A0A077ZC38_TRITR Loading...

Cyclic AMP-responsive element-binding protein 3-l ike protein 4

AlphaFold DB , UniProt , Accession A0A077ZC38, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 91 aa.

						>A0A077ZC38_TRITR|A0A077ZC38
MCEKEGIKMPLKFPLSKAEERIVKRIRRKIRNKRSAQESRKRKQAYVEALEKKVKCCALETQTWQNRVKMPRSKTPYVNLLLFRYSFFRWQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.4	Low	64.7	Low	88 Å²	88	117.5 Å²	117.5	43%	0.433	60%	0.604	S	S	.	*				0	-44	0	-154.5	167.1	-169.5	0	0	110.1	K4 E5 K29 I30 K33	M1-K4 PolarHBondContact O-N 3.47Å; M1-E5 PolarHBondContact O-N 3.02Å; M1-E5 VanDerWaalsContact O-N 3.11Å; M1-K29 HydrophobicContact CE-CB 3.97Å; M1-K29 HydrophobicContact CE-CD 4.36Å; M1-K29 HydrophobicContact SD-CB 4.24Å; M1-I30 HydrophobicContact CB-CG1 4.48Å; M1-I30 HydrophobicContact SD-CG1 4.11Å; M1-K33 HydrophobicContact CE-CD 4.28Å; M1-K33 HydrophobicContact SD-CD 4.26Å
2	C	59.7	Low	64.9	Low	45 Å²	45	122.7 Å²	122.7	30%	0.304	62%	0.619	S	S	.	*	T	Hydrogen-bonded Turn	trans	-58	-47.3	172.6	-53.2	0	0	0	0	113.2	K4 E5 G6 I7	C2-K4 PolarHBondContact O-N 3.16Å; C2-E5 PolarHBondContact O-N 2.85Å; C2-G6 PolarHBondContact O-N 3.42Å; C2-I7 PolarHBondContact O-N 3.26Å
3	E	61.4	Low	65.6	Low	181 Å²	181	126.2 Å²	126.2	85%	0.846	63%	0.628	S	S	*	*	G	3₁₀ helix	trans	-63.8	-40.4	175.3	-68.2	168.9	167.6	0	0	112.8	E5 G6	E3-E5 PolarHBondContact O-N 3.46Å; E3-G6 PolarHBondContact O-N 3.13Å
4	K	66.4	Low	66.5	Low	194 Å²	194	126.2 Å²	126.2	84%	0.843	64%	0.642	S	S	*	*	G	3₁₀ helix	trans	-66	-19	177.5	-69.6	-167.1	175.5	-168.7	0	113.6	M1 C2	M1-K4 PolarHBondContact O-N 3.47Å; C2-K4 PolarHBondContact O-N 3.16Å
5	E	65.1	Low	67.3	Low	95 Å²	95	119.7 Å²	119.7	44%	0.444	61%	0.609	S	S	.	*	G	3₁₀ helix	trans	-103.6	9.3	174.2	-60.8	-130.9	175.9	0	0	112.2	M1 C2 E3 I7 K29	M1-E5 PolarHBondContact O-N 3.02Å; M1-E5 VanDerWaalsContact O-N 3.11Å; C2-E5 PolarHBondContact O-N 2.85Å; E3-E5 PolarHBondContact O-N 3.46Å; E5-I7 HydrophobicContact CB-CD1 4.1Å; E5-I7 HydrophobicContact CB-CG1 4.21Å; E5-I7 WeakPolarHBondContact O-CG1 3.21Å; E5-I7 PolarHBondContact O-N 2.86Å; E5-K29 IonicContact OE1-NZ 2.76Å; E5-K29 PolarHBondContact OE1-NZ 3.06Å; E5-K29 IonicContact OE2-NZ 2.71Å; E5-K29 PolarHBondContact OE2-NZ 3.5Å
6	G	63.6	Low	68.4	Low	67 Å²	67	116.1 Å²	116.1	69%	0.691	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	71	13.8	178.2	0	0	0	0	0	114.6	C2 E3 K8	C2-G6 PolarHBondContact O-N 3.42Å; E3-G6 PolarHBondContact O-N 3.13Å; G6-K8 PolarHBondContact O-N 3.46Å
7	I	64	Low	69.5	Low	57 Å²	57	118.7 Å²	118.7	29%	0.292	60%	0.604	S	S	.	*			trans	-95.6	100.9	-173.8	-52.5	174.9	0	0	0	108.4	C2 E5 I22 I26	C2-I7 PolarHBondContact O-N 3.26Å; E5-I7 HydrophobicContact CB-CD1 4.1Å; E5-I7 HydrophobicContact CB-CG1 4.21Å; E5-I7 WeakPolarHBondContact O-CG1 3.21Å; E5-I7 PolarHBondContact O-N 2.86Å; I7-I22 HydrophobicContact CD1-CG2 3.82Å; I7-I22 HydrophobicContact CG2-CG2 4.18Å; I7-I26 HydrophobicContact CB-CD1 4.18Å; I7-I26 HydrophobicContact CD1-CD1 3.52Å; I7-I26 HydrophobicContact CD1-CG1 4.06Å; I7-I26 HydrophobicContact CG1-CD1 4.41Å; I7-I26 HydrophobicContact CG2-CD1 3.9Å
8	K	68.8	Low	70.5	Confident	194 Å²	194	115 Å²	115	84%	0.843	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-65.6	139.1	171.5	-69.2	-179	179.2	179.4	0	109.4	G6	G6-K8 PolarHBondContact O-N 3.46Å
9	M	66.4	Low	71.2	Confident	164 Å²	164	113.2 Å²	113.2	81%	0.808	58%	0.583	S	S	*	*	P	Polyproline II helix	trans	-60.7	129	176.8	-108.3	-153.7	179.2	0	0	109.2	L11	M9-L11 PolarHBondContact O-N 2.89Å
