å²	112.6	72%	0.717	51%	0.505	S	S	*	.	H	α-helix	trans	-58.9	-44.3	178.2	-76.8	-177.8	178.7	175.4	-1.1	111.6	R21 T22 V23 I28 V29	R21-R25 WeakPolarHBondContact O-CG 3.41Å; R21-R25 PolarHBondContact O-N 3.11Å; T22-R25 PolarHBondContact O-N 3.5Å; V23-R25 PolarHBondContact O-N 2.9Å; R25-I28 PolarHBondContact O-N 3.34Å; R25-V29 VanDerWaalsContact O-CG2 3.31Å; R25-V29 WeakPolarHBondContact O-CG2 3.39Å; R25-V29 PolarHBondContact O-N 2.89Å
26	R	90	Very high	87.1	Confident	108 Å²	108	111.1 Å²	111.1	41%	0.408	50%	0.5	S	S	.	.	H	α-helix	trans	-62.2	-44.4	177.6	-83.6	-175	146.7	153.3	-6.8	112.7	T22 V23 R24 I28 V29 F30	T22-R26 PolarHBondContact O-N 3.27Å; V23-R26 PolarHBondContact O-N 3.38Å; R24-R26 VanDerWaalsContact C-N 3.32Å; R24-R26 PolarHBondContact O-N 2.6Å; R26-I28 PolarHBondContact O-N 3.37Å; R26-V29 PolarHBondContact O-N 3.46Å; R26-F30 WeakPolarHBondContact O-CB 3.35Å; R26-F30 PolarHBondContact O-N 3.28Å
27	I	87.7	Confident	87.2	Confident	26 Å²	26	115.1 Å²	115.1	13%	0.133	51%	0.509	C	S	.	.	H	α-helix	trans	-59.8	-48.2	177.9	-67.8	170.6	0	0	0	110.5	R10 V23 R24 V29 F30 E31	R10-I27 HydrophobicContact CG-CD1 4.15Å; R10-I27 HydrophobicContact CG-CG1 4.1Å; R10-I27 HydrophobicContact CG-CG2 4.26Å; V23-I27 HydrophobicContact CG1-CD1 3.91Å; V23-I27 WeakPolarHBondContact O-CG1 3.32Å; V23-I27 PolarHBondContact O-N 3.18Å; R24-I27 PolarHBondContact O-N 3.11Å; I27-V29 PolarHBondContact O-N 3.48Å; I27-F30 PolarHBondContact O-N 2.92Å; I27-E31 HydrophobicContact CG2-CG 4.44Å; I27-E31 WeakPolarHBondContact O-CG 3.48Å; I27-E31 PolarHBondContact O-N 2.96Å
28	I	89.2	Confident	87.1	Confident	106 Å²	106	115.2 Å²	115.2	54%	0.544	49%	0.487	S	S	.	.	H	α-helix	trans	-60.9	-45.3	-179.4	-67.4	165.7	0	0	0	111.1	R24 R25 R26 F30 R32	R24-I28 WeakPolarHBondContact O-CG1 3.45Å; R24-I28 PolarHBondContact O-N 3.26Å; R24-I28 VanDerWaalsContact O-N 3.07Å; R25-I28 PolarHBondContact O-N 3.34Å; R26-I28 PolarHBondContact O-N 3.37Å; I28-F30 VanDerWaalsContact C-N 3.32Å; I28-F30 PolarHBondContact O-N 3.34Å; I28-R32 WeakPolarHBondContact O-CB 3.43Å; I28-R32 PolarHBondContact O-N 2.89Å
29	V	90.1	Very high	86.9	Confident	85 Å²	85	115.1 Å²	115.1	52%	0.515	49%	0.491	S	S	.	.	H	α-helix	trans	-62.8	-43	178	172.1	0	0	0	0	110.6	R25 R26 I27 R32 I33	R25-V29 VanDerWaalsContact O-CG2 3.31Å; R25-V29 WeakPolarHBondContact O-CG2 3.39Å; R25-V29 PolarHBondContact O-N 2.89Å; R26-V29 PolarHBondContact O-N 3.46Å; I27-V29 PolarHBondContact O-N 3.48Å; V29-R32 PolarHBondContact O-N 2.91Å; V29-I33 HydrophobicContact CG1-CD1 3.82Å; V29-I33 HydrophobicContact CG1-CG1 4.46Å; V29-I33 VanDerWaalsContact O-CG1 3.32Å; V29-I33 WeakPolarHBondContact O-CG1 3.33Å; V29-I33 PolarHBondContact O-N 2.83Å
30	F	88.5	Confident	86.5	Confident	50 Å²	50	111.7 Å²	111.7	22%	0.219	48%	0.48	C	S	.	.	H	α-helix	trans	-62.6	-49.2	179.8	-169	-101.6	0	0	0	112	M1 L6 N9 R26 I27 I28 R32 I33 E34	M1-F30 HydrophobicContact CE-CZ 4.1Å; L6-F30 HydrophobicContact CB-CE1 4.48Å; L6-F30 HydrophobicContact CD2-CD1 3.62Å; L6-F30 HydrophobicContact CD2-CE1 3.29Å; L6-F30 HydrophobicContact CD2-CZ 4.44Å; L6-F30 HydrophobicContact CG-CE1 4.18Å; N9-F30 HydrophobicContact CB-CE1 4.17Å; N9-F30 HydrophobicContact CB-CZ 4.16Å; R26-F30 WeakPolarHBondContact O-CB 3.35Å; R26-F30 PolarHBondContact O-N 3.28Å; I27-F30 PolarHBondContact O-N 2.92Å; I28-F30 VanDerWaalsContact C-N 3.32Å; I28-F30 PolarHBondContact O-N 3.34Å; F30-R32 VanDerWaalsContact C-N 3.28Å; F30-R32 PolarHBondContact O-N 3.42Å; F30-I33 PolarHBondContact O-N 3.29Å; F30-E34 WeakPolarHBondContact O-CB 3.13Å; F30-E34 PolarHBondContact O-N 2.87Å