10	P	66.6	Low	72	Confident	41 Å²	41	113 Å²	113	27%	0.266	58%	0.579	S	S	.	*	P	Polyproline II helix	trans	-63.4	121.4	176.6	20.9	-26.2	0	0	0	109.1	L15	P10-L15 HydrophobicContact CB-CD2 3.96Å; P10-L15 HydrophobicContact CB-CG 4.25Å; P10-L15 HydrophobicContact CG-CD2 3.5Å; P10-L15 HydrophobicContact CG-CG 4.22Å
11	L	68.9	Low	72.9	Confident	167 Å²	167	116 Å²	116	87%	0.874	58%	0.583	S	S	*	*			trans	-90.2	-11.6	-175.7	-76.3	157.2	0	0	0	113	M9	M9-L11 PolarHBondContact O-N 2.89Å
12	K	67.8	Low	74.2	Confident	179 Å²	179	115.1 Å²	115.1	78%	0.778	58%	0.579	S	S	*	*	S	Bend	trans	-126.7	133.6	-174.9	-61	-175.2	-178.4	-177.4	0	109.9
13	F	74.1	Confident	75.5	Confident	168 Å²	168	115.1 Å²	115.1	74%	0.737	58%	0.578	S	S	*	*	S	Bend	trans	-112.2	149.1	174.9	-70.9	-95.2	0	0	0	108.7	L15	F13-L15 HydrophobicContact CD1-CD1 3.32Å; F13-L15 HydrophobicContact CE1-CD1 3.17Å; F13-L15 HydrophobicContact CG-CD1 4.24Å; F13-L15 HydrophobicContact CZ-CD1 4.01Å
14	P	77.3	Confident	76.9	Confident	127 Å²	127	114.2 Å²	114.2	83%	0.825	57%	0.571	S	S	*	*	S	Bend	cis	-77.2	145.1	2	30.3	-33.2	0	0	0	113
15	L	78.8	Confident	78.1	Confident	28 Å²	28	113 Å²	113	15%	0.147	56%	0.561	C	S	.	*	P	Polyproline II helix	trans	-69.1	148.5	176.7	-77.7	94	0	0	0	110.8	P10 F13 E19 E20 V23	P10-L15 HydrophobicContact CB-CD2 3.96Å; P10-L15 HydrophobicContact CB-CG 4.25Å; P10-L15 HydrophobicContact CG-CD2 3.5Å; P10-L15 HydrophobicContact CG-CG 4.22Å; F13-L15 HydrophobicContact CD1-CD1 3.32Å; F13-L15 HydrophobicContact CE1-CD1 3.17Å; F13-L15 HydrophobicContact CG-CD1 4.24Å; F13-L15 HydrophobicContact CZ-CD1 4.01Å; L15-E19 WeakPolarHBondContact CA-OE2 3.34Å; L15-E19 HydrophobicContact CB-CB 4.17Å; L15-E19 HydrophobicContact CD2-CB 3.65Å; L15-E19 HydrophobicContact CG-CB 4.33Å; L15-E20 HydrophobicContact CB-CG 3.8Å; L15-V23 HydrophobicContact CD2-CG2 4.08Å
16	S	85.2	Confident	79.3	Confident	62 Å²	62	109.4 Å²	109.4	43%	0.434	55%	0.545	S	S	.	.	P	Polyproline II helix	trans	-62.1	147.4	164.8	154.3	0	0	0	0	110.6	A18 E19 E20	S16-A18 PolarHBondContact O-N 3.47Å; S16-A18 PolarHBondContact OG-N 2.91Å; S16-A18 VanDerWaalsContact OG-N 3.14Å; S16-E19 PolarHBondContact N-OE2 3.46Å; S16-E19 PolarHBondContact O-N 2.92Å; S16-E20 PolarHBondContact O-N 3.44Å
17	K	87.6	Confident	80.8	Confident	161 Å²	161	114.6 Å²	114.6	70%	0.7	54%	0.544	S	S	*	.	H	α-helix	trans	-50.9	-30	173	-70.3	-173.9	-176.2	179.1	0	112.6	R21	K17-R21 VanDerWaalsContact O-CG 3.28Å; K17-R21 WeakPolarHBondContact O-CG 3.47Å; K17-R21 PolarHBondContact O-N 3.04Å
18	A	86.5	Confident	82.3	Confident	52 Å²	52	118.6 Å²	118.6	43%	0.43	56%	0.555	S	S	.	*	H	α-helix	trans	-72	-43	176.8	0	0	0	0	0	111.9	S16 R21 I22	S16-A18 PolarHBondContact O-N 3.47Å; S16-A18 PolarHBondContact OG-N 2.91Å; S16-A18 VanDerWaalsContact OG-N 3.14Å; A18-R21 WeakPolarHBondContact O-CB 3.46Å; A18-R21 PolarHBondContact O-N 3.4Å; A18-I22 WeakPolarHBondContact O-CG1 3.47Å; A18-I22 PolarHBondContact O-N 3.26Å; A18-I22 VanDerWaalsContact O-N 3.12Å
19	E	83.9	Confident	83.5	Confident	81 Å²	81	113 Å²	113	38%	0.379	53%	0.531	S	S	.	.	H	α-helix	trans	-67.6	-38.6	179.3	-57.2	174.2	127.9	0	0	111	L15 S16 R21 I22 V23	L15-E19 WeakPolarHBondContact CA-OE2 3.34Å; L15-E19 HydrophobicContact CB-CB 4.17Å; L15-E19 HydrophobicContact CD2-CB 3.65Å; L15-E19 HydrophobicContact CG-CB 4.33Å; S16-E19 PolarHBondContact N-OE2 3.46Å; S16-E19 PolarHBondContact O-N 2.92Å; E19-R21 VanDerWaalsContact C-N 3.32Å; E19-R21 PolarHBondContact O-N 2.81Å; E19-I22 WeakPolarHBondContact O-CB 2.97Å; E19-I22 PolarHBondContact O-N 3.42Å; E19-I22 VanDerWaalsContact O-N 3.12Å; E19-V23 WeakPolarHBondContact O-CG2 3.3Å; E19-V23 PolarHBondContact O-N 3.47Å