31	E	87.9	Confident	86.3	Confident	83 Å²	83	104.5 Å²	104.5	39%	0.388	46%	0.461	S	S	.	.	H	α-helix	trans	-59.2	-39.7	176.5	-73.3	-178.9	147.1	0	0	112	R10 I27 E34 Y35	R10-E31 IonicContact CZ-OE1 2.82Å; R10-E31 IonicContact NH1-OE1 2.86Å; R10-E31 PolarHBondContact NH1-OE1 3.11Å; I27-E31 HydrophobicContact CG2-CG 4.44Å; I27-E31 WeakPolarHBondContact O-CG 3.48Å; I27-E31 PolarHBondContact O-N 2.96Å; E31-E34 PolarHBondContact O-N 2.95Å; E31-Y35 WeakPolarHBondContact O-CB 3.45Å; E31-Y35 PolarHBondContact O-N 3.48Å
32	R	88.9	Confident	85.9	Confident	171 Å²	171	98.7 Å²	98.7	65%	0.645	45%	0.449	S	S	*	.	H	α-helix	trans	-67.6	-40.1	179.9	-160.9	178.2	-178.1	-161.5	0.8	112.4	I28 V29 F30 E34 R36	I28-R32 WeakPolarHBondContact O-CB 3.43Å; I28-R32 PolarHBondContact O-N 2.89Å; V29-R32 PolarHBondContact O-N 2.91Å; F30-R32 VanDerWaalsContact C-N 3.28Å; F30-R32 PolarHBondContact O-N 3.42Å; R32-E34 VanDerWaalsContact C-N 3.32Å; R32-R36 PolarHBondContact O-N 3.47Å; R32-R36 VanDerWaalsContact O-N 3.11Å
33	I	88.1	Confident	85.3	Confident	105 Å²	105	100.1 Å²	100.1	54%	0.538	45%	0.454	S	S	.	.	H	α-helix	trans	-63.7	-43.2	173.5	-68.1	167.3	0	0	0	109.7	V29 F30 Y35 R36 Y37	V29-I33 HydrophobicContact CG1-CD1 3.82Å; V29-I33 HydrophobicContact CG1-CG1 4.46Å; V29-I33 VanDerWaalsContact O-CG1 3.32Å; V29-I33 WeakPolarHBondContact O-CG1 3.33Å; V29-I33 PolarHBondContact O-N 2.83Å; F30-I33 PolarHBondContact O-N 3.29Å; I33-Y35 PolarHBondContact O-N 3.3Å; I33-R36 PolarHBondContact O-N 2.93Å; I33-Y37 WeakPolarHBondContact O-CB 3.39Å; I33-Y37 PolarHBondContact O-N 2.8Å
34	E	83.4	Confident	84.6	Confident	15 Å²	15	104.6 Å²	104.6	7%	0.07	48%	0.477	C	S	.	.	H	α-helix	trans	-65.6	-41.9	-177.6	-148.3	-125.2	176.1	0	0	112	M1 L6 F30 E31 R32 Y37 K38	M1-E34 HydrophobicContact CE-CG 4.11Å; L6-E34 WeakPolarHBondContact CD1-OE1 3.46Å; L6-E34 WeakPolarHBondContact CD1-OE2 3.36Å; L6-E34 HydrophobicContact CD2-CB 4.16Å; L6-E34 VanDerWaalsContact CD2-CD 3.45Å; L6-E34 HydrophobicContact CD2-CG 3.81Å; L6-E34 HydrophobicContact CG-CG 4.47Å; F30-E34 WeakPolarHBondContact O-CB 3.13Å; F30-E34 PolarHBondContact O-N 2.87Å; E31-E34 PolarHBondContact O-N 2.95Å; R32-E34 VanDerWaalsContact C-N 3.32Å; E34-Y37 PolarHBondContact O-N 3.34Å; E34-K38 WeakPolarHBondContact O-CB 3.39Å; E34-K38 WeakPolarHBondContact O-CG 3.45Å; E34-K38 PolarHBondContact O-N 2.92Å; E34-K38 WeakPolarHBondContact OE1-CE 3.46Å; E34-K38 IonicContact OE1-NZ 2.6Å; E34-K38 PolarHBondContact OE1-NZ 2.86Å; E34-K38 IonicContact OE2-NZ 3.67Å; E34-K38 PolarHBondContact OE2-NZ 3.37Å
35	Y	86.1	Confident	83.6	Confident	177 Å²	177	98.7 Å²	98.7	69%	0.694	46%	0.463	S	S	*	.	H	α-helix	trans	-60.6	-45.5	173.4	-173.2	-92.2	0	0	0	111.7	E31 I33 K38 S39	E31-Y35 WeakPolarHBondContact O-CB 3.45Å; E31-Y35 PolarHBondContact O-N 3.48Å; I33-Y35 PolarHBondContact O-N 3.3Å; Y35-K38 PolarHBondContact O-N 3.35Å; Y35-S39 WeakPolarHBondContact O-CB 3.26Å; Y35-S39 PolarHBondContact O-N 3.18Å
36	R	86.9	Confident	82.5	Confident	164 Å²	164	93 Å²	93	62%	0.619	45%	0.449	S	S	*	.	H	α-helix	trans	-64.1	-42.1	176.6	-78.4	-158	173.7	-166.4	-1.4	112.5	R32 I33 S39 I40	R32-R36 PolarHBondContact O-N 3.47Å; R32-R36 VanDerWaalsContact O-N 3.11Å; I33-R36 PolarHBondContact O-N 2.93Å; R36-S39 PolarHBondContact O-N 3.03Å; R36-I40 VanDerWaalsContact O-CG1 3.26Å; R36-I40 WeakPolarHBondContact O-CG1 3.48Å; R36-I40 PolarHBondContact O-N 3.27Å
37	Y	84.8	Confident	81.2	Confident	130 Å²	130	95 Å²	95	51%	0.51	46%	0.461	S	S	.	.	H	α-helix	trans	-61.8	-45.9	177.4	-178.2	-93.9	0	0	0	111	I33 E34 S39 I40 V41	I33-Y37 WeakPolarHBondContact O-CB 3.39Å; I33-Y37 PolarHBondContact O-N 2.8Å; E34-Y37 PolarHBondContact O-N 3.34Å; Y37-S39 PolarHBondContact O-N 2.85Å; Y37-I40 PolarHBondContact O-N 2.91Å; Y37-V41 HydrophobicContact CD1-CG2 4.01Å; Y37-V41 HydrophobicContact CE1-CG2 3.58Å; Y37-V41 HydrophobicContact CE2-CG2 4.15Å; Y37-V41 HydrophobicContact CG-CG2 4.47Å; Y37-V41 WeakPolarHBondContact O-CB 3.49Å; Y37-V41 VanDerWaalsContact O-CG2 3.31Å; Y37-V41 WeakPolarHBondContact O-CG2 3.16Å; Y37-V41 PolarHBondContact O-N 3.4Å