20	E	88.3	Confident	84.8	Confident	109 Å²	109	109 Å²	109	51%	0.509	51%	0.512	S	S	.	.	H	α-helix	trans	-58.3	-42.4	173.1	-68	-177	161.1	0	0	112.3	L15 S16 I22 V23 K24	L15-E20 HydrophobicContact CB-CG 3.8Å; S16-E20 PolarHBondContact O-N 3.44Å; E20-I22 VanDerWaalsContact C-N 3.32Å; E20-I22 PolarHBondContact O-N 3.49Å; E20-V23 PolarHBondContact O-N 3.32Å; E20-K24 WeakPolarHBondContact O-CB 3.35Å; E20-K24 PolarHBondContact O-N 2.92Å
21	R	89.5	Confident	86.3	Confident	177 Å²	177	114.5 Å²	114.5	67%	0.668	53%	0.528	S	S	*	.	H	α-helix	trans	-62	-41.1	175.2	-70	171.3	-165.2	-176.7	3.4	111.4	K17 A18 E19 K24 R25	K17-R21 VanDerWaalsContact O-CG 3.28Å; K17-R21 WeakPolarHBondContact O-CG 3.47Å; K17-R21 PolarHBondContact O-N 3.04Å; A18-R21 WeakPolarHBondContact O-CB 3.46Å; A18-R21 PolarHBondContact O-N 3.4Å; E19-R21 VanDerWaalsContact C-N 3.32Å; E19-R21 PolarHBondContact O-N 2.81Å; R21-K24 PolarHBondContact O-N 2.97Å; R21-R25 WeakPolarHBondContact O-CB 3.38Å; R21-R25 PolarHBondContact O-N 3.3Å
22	I	88.1	Confident	87.6	Confident	68 Å²	68	110 Å²	110	35%	0.349	50%	0.504	S	S	.	.	H	α-helix	trans	-63.5	-49.8	177.3	-67.9	168.2	0	0	0	110.1	I7 A18 E19 E20 K24 R25 I26	I7-I22 HydrophobicContact CD1-CG2 3.82Å; I7-I22 HydrophobicContact CG2-CG2 4.18Å; A18-I22 WeakPolarHBondContact O-CG1 3.47Å; A18-I22 PolarHBondContact O-N 3.26Å; A18-I22 VanDerWaalsContact O-N 3.12Å; E19-I22 WeakPolarHBondContact O-CB 2.97Å; E19-I22 PolarHBondContact O-N 3.42Å; E19-I22 VanDerWaalsContact O-N 3.12Å; E20-I22 VanDerWaalsContact C-N 3.32Å; E20-I22 PolarHBondContact O-N 3.49Å; I22-K24 VanDerWaalsContact C-N 3.3Å; I22-K24 PolarHBondContact O-N 2.66Å; I22-R25 WeakPolarHBondContact O-CB 3.35Å; I22-R25 PolarHBondContact O-N 3.41Å; I22-R25 VanDerWaalsContact O-N 3.1Å; I22-I26 HydrophobicContact CG2-CD1 3.86Å; I22-I26 HydrophobicContact CG2-CG1 4.4Å; I22-I26 WeakPolarHBondContact O-CG1 3.38Å; I22-I26 PolarHBondContact O-N 3.25Å
23	V	87.5	Confident	89	Confident	45 Å²	45	107.8 Å²	107.8	27%	0.273	50%	0.495	S	S	.	.	H	α-helix	trans	-58.2	-43.1	177.9	172.9	0	0	0	0	111.1	L15 E19 E20 R25 I26 R27	L15-V23 HydrophobicContact CD2-CG2 4.08Å; E19-V23 WeakPolarHBondContact O-CG2 3.3Å; E19-V23 PolarHBondContact O-N 3.47Å; E20-V23 PolarHBondContact O-N 3.32Å; V23-R25 PolarHBondContact O-N 3.24Å; V23-I26 PolarHBondContact O-N 3Å; V23-R27 HydrophobicContact CG1-CG 4.47Å; V23-R27 WeakPolarHBondContact O-CB 3.49Å; V23-R27 WeakPolarHBondContact O-CG 3.4Å; V23-R27 PolarHBondContact O-N 3.49Å
24	K	90.8	Very high	90	Very high	163 Å²	163	108.9 Å²	108.9	71%	0.709	49%	0.494	S	S	*	.	H	α-helix	trans	-61.2	-43	176.2	-168.7	174.8	-176.4	176.5	0	111.8	E20 R21 I22 R27 R28	E20-K24 WeakPolarHBondContact O-CB 3.35Å; E20-K24 PolarHBondContact O-N 2.92Å; R21-K24 PolarHBondContact O-N 2.97Å; I22-K24 VanDerWaalsContact C-N 3.3Å; I22-K24 PolarHBondContact O-N 2.66Å; K24-R27 PolarHBondContact O-N 3.11Å; K24-R28 PolarHBondContact O-N 3.13Å
25	R	91.5	Very high	90.9	Very high	167 Å²	167	106 Å²	106	63%	0.63	48%	0.477	S	S	*	.	H	α-helix	trans	-62.5	-44.8	176.2	-171.3	-174.6	-65.2	168.1	-1.3	111.6	R21 I22 V23 R28 K29	R21-R25 WeakPolarHBondContact O-CB 3.38Å; R21-R25 PolarHBondContact O-N 3.3Å; I22-R25 WeakPolarHBondContact O-CB 3.35Å; I22-R25 PolarHBondContact O-N 3.41Å; I22-R25 VanDerWaalsContact O-N 3.1Å; V23-R25 PolarHBondContact O-N 3.24Å; R25-R28 WeakPolarHBondContact O-CB 3.38Å; R25-R28 PolarHBondContact O-N 3.41Å; R25-K29 PolarHBondContact O-N 2.95Å
26	I	90.9	Very high	91.8	Very high	20 Å²	20	106.5 Å²	106.5	10%	0.103	49%	0.485	C	S	.	.	H	α-helix	trans	-62.9	-47.3	177.7	-64.7	168.9	0	0	0	110.7	I7 I22 V23 R28 K29 I30	I7-I26 HydrophobicContact CB-CD1 4.18Å; I7-I26 HydrophobicContact CD1-CD1 3.52Å; I7-I26 HydrophobicContact CD1-CG1 4.06Å; I7-I26 HydrophobicContact CG1-CD1 4.41Å; I7-I26 HydrophobicContact CG2-CD1 3.9Å; I22-I26 HydrophobicContact CG2-CD1 3.86Å; I22-I26 HydrophobicContact CG2-CG1 4.4Å; I22-I26 WeakPolarHBondContact O-CG1 3.38Å; I22-I26 PolarHBondContact O-N 3.25Å; V23-I26 PolarHBondContact O-N 3Å; I26-R28 PolarHBondContact O-N 3.01Å; I26-K29 WeakPolarHBondContact O-CB 3.38Å; I26-K29 PolarHBondContact O-N 2.78Å; I26-K29 VanDerWaalsContact O-N 3.1Å; I26-I30 HydrophobicContact CG2-CD1 3.8Å; I26-I30 HydrophobicContact CG2-CG1 4.34Å; I26-I30 WeakPolarHBondContact O-CG1 3.46Å; I26-I30 PolarHBondContact O-N 2.98Å
27	R	93.4	Very high	92.4	Very high	177 Å²	177	109.3 Å²	109.3	67%	0.668	49%	0.491	S	S	*	.	H	α-helix	trans	-55.8	-41.2	176	-76.5	178	170.9	-172.3	-1.8	111.5	V23 K24 R31	V23-R27 HydrophobicContact CG1-CG 4.47Å; V23-R27 WeakPolarHBondContact O-CB 3.49Å; V23-R27 WeakPolarHBondContact O-CG 3.4Å; V23-R27 PolarHBondContact O-N 3.49Å; K24-R27 PolarHBondContact O-N 3.11Å; R27-R31 PolarHBondContact O-N 3.04Å; R27-R31 VanDerWaalsContact O-N 3.09Å
28	R	95.5	Very high	92.9	Very high	141 Å²	141	105.5 Å²	105.5	53%	0.532	48%	0.476	S	S	.	.	H	α-helix	trans	-65.3	-45.9	175.1	-176.1	59.1	169.5	175.8	0.4	112.1	K24 R25 I26 I30 R31 N32	K24-R28 PolarHBondContact O-N 3.13Å; R25-R28 WeakPolarHBondContact O-CB 3.38Å; R25-R28 PolarHBondContact O-N 3.41Å; I26-R28 PolarHBondContact O-N 3.01Å; R28-I30 VanDerWaalsContact C-N 3.33Å; R28-I30 PolarHBondContact O-N 3.4Å; R28-R31 PolarHBondContact O-N 3.48Å; R28-N32 PolarHBondContact NE-OD1 2.67Å; R28-N32 WeakPolarHBondContact O-CB 3.25Å; R28-N32 PolarHBondContact O-N 3.38Å
29	K	95.2	Very high	93.5	Very high	75 Å²	75	106 Å²	106	33%	0.326	48%	0.476	S	S	.	.	H	α-helix	trans	-57.1	-44.8	175.9	-77.6	-175.1	172.8	-172.6	0	111.7	M1 E5 R25 I26 N32 K33	M1-K29 HydrophobicContact CE-CB 3.97Å; M1-K29 HydrophobicContact CE-CD 4.36Å; M1-K29 HydrophobicContact SD-CB 4.24Å; E5-K29 IonicContact OE1-NZ 2.76Å; E5-K29 PolarHBondContact OE1-NZ 3.06Å; E5-K29 IonicContact OE2-NZ 2.71Å; E5-K29 PolarHBondContact OE2-NZ 3.5Å; R25-K29 PolarHBondContact O-N 2.95Å; I26-K29 WeakPolarHBondContact O-CB 3.38Å; I26-K29 PolarHBondContact O-N 2.78Å; I26-K29 VanDerWaalsContact O-N 3.1Å; K29-N32 PolarHBondContact O-N 2.83Å; K29-K33 WeakPolarHBondContact O-CB 3.35Å; K29-K33 PolarHBondContact O-N 2.89Å
30	I	94.4	Very high	94.2	Very high	82 Å²	82	111 Å²	111	42%	0.421	49%	0.492	S	S	.	.	H	α-helix	trans	-62.2	-49.1	178.8	-67.4	168.5	0	0	0	110.7	M1 I26 R28 N32 K33 R34	M1-I30 HydrophobicContact CB-CG1 4.48Å; M1-I30 HydrophobicContact SD-CG1 4.11Å; I26-I30 HydrophobicContact CG2-CD1 3.8Å; I26-I30 HydrophobicContact CG2-CG1 4.34Å; I26-I30 WeakPolarHBondContact O-CG1 3.46Å; I26-I30 PolarHBondContact O-N 2.98Å; R28-I30 VanDerWaalsContact C-N 3.33Å; R28-I30 PolarHBondContact O-N 3.4Å; I30-N32 PolarHBondContact O-N 2.87Å; I30-K33 PolarHBondContact O-N 3.34Å; I30-R34 PolarHBondContact O-N 3.36Å; I30-R34 VanDerWaalsContact O-N 3.15Å
31	R	96.5	Very high	94.7	Very high	156 Å²	156	112.3 Å²	112.3	59%	0.589	50%	0.496	S	S	*	.	H	α-helix	trans	-61	-46.9	179.3	-159.6	-171.7	-51.5	168.2	2.8	111.4	R27 R28 K33 R34 S35	R27-R31 PolarHBondContact O-N 3.04Å; R27-R31 VanDerWaalsContact O-N 3.09Å; R28-R31 PolarHBondContact O-N 3.48Å; R31-K33 VanDerWaalsContact C-N 3.32Å; R31-K33 PolarHBondContact O-N 3.19Å; R31-R34 PolarHBondContact O-N 3.45Å; R31-S35 PolarHBondContact O-N 3.36Å; R31-S35 PolarHBondContact O-OG 2.79Å
32	N	97.1	Very high	95.1	Very high	73 Å²	73	111.4 Å²	111.4	39%	0.39	49%	0.493	S	S	.	.	H	α-helix	trans	-63.2	-37.4	179	-76.5	6.3	0	0	0	112.3	R28 K29 I30 S35 A36	R28-N32 PolarHBondContact NE-OD1 2.67Å; R28-N32 WeakPolarHBondContact O-CB 3.25Å; R28-N32 PolarHBondContact O-N 3.38Å; K29-N32 PolarHBondContact O-N 2.83Å; I30-N32 PolarHBondContact O-N 2.87Å; N32-S35 PolarHBondContact O-N 3.3Å; N32-A36 VanDerWaalsContact O-CB 3.29Å; N32-A36 WeakPolarHBondContact O-CB 3.47Å; N32-A36 PolarHBondContact O-N 3.33Å