38	K	81.8	Confident	80.1	Confident	81 Å²	81	101 Å²	101	35%	0.352	49%	0.486	S	S	.	.	H	α-helix	trans	-57.6	-48.7	174.6	-78.2	174	177.9	159.5	0	111.1	E34 Y35 I40 V41 T42	E34-K38 WeakPolarHBondContact O-CB 3.39Å; E34-K38 WeakPolarHBondContact O-CG 3.45Å; E34-K38 PolarHBondContact O-N 2.92Å; E34-K38 WeakPolarHBondContact OE1-CE 3.46Å; E34-K38 IonicContact OE1-NZ 2.6Å; E34-K38 PolarHBondContact OE1-NZ 2.86Å; E34-K38 IonicContact OE2-NZ 3.67Å; E34-K38 PolarHBondContact OE2-NZ 3.37Å; Y35-K38 PolarHBondContact O-N 3.35Å; K38-I40 PolarHBondContact O-N 3.05Å; K38-V41 PolarHBondContact O-N 2.82Å; K38-T42 WeakPolarHBondContact O-CG2 3.33Å; K38-T42 PolarHBondContact O-N 2.81Å; K38-T42 PolarHBondContact O-OG1 2.92Å
39	S	81.4	Confident	78.8	Confident	60 Å²	60	104.3 Å²	104.3	42%	0.42	49%	0.492	S	S	.	.	H	α-helix	trans	-56.4	-47.5	176.9	174.1	0	0	0	0	112	Y35 R36 Y37 V41 T42 D43	Y35-S39 WeakPolarHBondContact O-CB 3.26Å; Y35-S39 PolarHBondContact O-N 3.18Å; R36-S39 PolarHBondContact O-N 3.03Å; Y37-S39 PolarHBondContact O-N 2.85Å; S39-V41 PolarHBondContact O-N 2.89Å; S39-T42 WeakPolarHBondContact CA-OG1 3.4Å; S39-T42 PolarHBondContact O-N 3.19Å; S39-T42 PolarHBondContact O-OG1 3.26Å; S39-D43 WeakPolarHBondContact O-CB 3.31Å; S39-D43 PolarHBondContact O-N 2.76Å
40	I	79.2	Confident	77.7	Confident	100 Å²	100	103.1 Å²	103.1	51%	0.513	49%	0.487	S	S	.	.	H	α-helix	trans	-63.2	-44.1	178.6	-66.7	164.1	0	0	0	111.3	R36 Y37 K38 T42 D43 L44	R36-I40 VanDerWaalsContact O-CG1 3.26Å; R36-I40 WeakPolarHBondContact O-CG1 3.48Å; R36-I40 PolarHBondContact O-N 3.27Å; Y37-I40 PolarHBondContact O-N 2.91Å; K38-I40 PolarHBondContact O-N 3.05Å; I40-T42 VanDerWaalsContact C-N 3.34Å; I40-T42 PolarHBondContact O-N 3.37Å; I40-D43 PolarHBondContact O-N 3.43Å; I40-L44 HydrophobicContact CG2-CD1 3.98Å; I40-L44 PolarHBondContact O-N 3.49Å
41	V	79.7	Confident	76.7	Confident	72 Å²	72	110 Å²	110	44%	0.436	51%	0.512	S	S	.	.	H	α-helix	trans	-66.5	-37.1	179.7	171.9	0	0	0	0	111.4	Y37 K38 S39 P45	Y37-V41 HydrophobicContact CD1-CG2 4.01Å; Y37-V41 HydrophobicContact CE1-CG2 3.58Å; Y37-V41 HydrophobicContact CE2-CG2 4.15Å; Y37-V41 HydrophobicContact CG-CG2 4.47Å; Y37-V41 WeakPolarHBondContact O-CB 3.49Å; Y37-V41 VanDerWaalsContact O-CG2 3.31Å; Y37-V41 WeakPolarHBondContact O-CG2 3.16Å; Y37-V41 PolarHBondContact O-N 3.4Å; K38-V41 PolarHBondContact O-N 2.82Å; S39-V41 PolarHBondContact O-N 2.89Å; V41-P45 WeakPolarHBondContact O-CD 3.16Å
42	T	77.9	Confident	75.7	Confident	91 Å²	91	111.3 Å²	111.3	56%	0.558	52%	0.521	S	S	*	.	H	α-helix	trans	-74.3	-30.1	174.2	49.8	0	0	0	0	112.8	K38 S39 I40 P45 T46	K38-T42 WeakPolarHBondContact O-CG2 3.33Å; K38-T42 PolarHBondContact O-N 2.81Å; K38-T42 PolarHBondContact O-OG1 2.92Å; S39-T42 WeakPolarHBondContact CA-OG1 3.4Å; S39-T42 PolarHBondContact O-N 3.19Å; S39-T42 PolarHBondContact O-OG1 3.26Å; I40-T42 VanDerWaalsContact C-N 3.34Å; I40-T42 PolarHBondContact O-N 3.37Å; T42-P45 VanDerWaalsContact O-CD 3.3Å; T42-P45 WeakPolarHBondContact O-CD 3.47Å; T42-P45 WeakPolarHBondContact O-CG 3.3Å; T42-T46 PolarHBondContact O-OG1 3.24Å
43	D	75.5	Confident	74.8	Confident	88 Å²	88	109.6 Å²	109.6	47%	0.471	52%	0.52	S	S	.	.	H	α-helix	trans	-84.1	-24.7	-176.6	-159.1	46.3	0	0	0	112.9	S39 I40 T46 K47	S39-D43 WeakPolarHBondContact O-CB 3.31Å; S39-D43 PolarHBondContact O-N 2.76Å; I40-D43 PolarHBondContact O-N 3.43Å; D43-T46 VanDerWaalsContact C-OG1 3.25Å; D43-T46 WeakPolarHBondContact CA-OG1 3.26Å; D43-T46 PolarHBondContact O-N 3.27Å; D43-T46 PolarHBondContact O-OG1 2.92Å; D43-T46 PolarHBondContact OD1-OG1 2.93Å; D43-T46 VanDerWaalsContact OD1-OG1 3.05Å; D43-K47 VanDerWaalsContact O-CB 3.3Å; D43-K47 WeakPolarHBondContact O-CB 3.3Å; D43-K47 PolarHBondContact O-N 2.9Å