33	K	96.6	Very high	95.5	Very high	131 Å²	131	115.5 Å²	115.5	57%	0.57	51%	0.508	S	S	*	.	H	α-helix	trans	-61.9	-45.6	176.3	-175.2	165.2	-177.2	171.5	0	111.5	M1 K29 I30 R31 A36 Q37	M1-K33 HydrophobicContact CE-CD 4.28Å; M1-K33 HydrophobicContact SD-CD 4.26Å; K29-K33 WeakPolarHBondContact O-CB 3.35Å; K29-K33 PolarHBondContact O-N 2.89Å; I30-K33 PolarHBondContact O-N 3.34Å; R31-K33 VanDerWaalsContact C-N 3.32Å; R31-K33 PolarHBondContact O-N 3.19Å; K33-A36 PolarHBondContact O-N 3.23Å; K33-Q37 WeakPolarHBondContact O-CB 3.25Å; K33-Q37 PolarHBondContact O-N 2.96Å
34	R	95.8	Very high	96	Very high	191 Å²	191	118.1 Å²	118.1	72%	0.721	52%	0.517	S	S	*	.	H	α-helix	trans	-61.8	-48	174.8	-175	-177.5	-79.9	-173.6	-5.3	110.9	I30 R31 A36 Q37 E38	I30-R34 PolarHBondContact O-N 3.36Å; I30-R34 VanDerWaalsContact O-N 3.15Å; R31-R34 PolarHBondContact O-N 3.45Å; R34-A36 PolarHBondContact O-N 2.94Å; R34-Q37 PolarHBondContact O-N 3.48Å; R34-E38 PolarHBondContact O-N 3.33Å
35	S	96.9	Very high	96.4	Very high	67 Å²	67	113 Å²	113	47%	0.469	51%	0.505	S	S	.	.	H	α-helix	trans	-60.9	-41.7	179.2	-63.1	0	0	0	0	113.1	R31 N32 E38 S39	R31-S35 PolarHBondContact O-N 3.36Å; R31-S35 PolarHBondContact O-OG 2.79Å; N32-S35 PolarHBondContact O-N 3.3Å; S35-E38 PolarHBondContact O-N 2.92Å; S35-S39 WeakPolarHBondContact O-CB 3.43Å; S35-S39 PolarHBondContact O-N 2.99Å
36	A	97.3	Very high	96.7	Very high	39 Å²	39	112.2 Å²	112.2	32%	0.322	50%	0.503	S	S	.	.	H	α-helix	trans	-66.1	-38.1	177	0	0	0	0	0	111.9	N32 K33 R34 S39 R40	N32-A36 VanDerWaalsContact O-CB 3.29Å; N32-A36 WeakPolarHBondContact O-CB 3.47Å; N32-A36 PolarHBondContact O-N 3.33Å; K33-A36 PolarHBondContact O-N 3.23Å; R34-A36 PolarHBondContact O-N 2.94Å; A36-S39 PolarHBondContact O-N 3.44Å; A36-R40 WeakPolarHBondContact O-CG 3.45Å; A36-R40 PolarHBondContact O-N 2.85Å
37	Q	98.2	Very high	97	Very high	120 Å²	120	113.6 Å²	113.6	56%	0.561	51%	0.512	S	S	*	.	H	α-helix	trans	-64.4	-48.2	175.3	-175	174.3	-4.4	0	0	111.5	K33 R34 S39 R40 K41	K33-Q37 WeakPolarHBondContact O-CB 3.25Å; K33-Q37 PolarHBondContact O-N 2.96Å; R34-Q37 PolarHBondContact O-N 3.48Å; Q37-S39 VanDerWaalsContact C-N 3.28Å; Q37-S39 PolarHBondContact O-N 3.36Å; Q37-R40 PolarHBondContact O-N 3.33Å; Q37-R40 VanDerWaalsContact O-N 3.16Å; Q37-K41 PolarHBondContact O-N 2.76Å
38	E	98.1	Very high	97.2	Very high	81 Å²	81	110 Å²	110	38%	0.379	50%	0.503	S	S	.	.	H	α-helix	trans	-61.9	-37.1	176.2	-72.7	-54.4	132.6	0	0	112.2	R34 S35 K41 R42	R34-E38 PolarHBondContact O-N 3.33Å; S35-E38 PolarHBondContact O-N 2.92Å; E38-K41 PolarHBondContact O-N 3.43Å; E38-R42 WeakPolarHBondContact O-CG 3.43Å; E38-R42 PolarHBondContact O-N 3.33Å
39	S	98.5	Very high	97.3	Very high	63 Å²	63	105.5 Å²	105.5	44%	0.441	50%	0.496	S	S	.	.	H	α-helix	trans	-62.8	-43	174.4	-166.5	0	0	0	0	112.2	S35 A36 Q37 K43	S35-S39 WeakPolarHBondContact O-CB 3.43Å; S35-S39 PolarHBondContact O-N 2.99Å; A36-S39 PolarHBondContact O-N 3.44Å; Q37-S39 VanDerWaalsContact C-N 3.28Å; Q37-S39 PolarHBondContact O-N 3.36Å; S39-K43 PolarHBondContact O-N 2.98Å; S39-K43 VanDerWaalsContact O-N 3.13Å
40	R	98.3	Very high	97.4	Very high	185 Å²	185	105.3 Å²	105.3	70%	0.698	50%	0.498	S	S	*	.	H	α-helix	trans	-64.7	-42.5	175.1	-71.7	174.8	-174.1	134.9	-0.5	111.2	A36 Q37 R42 K43 Q44	A36-R40 WeakPolarHBondContact O-CG 3.45Å; A36-R40 PolarHBondContact O-N 2.85Å; Q37-R40 PolarHBondContact O-N 3.33Å; Q37-R40 VanDerWaalsContact O-N 3.16Å; R40-R42 PolarHBondContact O-N 3.41Å; R40-K43 PolarHBondContact O-N 2.95Å; R40-Q44 WeakPolarHBondContact O-CB 3.37Å; R40-Q44 PolarHBondContact O-N 3.11Å