44	L	71.5	Confident	73.9	Confident	108 Å²	108	109.6 Å²	109.6	57%	0.565	53%	0.525	S	S	*	.	H	α-helix	trans	-55.3	-51.8	173.2	-119.9	76.7	0	0	0	113.6	I40 K48	I40-L44 HydrophobicContact CG2-CD1 3.98Å; I40-L44 PolarHBondContact O-N 3.49Å; L44-K48 PolarHBondContact O-N 3.22Å
45	P	66.7	Low	73.3	Confident	62 Å²	62	112.6 Å²	112.6	40%	0.403	54%	0.544	S	S	.	.	H	α-helix	trans	-71.4	-33.3	179.3	26.2	-33.2	0	0	0	112.7	V41 T42 K48 R49	V41-P45 WeakPolarHBondContact O-CD 3.16Å; T42-P45 VanDerWaalsContact O-CD 3.3Å; T42-P45 WeakPolarHBondContact O-CD 3.47Å; T42-P45 WeakPolarHBondContact O-CG 3.3Å; P45-K48 PolarHBondContact O-N 2.86Å; P45-R49 WeakPolarHBondContact O-CB 2.96Å; P45-R49 VanDerWaalsContact O-CG 3.26Å; P45-R49 WeakPolarHBondContact O-CG 3.27Å; P45-R49 PolarHBondContact O-N 3.44Å
46	T	66.2	Low	72.7	Confident	71 Å²	71	113.4 Å²	113.4	44%	0.436	55%	0.546	S	S	.	.	H	α-helix	trans	-65.2	-41	174.6	44.2	0	0	0	0	110.9	T42 D43 R49 S50	T42-T46 PolarHBondContact O-OG1 3.24Å; D43-T46 VanDerWaalsContact C-OG1 3.25Å; D43-T46 WeakPolarHBondContact CA-OG1 3.26Å; D43-T46 PolarHBondContact O-N 3.27Å; D43-T46 PolarHBondContact O-OG1 2.92Å; D43-T46 PolarHBondContact OD1-OG1 2.93Å; D43-T46 VanDerWaalsContact OD1-OG1 3.05Å; T46-R49 PolarHBondContact O-N 3.47Å; T46-S50 PolarHBondContact O-N 2.88Å
47	K	63.8	Low	72.3	Confident	149 Å²	149	115.2 Å²	115.2	65%	0.648	55%	0.553	S	S	*	*	H	α-helix	trans	-66.3	-42.3	176.3	-151	171.4	-173.5	177.1	0	112.1	D43 R49 S50 R51	D43-K47 VanDerWaalsContact O-CB 3.3Å; D43-K47 WeakPolarHBondContact O-CB 3.3Å; D43-K47 PolarHBondContact O-N 2.9Å; K47-R49 PolarHBondContact O-N 3.19Å; K47-S50 PolarHBondContact O-N 3.34Å; K47-S50 PolarHBondContact O-OG 2.87Å; K47-R51 PolarHBondContact O-N 3.45Å
48	K	65.6	Low	72.1	Confident	154 Å²	154	110.7 Å²	110.7	67%	0.67	55%	0.546	S	S	*	.	H	α-helix	trans	-62.3	-39.3	172.3	-83.3	-171.1	174.6	-176.8	0	112.6	L44 P45 R51 L52	L44-K48 PolarHBondContact O-N 3.22Å; P45-K48 PolarHBondContact O-N 2.86Å; K48-R51 PolarHBondContact O-N 3.07Å; K48-L52 PolarHBondContact O-N 3.2Å; K48-L52 VanDerWaalsContact O-N 3.07Å
49	R	61.2	Low	72	Confident	175 Å²	175	111.2 Å²	111.2	66%	0.66	55%	0.553	S	S	*	*	H	α-helix	trans	-66.3	-40.3	175.5	-77.5	177.1	177.6	179.4	0	112.3	P45 T46 K47 R51 L52 Q53	P45-R49 WeakPolarHBondContact O-CB 2.96Å; P45-R49 VanDerWaalsContact O-CG 3.26Å; P45-R49 WeakPolarHBondContact O-CG 3.27Å; P45-R49 PolarHBondContact O-N 3.44Å; T46-R49 PolarHBondContact O-N 3.47Å; K47-R49 PolarHBondContact O-N 3.19Å; R49-R51 VanDerWaalsContact C-N 3.33Å; R49-R51 PolarHBondContact O-N 2.91Å; R49-L52 PolarHBondContact O-N 2.77Å; R49-Q53 WeakPolarHBondContact O-CG 3.25Å; R49-Q53 PolarHBondContact O-N 3.46Å
50	S	67.6	Low	72	Confident	60 Å²	60	113.5 Å²	113.5	42%	0.42	56%	0.559	S	S	.	*	H	α-helix	trans	-60.3	-43.6	176.2	77.4	0	0	0	0	111.7	T46 K47 Q53 V54	T46-S50 PolarHBondContact O-N 2.88Å; K47-S50 PolarHBondContact O-N 3.34Å; K47-S50 PolarHBondContact O-OG 2.87Å; S50-Q53 PolarHBondContact O-N 3.28Å; S50-V54 VanDerWaalsContact O-CG2 3.27Å; S50-V54 WeakPolarHBondContact O-CG2 3.41Å; S50-V54 PolarHBondContact O-N 3.49Å
51	R	66.7	Low	72.1	Confident	193 Å²	193	112.5 Å²	112.5	73%	0.728	56%	0.561	S	S	*	*	H	α-helix	trans	-65.3	-41.9	177.5	-175.1	175.4	161.8	-154.8	-5.6	111.8	K47 K48 R49 Q53 V54 V55	K47-R51 PolarHBondContact O-N 3.45Å; K48-R51 PolarHBondContact O-N 3.07Å; R49-R51 VanDerWaalsContact C-N 3.33Å; R49-R51 PolarHBondContact O-N 2.91Å; R51-Q53 VanDerWaalsContact C-N 3.33Å; R51-Q53 PolarHBondContact O-N 2.94Å; R51-V54 PolarHBondContact O-N 2.92Å; R51-V55 WeakPolarHBondContact O-CG2 3.41Å; R51-V55 PolarHBondContact O-N 3.29Å
52	L	66	Low	72.1	Confident	111 Å²	111	114.7 Å²	114.7	58%	0.581	57%	0.569	S	S	*	*	H	α-helix	trans	-63.1	-38.6	173.8	-82.9	165.4	0	0	0	112.1	K48 R49 V55 R56	K48-L52 PolarHBondContact O-N 3.2Å; K48-L52 VanDerWaalsContact O-N 3.07Å; R49-L52 PolarHBondContact O-N 2.77Å; L52-V55 PolarHBondContact O-N 3.28Å; L52-R56 WeakPolarHBondContact O-CB 3.34Å; L52-R56 VanDerWaalsContact O-CG 3.25Å; L52-R56 WeakPolarHBondContact O-CG 3.44Å; L52-R56 PolarHBondContact O-N 3.32Å
53	Q	70.8	Confident	72.4	Confident	136 Å²	136	118.7 Å²	118.7	64%	0.636	57%	0.574	S	S	*	*	H	α-helix	trans	-65.6	-40.8	175.1	-74.5	-176.4	10.7	0	0	112.1	R49 S50 R51 R56 R57	R49-Q53 WeakPolarHBondContact O-CG 3.25Å; R49-Q53 PolarHBondContact O-N 3.46Å; S50-Q53 PolarHBondContact O-N 3.28Å; R51-Q53 VanDerWaalsContact C-N 3.33Å; R51-Q53 PolarHBondContact O-N 2.94Å; Q53-R56 PolarHBondContact O-N 3.49Å; Q53-R57 WeakPolarHBondContact O-CB 3.33Å; Q53-R57 PolarHBondContact O-N 2.89Å
54	V	70	Confident	72.7	Confident	105 Å²	105	117.6 Å²	117.6	64%	0.636	57%	0.57	S	S	*	*	H	α-helix	trans	-62.8	-46.3	175	176.9	0	0	0	0	111	S50 R51 R57 G58	S50-V54 VanDerWaalsContact O-CG2 3.27Å; S50-V54 WeakPolarHBondContact O-CG2 3.41Å; S50-V54 PolarHBondContact O-N 3.49Å; R51-V54 PolarHBondContact O-N 2.92Å; V54-R57 PolarHBondContact O-N 3.47Å; V54-G58 PolarHBondContact O-N 3.07Å
55	V	69.9	Low	73.3	Confident	77 Å²	77	115.6 Å²	115.6	47%	0.467	56%	0.563	S	S	.	*	H	α-helix	trans	-61.6	-46.4	177.4	172.8	0	0	0	0	111	R51 L52 R57 G58 D59	R51-V55 WeakPolarHBondContact O-CG2 3.41Å; R51-V55 PolarHBondContact O-N 3.29Å; L52-V55 PolarHBondContact O-N 3.28Å; V55-R57 VanDerWaalsContact C-N 3.3Å; V55-R57 PolarHBondContact O-N 2.95Å; V55-G58 PolarHBondContact O-N 3.22Å; V55-D59 PolarHBondContact O-N 2.95Å
56	R	73.8	Confident	74	Confident	194 Å²	194	116.2 Å²	116.2	73%	0.732	57%	0.569	S	S	*	*	H	α-helix	trans	-63.7	-34.4	178.2	-70.4	-179.5	91.3	-163.8	6.5	112.7	L52 Q53 L60	L52-R56 WeakPolarHBondContact O-CB 3.34Å; L52-R56 VanDerWaalsContact O-CG 3.25Å; L52-R56 WeakPolarHBondContact O-CG 3.44Å; L52-R56 PolarHBondContact O-N 3.32Å; Q53-R56 PolarHBondContact O-N 3.49Å; R56-L60 VanDerWaalsContact O-CB 3.3Å; R56-L60 WeakPolarHBondContact O-CB 3.4Å; R56-L60 PolarHBondContact O-N 3.44Å
57	R	78.3	Confident	74.9	Confident	202 Å²	202	117.7 Å²	117.7	76%	0.762	57%	0.573	S	S	*	*	H	α-helix	trans	-69.1	-42	173.3	-86.5	-172.7	167.6	-159.3	-2.8	112.3	Q53 V54 V55 L60 C61	Q53-R57 WeakPolarHBondContact O-CB 3.33Å; Q53-R57 PolarHBondContact O-N 2.89Å; V54-R57 PolarHBondContact O-N 3.47Å; V55-R57 VanDerWaalsContact C-N 3.3Å; V55-R57 PolarHBondContact O-N 2.95Å; R57-L60 PolarHBondContact O-N 3.43Å; R57-C61 WeakPolarHBondContact O-CB 3.44Å; R57-C61 PolarHBondContact O-N 3.32Å
58	G	80.3	Confident	76	Confident	36 Å²	36	115.8 Å²	115.8	37%	0.371	57%	0.566	S	S	.	*	H	α-helix	trans	-60.3	-49.3	175.2	0	0	0	0	0	111.8	V54 V55 L60 C61 L62	V54-G58 PolarHBondContact O-N 3.07Å; V55-G58 PolarHBondContact O-N 3.22Å; G58-L60 VanDerWaalsContact C-N 3.3Å; G58-L60 PolarHBondContact O-N 2.69Å; G58-C61 WeakPolarHBondContact O-CB 3.47Å; G58-C61 PolarHBondContact O-N 2.93Å; G58-C61 VanDerWaalsContact O-N 3.15Å; G58-L62 WeakPolarHBondContact O-CG 3.43Å; G58-L62 PolarHBondContact O-N 3.39Å
59	D	80.4	Confident	76.8	Confident	92 Å²	92	111.3 Å²	111.3	49%	0.492	55%	0.554	S	S	.	*	H	α-helix	trans	-60	-39.7	175.2	-94.6	19.4	0	0	0	112.4	V55 L62 R63	V55-D59 PolarHBondContact O-N 2.95Å; D59-L62 PolarHBondContact O-N 3.33Å; D59-R63 WeakPolarHBondContact O-CG 3.39Å; D59-R63 PolarHBondContact O-N 3.36Å