41	K	98.2	Very high	97.6	Very high	138 Å²	138	106.1 Å²	106.1	60%	0.6	50%	0.5	S	S	*	.	H	α-helix	trans	-60.6	-43.7	177.6	-170.1	178	-179.7	-177.7	0	112.1	Q37 E38 Q44 A45	Q37-K41 PolarHBondContact O-N 2.76Å; E38-K41 PolarHBondContact O-N 3.43Å; K41-Q44 PolarHBondContact O-N 3.34Å; K41-A45 PolarHBondContact O-N 3.01Å
42	R	97.9	Very high	97.6	Very high	158 Å²	158	105.7 Å²	105.7	60%	0.596	50%	0.502	S	S	*	.	H	α-helix	trans	-62	-44.9	174.9	-75.2	-168.6	-64.4	-91.8	2.6	112.5	E38 R40 Q44 A45 Y46	E38-R42 WeakPolarHBondContact O-CG 3.43Å; E38-R42 PolarHBondContact O-N 3.33Å; R40-R42 PolarHBondContact O-N 3.41Å; R42-Q44 VanDerWaalsContact C-N 3.35Å; R42-A45 PolarHBondContact O-N 2.84Å; R42-Y46 PolarHBondContact O-N 3.35Å
43	K	97.8	Very high	97.6	Very high	153 Å²	153	109.4 Å²	109.4	67%	0.665	52%	0.515	S	S	*	.	H	α-helix	trans	-61.6	-45.1	176.9	-175.2	178	178.6	-179	0	111.1	S39 R40 Y46 V47	S39-K43 PolarHBondContact O-N 2.98Å; S39-K43 VanDerWaalsContact O-N 3.13Å; R40-K43 PolarHBondContact O-N 2.95Å; K43-Y46 PolarHBondContact O-N 3.44Å; K43-V47 WeakPolarHBondContact O-CG2 3.48Å; K43-V47 PolarHBondContact O-N 2.93Å
44	Q	97.9	Very high	97.6	Very high	101 Å²	101	107.9 Å²	107.9	47%	0.472	52%	0.517	S	S	.	.	H	α-helix	trans	-58.5	-49.6	177.9	-175.9	61.6	28.3	0	0	111.4	R40 K41 R42 Y46 V47 E48	R40-Q44 WeakPolarHBondContact O-CB 3.37Å; R40-Q44 PolarHBondContact O-N 3.11Å; K41-Q44 PolarHBondContact O-N 3.34Å; R42-Q44 VanDerWaalsContact C-N 3.35Å; Q44-Y46 VanDerWaalsContact C-N 3.29Å; Q44-Y46 PolarHBondContact O-N 2.97Å; Q44-V47 PolarHBondContact O-N 3.31Å; Q44-V47 VanDerWaalsContact O-N 3.16Å; Q44-E48 VanDerWaalsContact CG-OE1 3.29Å; Q44-E48 WeakPolarHBondContact CG-OE1 3.43Å; Q44-E48 PolarHBondContact NE2-OE1 3.32Å; Q44-E48 WeakPolarHBondContact O-CG 3.31Å; Q44-E48 PolarHBondContact O-N 2.92Å
45	A	97.9	Very high	97.6	Very high	54 Å²	54	105.3 Å²	105.3	45%	0.446	51%	0.511	S	S	.	.	H	α-helix	trans	-60.7	-37	178.4	0	0	0	0	0	112.9	K41 R42 A49	K41-A45 PolarHBondContact O-N 3.01Å; R42-A45 PolarHBondContact O-N 2.84Å; A45-A49 WeakPolarHBondContact O-CB 3.26Å; A45-A49 PolarHBondContact O-N 3.07Å
46	Y	97.9	Very high	97.5	Very high	152 Å²	152	105.4 Å²	105.4	60%	0.596	51%	0.511	S	S	*	.	H	α-helix	trans	-66.3	-43.7	175.5	179.6	-108.5	0	0	0	112.1	R42 K43 Q44 A49 L50	R42-Y46 PolarHBondContact O-N 3.35Å; K43-Y46 PolarHBondContact O-N 3.44Å; Q44-Y46 VanDerWaalsContact C-N 3.29Å; Q44-Y46 PolarHBondContact O-N 2.97Å; Y46-A49 PolarHBondContact O-N 2.9Å; Y46-L50 HydrophobicContact CD1-CD1 3.89Å; Y46-L50 HydrophobicContact CE1-CD1 3.36Å; Y46-L50 HydrophobicContact CE1-CG 4.19Å; Y46-L50 HydrophobicContact CE2-CD1 4.4Å; Y46-L50 HydrophobicContact CE2-CG 4.41Å; Y46-L50 WeakPolarHBondContact O-CG 3.31Å; Y46-L50 PolarHBondContact O-N 2.88Å
47	V	98	Very high	97.4	Very high	49 Å²	49	107.1 Å²	107.1	30%	0.297	52%	0.519	S	S	.	.	H	α-helix	trans	-63.5	-47.1	176.9	172.9	0	0	0	0	110.7	K43 Q44 A49 L50 E51	K43-V47 WeakPolarHBondContact O-CG2 3.48Å; K43-V47 PolarHBondContact O-N 2.93Å; Q44-V47 PolarHBondContact O-N 3.31Å; Q44-V47 VanDerWaalsContact O-N 3.16Å; V47-A49 VanDerWaalsContact C-N 3.29Å; V47-A49 PolarHBondContact O-N 3.33Å; V47-L50 WeakPolarHBondContact O-CB 3.41Å; V47-L50 PolarHBondContact O-N 3.49Å; V47-L50 VanDerWaalsContact O-N 3.08Å; V47-E51 HydrophobicContact CG1-CG 4.41Å; V47-E51 WeakPolarHBondContact O-CG 3.34Å; V47-E51 PolarHBondContact O-N 2.84Å