60	L	80.1	Confident	77.9	Confident	107 Å²	107	107.5 Å²	107.5	56%	0.56	55%	0.547	S	S	*	.	H	α-helix	trans	-64.5	-43.6	175.5	-175.3	63.7	0	0	0	111	R56 R57 G58 L62 R63 V64	R56-L60 VanDerWaalsContact O-CB 3.3Å; R56-L60 WeakPolarHBondContact O-CB 3.4Å; R56-L60 PolarHBondContact O-N 3.44Å; R57-L60 PolarHBondContact O-N 3.43Å; G58-L60 VanDerWaalsContact C-N 3.3Å; G58-L60 PolarHBondContact O-N 2.69Å; L60-L62 VanDerWaalsContact C-N 3.32Å; L60-L62 PolarHBondContact O-N 3.01Å; L60-R63 PolarHBondContact O-N 2.92Å; L60-V64 HydrophobicContact CD1-CG2 4.4Å; L60-V64 HydrophobicContact CG-CG2 4.38Å; L60-V64 VanDerWaalsContact O-CG2 3.28Å; L60-V64 WeakPolarHBondContact O-CG2 3.42Å; L60-V64 PolarHBondContact O-N 2.81Å
61	C	81.3	Confident	78.7	Confident	80 Å²	80	109.3 Å²	109.3	54%	0.541	55%	0.551	S	S	.	*	H	α-helix	trans	-59.9	-43.1	177	-165.9	0	0	0	0	111.5	R57 G58 V64 T65	R57-C61 WeakPolarHBondContact O-CB 3.44Å; R57-C61 PolarHBondContact O-N 3.32Å; G58-C61 WeakPolarHBondContact O-CB 3.47Å; G58-C61 PolarHBondContact O-N 2.93Å; G58-C61 VanDerWaalsContact O-N 3.15Å; C61-V64 PolarHBondContact O-N 3.15Å; C61-T65 PolarHBondContact O-N 2.89Å; C61-T65 PolarHBondContact O-OG1 2.88Å
62	L	80.8	Confident	79.5	Confident	117 Å²	117	104.9 Å²	104.9	61%	0.613	54%	0.541	S	S	*	.	H	α-helix	trans	-63.1	-40.6	175.2	-71.3	173	0	0	0	112.2	G58 D59 L60 T65 S66	G58-L62 WeakPolarHBondContact O-CG 3.43Å; G58-L62 PolarHBondContact O-N 3.39Å; D59-L62 PolarHBondContact O-N 3.33Å; L60-L62 VanDerWaalsContact C-N 3.32Å; L60-L62 PolarHBondContact O-N 3.01Å; L62-T65 WeakPolarHBondContact CA-OG1 3.48Å; L62-T65 PolarHBondContact O-OG1 3.38Å; L62-S66 VanDerWaalsContact O-CB 3.3Å; L62-S66 WeakPolarHBondContact O-CB 3.3Å; L62-S66 PolarHBondContact O-N 3.4Å
63	R	83.8	Confident	80.4	Confident	176 Å²	176	108.6 Å²	108.6	66%	0.664	55%	0.548	S	S	*	.	H	α-helix	trans	-66.8	-40.9	175	-75.3	177.8	179.4	-110.6	-0.3	112.1	D59 L60 S66 I67	D59-R63 WeakPolarHBondContact O-CG 3.39Å; D59-R63 PolarHBondContact O-N 3.36Å; L60-R63 PolarHBondContact O-N 2.92Å; R63-S66 PolarHBondContact O-N 2.98Å; R63-I67 WeakPolarHBondContact O-CD1 3.46Å; R63-I67 VanDerWaalsContact O-CG1 3.25Å; R63-I67 WeakPolarHBondContact O-CG1 3.28Å; R63-I67 PolarHBondContact O-N 3.15Å
64	V	81.3	Confident	80.9	Confident	64 Å²	64	106.2 Å²	106.2	39%	0.388	54%	0.539	S	S	.	.	H	α-helix	trans	-64.5	-48.7	178.5	171.3	0	0	0	0	110.6	L60 C61 S66 I67 E68	L60-V64 HydrophobicContact CD1-CG2 4.4Å; L60-V64 HydrophobicContact CG-CG2 4.38Å; L60-V64 VanDerWaalsContact O-CG2 3.28Å; L60-V64 WeakPolarHBondContact O-CG2 3.42Å; L60-V64 PolarHBondContact O-N 2.81Å; C61-V64 PolarHBondContact O-N 3.15Å; V64-S66 VanDerWaalsContact C-N 3.31Å; V64-S66 PolarHBondContact O-N 3.48Å; V64-I67 PolarHBondContact O-N 3.47Å; V64-E68 HydrophobicContact CG1-CG 4.49Å; V64-E68 PolarHBondContact O-N 3.03Å
65	T	84.1	Confident	81.4	Confident	67 Å²	67	103.5 Å²	103.5	41%	0.411	53%	0.527	S	S	.	.	H	α-helix	trans	-63.5	-35.2	176.3	33.2	0	0	0	0	112.6	C61 L62 I67 S69	C61-T65 PolarHBondContact O-N 2.89Å; C61-T65 PolarHBondContact O-OG1 2.88Å; L62-T65 WeakPolarHBondContact CA-OG1 3.48Å; L62-T65 PolarHBondContact O-OG1 3.38Å; T65-I67 VanDerWaalsContact C-N 3.31Å; T65-I67 PolarHBondContact O-N 2.98Å; T65-S69 WeakPolarHBondContact O-CB 3.25Å; T65-S69 PolarHBondContact O-N 3.19Å; T65-S69 PolarHBondContact O-OG 2.93Å
66	S	82.5	Confident	81.9	Confident	75 Å²	75	106.6 Å²	106.6	52%	0.524	54%	0.537	S	S	.	.	H	α-helix	trans	-65.4	-33.5	172.2	-176.2	0	0	0	0	112.7	L62 R63 V64 S69 N70	L62-S66 VanDerWaalsContact O-CB 3.3Å; L62-S66 WeakPolarHBondContact O-CB 3.3Å; L62-S66 PolarHBondContact O-N 3.4Å; R63-S66 PolarHBondContact O-N 2.98Å; V64-S66 VanDerWaalsContact C-N 3.31Å; V64-S66 PolarHBondContact O-N 3.48Å; S66-S69 WeakPolarHBondContact CA-OG 3.3Å; S66-S69 PolarHBondContact O-OG 2.83Å; S66-N70 WeakPolarHBondContact O-CB 3.35Å; S66-N70 PolarHBondContact O-N 3.19Å
67	I	85.4	Confident	82.2	Confident	102 Å²	102	100.8 Å²	100.8	52%	0.523	53%	0.526	S	S	.	.	H	α-helix	trans	-73.9	-46.6	176.3	-69.5	163.1	0	0	0	110.1	R63 V64 T65 S69 N70 I71	R63-I67 WeakPolarHBondContact O-CD1 3.46Å; R63-I67 VanDerWaalsContact O-CG1 3.25Å; R63-I67 WeakPolarHBondContact O-CG1 3.28Å; R63-I67 PolarHBondContact O-N 3.15Å; V64-I67 PolarHBondContact O-N 3.47Å; T65-I67 VanDerWaalsContact C-N 3.31Å; T65-I67 PolarHBondContact O-N 2.98Å; I67-S69 PolarHBondContact O-N 2.96Å; I67-N70 WeakPolarHBondContact O-CB 3.44Å; I67-N70 PolarHBondContact O-N 3.41Å; I67-N70 VanDerWaalsContact O-N 3.13Å; I67-I71 HydrophobicContact CG2-CD1 3.87Å; I67-I71 HydrophobicContact CG2-CG1 4.45Å; I67-I71 WeakPolarHBondContact O-CG1 3.49Å; I67-I71 PolarHBondContact O-N 3.08Å
68	E	85.5	Confident	81.7	Confident	109 Å²	109	98.1 Å²	98.1	51%	0.509	52%	0.522	S	S	.	.	H	α-helix	trans	-57	-50	177.2	-73.6	176.9	157.9	0	0	111.4	V64 N70 I71 D72	V64-E68 HydrophobicContact CG1-CG 4.49Å; V64-E68 PolarHBondContact O-N 3.03Å; E68-N70 VanDerWaalsContact C-N 3.25Å; E68-N70 PolarHBondContact O-N 2.85Å; E68-I71 WeakPolarHBondContact O-CB 3.46Å; E68-I71 PolarHBondContact O-N 2.98Å; E68-I71 VanDerWaalsContact O-N 3.08Å; E68-D72 PolarHBondContact O-N 2.93Å
69	S	82.9	Confident	80.9	Confident	59 Å²	59	103.7 Å²	103.7	41%	0.413	54%	0.542	S	S	.	.	H	α-helix	trans	-63.1	-30	177	55.9	0	0	0	0	113.7	T65 S66 I67 R73	T65-S69 WeakPolarHBondContact O-CB 3.25Å; T65-S69 PolarHBondContact O-N 3.19Å; T65-S69 PolarHBondContact O-OG 2.93Å; S66-S69 WeakPolarHBondContact CA-OG 3.3Å; S66-S69 PolarHBondContact O-OG 2.83Å; I67-S69 PolarHBondContact O-N 2.96Å; S69-R73 WeakPolarHBondContact O-CG 3.36Å; S69-R73 PolarHBondContact O-N 3.13Å; S69-R73 VanDerWaalsContact O-N 3.11Å
70	N	85.4	Confident	79.7	Confident	96 Å²	96	101.9 Å²	101.9	51%	0.513	55%	0.546	S	S	.	.	H	α-helix	trans	-72	-38.1	174	-164.7	31.6	0	0	0	111.6	S66 I67 E68 R73 L74	S66-N70 WeakPolarHBondContact O-CB 3.35Å; S66-N70 PolarHBondContact O-N 3.19Å; I67-N70 WeakPolarHBondContact O-CB 3.44Å; I67-N70 PolarHBondContact O-N 3.41Å; I67-N70 VanDerWaalsContact O-N 3.13Å; E68-N70 VanDerWaalsContact C-N 3.25Å; E68-N70 PolarHBondContact O-N 2.85Å; N70-R73 PolarHBondContact O-N 3.24Å; N70-L74 WeakPolarHBondContact O-CG 3.46Å; N70-L74 PolarHBondContact O-N 3.45Å
71	I	82.9	Confident	78.3	Confident	97 Å²	97	105.1 Å²	105.1	50%	0.497	56%	0.558	S	S	.	*	H	α-helix	trans	-63.7	-44.6	174.1	-66.1	164.9	0	0	0	110.2	I67 E68 R73 L74 A75	I67-I71 HydrophobicContact CG2-CD1 3.87Å; I67-I71 HydrophobicContact CG2-CG1 4.45Å; I67-I71 WeakPolarHBondContact O-CG1 3.49Å; I67-I71 PolarHBondContact O-N 3.08Å; E68-I71 WeakPolarHBondContact O-CB 3.46Å; E68-I71 PolarHBondContact O-N 2.98Å; E68-I71 VanDerWaalsContact O-N 3.08Å; I71-R73 VanDerWaalsContact C-N 3.32Å; I71-R73 PolarHBondContact O-N 3.27Å; I71-L74 PolarHBondContact O-N 3.4Å; I71-A75 WeakPolarHBondContact O-CB 3.35Å; I71-A75 PolarHBondContact O-N 3.11Å
72	D	83.9	Confident	76.5	Confident	100 Å²	100	106.5 Å²	106.5	54%	0.535	57%	0.566	S	S	.	*	H	α-helix	trans	-61.3	-41.1	177.6	-73.8	-20.2	0	0	0	111.8	E68 A75 Q76	E68-D72 PolarHBondContact O-N 2.93Å; D72-A75 PolarHBondContact O-N 2.93Å; D72-Q76 WeakPolarHBondContact O-CB 3.34Å; D72-Q76 WeakPolarHBondContact O-CG 3.43Å; D72-Q76 PolarHBondContact O-N 3.4Å
73	R	84.6	Confident	75	Confident	190 Å²	190	106.6 Å²	106.6	72%	0.717	58%	0.576	S	S	*	*	H	α-helix	trans	-63.9	-41.6	174.8	-79.4	-179.1	152.1	-162.7	-5.8	112.6	S69 N70 I71 Q76 S77	S69-R73 WeakPolarHBondContact O-CG 3.36Å; S69-R73 PolarHBondContact O-N 3.13Å; S69-R73 VanDerWaalsContact O-N 3.11Å; N70-R73 PolarHBondContact O-N 3.24Å; I71-R73 VanDerWaalsContact C-N 3.32Å; I71-R73 PolarHBondContact O-N 3.27Å; R73-Q76 PolarHBondContact O-N 2.97Å; R73-S77 PolarHBondContact O-N 2.69Å