48	E	97.6	Very high	97.2	Very high	101 Å²	101	103.7 Å²	103.7	47%	0.472	51%	0.511	S	S	.	.	H	α-helix	trans	-58.5	-40.4	176.3	-73.7	170.8	-171	0	0	112.1	Q44 E51 K52	Q44-E48 VanDerWaalsContact CG-OE1 3.29Å; Q44-E48 WeakPolarHBondContact CG-OE1 3.43Å; Q44-E48 PolarHBondContact NE2-OE1 3.32Å; Q44-E48 WeakPolarHBondContact O-CG 3.31Å; Q44-E48 PolarHBondContact O-N 2.92Å; E48-E51 PolarHBondContact O-N 3.16Å; E48-K52 WeakPolarHBondContact O-CB 3.48Å; E48-K52 PolarHBondContact O-N 3.08Å
49	A	97.7	Very high	97	Very high	46 Å²	46	105.1 Å²	105.1	38%	0.38	52%	0.521	S	S	.	.	H	α-helix	trans	-64.8	-39.6	175.5	0	0	0	0	0	112.3	A45 Y46 V47 K52 K53	A45-A49 WeakPolarHBondContact O-CB 3.26Å; A45-A49 PolarHBondContact O-N 3.07Å; Y46-A49 PolarHBondContact O-N 2.9Å; V47-A49 VanDerWaalsContact C-N 3.29Å; V47-A49 PolarHBondContact O-N 3.33Å; A49-K52 PolarHBondContact O-N 3.36Å; A49-K53 WeakPolarHBondContact O-CG 3.29Å; A49-K53 PolarHBondContact O-N 3.45Å; A49-K53 VanDerWaalsContact O-N 3.07Å
50	L	97.6	Very high	96.8	Very high	71 Å²	71	107.4 Å²	107.4	37%	0.372	53%	0.525	S	S	.	.	H	α-helix	trans	-65.7	-46.4	174.9	-73.6	173.3	0	0	0	111.7	Y46 V47 K52 K53 V54	Y46-L50 HydrophobicContact CD1-CD1 3.89Å; Y46-L50 HydrophobicContact CE1-CD1 3.36Å; Y46-L50 HydrophobicContact CE1-CG 4.19Å; Y46-L50 HydrophobicContact CE2-CD1 4.4Å; Y46-L50 HydrophobicContact CE2-CG 4.41Å; Y46-L50 WeakPolarHBondContact O-CG 3.31Å; Y46-L50 PolarHBondContact O-N 2.88Å; V47-L50 WeakPolarHBondContact O-CB 3.41Å; V47-L50 PolarHBondContact O-N 3.49Å; V47-L50 VanDerWaalsContact O-N 3.08Å; L50-K52 VanDerWaalsContact C-N 3.27Å; L50-K52 PolarHBondContact O-N 3.01Å; L50-K53 PolarHBondContact O-N 3.43Å; L50-K53 VanDerWaalsContact O-N 3.11Å; L50-V54 WeakPolarHBondContact O-CG2 3.37Å; L50-V54 PolarHBondContact O-N 3.06Å
51	E	97.4	Very high	96.4	Very high	100 Å²	100	101.5 Å²	101.5	47%	0.467	51%	0.509	S	S	.	.	H	α-helix	trans	-58.1	-41.2	176.6	-72.1	178.8	-174.8	0	0	111.5	V47 E48 V54 K55	V47-E51 HydrophobicContact CG1-CG 4.41Å; V47-E51 WeakPolarHBondContact O-CG 3.34Å; V47-E51 PolarHBondContact O-N 2.84Å; E48-E51 PolarHBondContact O-N 3.16Å; E51-V54 PolarHBondContact O-N 3.47Å; E51-K55 WeakPolarHBondContact O-CB 3.34Å; E51-K55 VanDerWaalsContact O-CG 3.29Å; E51-K55 WeakPolarHBondContact O-CG 3.44Å; E51-K55 PolarHBondContact O-N 2.89Å
52	K	97.2	Very high	96.2	Very high	147 Å²	147	100.1 Å²	100.1	64%	0.639	51%	0.505	S	S	*	.	H	α-helix	trans	-62.3	-45	175	-172.8	175.6	-180	179.2	0	111.7	E48 A49 L50 K55 C56	E48-K52 WeakPolarHBondContact O-CB 3.48Å; E48-K52 PolarHBondContact O-N 3.08Å; A49-K52 PolarHBondContact O-N 3.36Å; L50-K52 VanDerWaalsContact C-N 3.27Å; L50-K52 PolarHBondContact O-N 3.01Å; K52-K55 PolarHBondContact O-N 2.98Å; K52-C56 PolarHBondContact O-N 3.38Å; K52-C56 PolarHBondContact O-SG 3.27Å; K52-C56 VanDerWaalsContact O-SG 3.33Å
53	K	97.1	Very high	95.8	Very high	150 Å²	150	96 Å²	96	65%	0.652	50%	0.497	S	S	*	.	H	α-helix	trans	-61.5	-44.2	177.2	-74.3	178.7	-179.5	-175.6	0	112.2	A49 L50 C56 C57	A49-K53 WeakPolarHBondContact O-CG 3.29Å; A49-K53 PolarHBondContact O-N 3.45Å; A49-K53 VanDerWaalsContact O-N 3.07Å; L50-K53 PolarHBondContact O-N 3.43Å; L50-K53 VanDerWaalsContact O-N 3.11Å; K53-C56 PolarHBondContact O-N 2.89Å; K53-C57 WeakPolarHBondContact O-CB 3.34Å; K53-C57 PolarHBondContact O-N 3.26Å
54	V	96.6	Very high	95.3	Very high	100 Å²	100	95.1 Å²	95.1	61%	0.606	49%	0.49	S	S	*	.	H	α-helix	trans	-62.7	-44.2	177.6	173	0	0	0	0	110.7	L50 E51 C56 C57 A58	L50-V54 WeakPolarHBondContact O-CG2 3.37Å; L50-V54 PolarHBondContact O-N 3.06Å; E51-V54 PolarHBondContact O-N 3.47Å; V54-C56 PolarHBondContact O-N 3Å; V54-C57 PolarHBondContact O-N 2.93Å; V54-A58 WeakPolarHBondContact O-CB 3.41Å; V54-A58 PolarHBondContact O-N 3.33Å