74	L	82.6	Confident	73.5	Confident	85 Å²	85	103.6 Å²	103.6	45%	0.445	58%	0.582	S	S	.	*	H	α-helix	trans	-63.5	-47.5	174.9	-74.8	166	0	0	0	110.7	N70 I71 Q76 S77 H78	N70-L74 WeakPolarHBondContact O-CG 3.46Å; N70-L74 PolarHBondContact O-N 3.45Å; I71-L74 PolarHBondContact O-N 3.4Å; L74-Q76 VanDerWaalsContact C-N 3.3Å; L74-Q76 PolarHBondContact O-N 3.04Å; L74-S77 WeakPolarHBondContact CA-OG 3.48Å; L74-S77 PolarHBondContact O-N 3.27Å; L74-S77 VanDerWaalsContact O-N 3.09Å; L74-S77 PolarHBondContact O-OG 3.22Å; L74-H78 PolarHBondContact O-CD2 3.45Å; L74-H78 PolarHBondContact O-N 3.34Å
75	A	80.1	Confident	71.8	Confident	48 Å²	48	106 Å²	106	40%	0.397	60%	0.602	S	S	.	*	H	α-helix	trans	-58	-41.7	177.1	0	0	0	0	0	112.2	I71 D72 H78 L79	I71-A75 WeakPolarHBondContact O-CB 3.35Å; I71-A75 PolarHBondContact O-N 3.11Å; D72-A75 PolarHBondContact O-N 2.93Å; A75-H78 PolarHBondContact O-N 3.36Å; A75-L79 WeakPolarHBondContact O-CG 3.35Å; A75-L79 PolarHBondContact O-N 2.98Å
76	Q	81	Confident	69.7	Low	143 Å²	143	117.1 Å²	117.1	67%	0.668	64%	0.636	S	S	*	*	H	α-helix	trans	-65.2	-40.1	174.6	-75	-176.7	2.9	0	0	112.8	D72 R73 L74 H78 L79 G80	D72-Q76 WeakPolarHBondContact O-CB 3.34Å; D72-Q76 WeakPolarHBondContact O-CG 3.43Å; D72-Q76 PolarHBondContact O-N 3.4Å; R73-Q76 PolarHBondContact O-N 2.97Å; L74-Q76 VanDerWaalsContact C-N 3.3Å; L74-Q76 PolarHBondContact O-N 3.04Å; Q76-H78 VanDerWaalsContact C-N 3.27Å; Q76-H78 PolarHBondContact O-N 3.09Å; Q76-L79 PolarHBondContact O-N 2.97Å; Q76-G80 PolarHBondContact O-N 3.24Å
77	S	78.6	Confident	69.1	Low	71 Å²	71	119.2 Å²	119.2	50%	0.497	64%	0.642	S	S	.	*	H	α-helix	trans	-65	-30.9	177.2	68.9	0	0	0	0	112.9	R73 L74	R73-S77 PolarHBondContact O-N 2.69Å; L74-S77 WeakPolarHBondContact CA-OG 3.48Å; L74-S77 PolarHBondContact O-N 3.27Å; L74-S77 VanDerWaalsContact O-N 3.09Å; L74-S77 PolarHBondContact O-OG 3.22Å
78	H	68.2	Low	68.2	Low	147 Å²	147	120.1 Å²	120.1	68%	0.681	65%	0.648	S	S	*	*	H	α-helix	trans	-81.2	-18	177.5	-67.1	-57	0	0	0	114	L74 A75 Q76	L74-H78 PolarHBondContact O-CD2 3.45Å; L74-H78 PolarHBondContact O-N 3.34Å; A75-H78 PolarHBondContact O-N 3.36Å; Q76-H78 VanDerWaalsContact C-N 3.27Å; Q76-H78 PolarHBondContact O-N 3.09Å
79	L	62.9	Low	67.3	Low	152 Å²	152	120.7 Å²	120.7	80%	0.796	66%	0.656	S	S	*	*	H	α-helix	trans	-88.6	-7.2	175.5	-72.9	167.6	0	0	0	113.1	A75 Q76	A75-L79 WeakPolarHBondContact O-CG 3.35Å; A75-L79 PolarHBondContact O-N 2.98Å; Q76-L79 PolarHBondContact O-N 2.97Å
80	G	56	Low	66.3	Low	55 Å²	55	124.4 Å²	124.4	57%	0.567	67%	0.67	S	S	*	*	S	Bend	trans	-89.8	-4.4	-174.2	0	0	0	0	0	116.6	Q76 P82	Q76-G80 PolarHBondContact O-N 3.24Å; G80-P82 WeakPolarHBondContact O-CD 3.09Å
81	E	50.3	Low	65.1	Low	175 Å²	175	126.1 Å²	126.1	82%	0.818	68%	0.68	S	S	*	*			trans	-104.7	90.2	173.4	-72	-154.1	150.8	0	0	111.2	S83	E81-S83 PolarHBondContact O-N 3.38Å
82	P	44.9	Very low	64	Low	109 Å²	109	128.1 Å²	128.1	71%	0.708	69%	0.692	S	S	*	*			trans	-66.5	118.5	154.4	28.9	-28	0	0	0	106.1	G80 S84	G80-P82 WeakPolarHBondContact O-CD 3.09Å; P82-S84 PolarHBondContact O-N 2.84Å
83	S	48.3	Very low	62.5	Low	118 Å²	118	130.1 Å²	130.1	83%	0.825	70%	0.703	S	S	*	*			trans	-56.6	91.9	165.9	8.4	0	0	0	0	107.3	E81 S85	E81-S83 PolarHBondContact O-N 3.38Å; S83-S85 PolarHBondContact O-N 2.73Å
84	S	51.3	Low	60.9	Low	113 Å²	113	125.5 Å²	125.5	79%	0.79	70%	0.702	S	S	*	*			trans	-71.3	75	166.8	174.6	0	0	0	0	107.2	P82 R86	P82-S84 PolarHBondContact O-N 2.84Å; S84-R86 PolarHBondContact O-N 3.16Å; S84-R86 VanDerWaalsContact O-N 3.16Å
85	S	46.1	Very low	59	Low	116 Å²	116	128.8 Å²	128.8	81%	0.811	72%	0.724	S	S	*	*			trans	-72	98.2	160.7	-173.7	0	0	0	0	106.8	S83	S83-S85 PolarHBondContact O-N 2.73Å
86	R	40.8	Very low	57.1	Low	299 Å²	299	136.2 Å²	136.2	100%	1.128	75%	0.754	S	S	*	*			trans	-79.8	0	163.9	178.3	-178.8	-96.6	-163.5	-5.3	109.3	S84	S84-R86 PolarHBondContact O-N 3.16Å; S84-R86 VanDerWaalsContact O-N 3.16Å

Retrieved 86 of 86 residues in 55.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).