55	K	96.2	Very high	94.7	Very high	136 Å²	136	95 Å²	95	59%	0.591	49%	0.49	S	S	*	.	H	α-helix	trans	-60	-45.5	175.6	-73.6	172.4	-177	174.5	0	112	E51 K52 A58 L59	E51-K55 WeakPolarHBondContact O-CB 3.34Å; E51-K55 VanDerWaalsContact O-CG 3.29Å; E51-K55 WeakPolarHBondContact O-CG 3.44Å; E51-K55 PolarHBondContact O-N 2.89Å; K52-K55 PolarHBondContact O-N 2.98Å; K55-A58 PolarHBondContact O-N 2.98Å; K55-L59 WeakPolarHBondContact O-CG 3.42Å; K55-L59 PolarHBondContact O-N 3.22Å
56	C	95.2	Very high	94.1	Very high	70 Å²	70	97.3 Å²	97.3	47%	0.473	50%	0.495	S	S	.	.	H	α-helix	trans	-60.4	-47.1	176.1	-70.9	0	0	0	0	111.8	K52 K53 V54 A58 L59 E60	K52-C56 PolarHBondContact O-N 3.38Å; K52-C56 PolarHBondContact O-SG 3.27Å; K52-C56 VanDerWaalsContact O-SG 3.33Å; K53-C56 PolarHBondContact O-N 2.89Å; V54-C56 PolarHBondContact O-N 3Å; C56-A58 VanDerWaalsContact C-N 3.34Å; C56-A58 PolarHBondContact O-N 3.46Å; C56-L59 PolarHBondContact O-N 3.04Å; C56-E60 WeakPolarHBondContact O-CB 3.45Å; C56-E60 PolarHBondContact O-N 3.01Å
57	C	93.8	Very high	93.3	Very high	74 Å²	74	98.4 Å²	98.4	50%	0.5	50%	0.497	S	S	.	.	H	α-helix	trans	-63	-39.6	178.4	-174.7	0	0	0	0	112.2	K53 V54 E60 T61	K53-C57 WeakPolarHBondContact O-CB 3.34Å; K53-C57 PolarHBondContact O-N 3.26Å; V54-C57 PolarHBondContact O-N 2.93Å; C57-E60 PolarHBondContact O-N 3.37Å; C57-T61 VanDerWaalsContact O-CB 3.31Å; C57-T61 WeakPolarHBondContact O-CB 3.45Å; C57-T61 PolarHBondContact O-N 3.43Å; C57-T61 PolarHBondContact O-OG1 3.13Å
58	A	94.4	Very high	92.4	Very high	48 Å²	48	101.8 Å²	101.8	40%	0.397	52%	0.518	S	S	.	.	H	α-helix	trans	-65	-44.1	177	0	0	0	0	0	111.9	V54 K55 C56 T61 Q62	V54-A58 WeakPolarHBondContact O-CB 3.41Å; V54-A58 PolarHBondContact O-N 3.33Å; K55-A58 PolarHBondContact O-N 2.98Å; C56-A58 VanDerWaalsContact C-N 3.34Å; C56-A58 PolarHBondContact O-N 3.46Å; A58-T61 PolarHBondContact O-N 2.94Å; A58-Q62 WeakPolarHBondContact O-CG 3.4Å; A58-Q62 PolarHBondContact O-N 3.18Å
59	L	94.5	Very high	91.3	Very high	112 Å²	112	104.4 Å²	104.4	59%	0.586	53%	0.528	S	S	*	.	H	α-helix	trans	-61.4	-47.6	174.8	-72.4	171.5	0	0	0	111.2	K55 C56 T61 Q62 T63	K55-L59 WeakPolarHBondContact O-CG 3.42Å; K55-L59 PolarHBondContact O-N 3.22Å; C56-L59 PolarHBondContact O-N 3.04Å; L59-T61 VanDerWaalsContact C-N 3.34Å; L59-T61 PolarHBondContact O-N 3.42Å; L59-Q62 WeakPolarHBondContact O-CB 3.29Å; L59-Q62 PolarHBondContact O-N 3.16Å; L59-T63 WeakPolarHBondContact O-CG2 3.43Å; L59-T63 PolarHBondContact O-N 3.48Å
60	E	93.3	Very high	89.6	Confident	110 Å²	110	107 Å²	107	51%	0.514	53%	0.533	S	S	.	.	H	α-helix	trans	-60	-46.4	178	-175.9	173.3	-172.9	0	0	111	C56 C57 Q62 T63 W64	C56-E60 WeakPolarHBondContact O-CB 3.45Å; C56-E60 PolarHBondContact O-N 3.01Å; C57-E60 PolarHBondContact O-N 3.37Å; E60-Q62 VanDerWaalsContact C-N 3.3Å; E60-Q62 PolarHBondContact O-N 2.94Å; E60-T63 PolarHBondContact O-N 3.29Å; E60-T63 PolarHBondContact O-OG1 2.84Å; E60-W64 VanDerWaalsContact CG-NE1 3.34Å; E60-W64 PolarHBondContact O-N 3.35Å; E60-W64 PolarHBondContact OE1-NE1 3.31Å
61	T	91.4	Very high	87.9	Confident	61 Å²	61	107.3 Å²	107.3	37%	0.374	54%	0.54	S	S	.	.	H	α-helix	trans	-57.2	-43.2	175.5	-59	0	0	0	0	111.5	C57 A58 L59 T63 W64 Q65	C57-T61 VanDerWaalsContact O-CB 3.31Å; C57-T61 WeakPolarHBondContact O-CB 3.45Å; C57-T61 PolarHBondContact O-N 3.43Å; C57-T61 PolarHBondContact O-OG1 3.13Å; A58-T61 PolarHBondContact O-N 2.94Å; L59-T61 VanDerWaalsContact C-N 3.34Å; L59-T61 PolarHBondContact O-N 3.42Å; T61-T63 PolarHBondContact O-N 3.48Å; T61-W64 PolarHBondContact O-N 2.93Å; T61-Q65 HydrophobicContact CG2-CG 4.34Å; T61-Q65 WeakPolarHBondContact O-CB 3.43Å; T61-Q65 VanDerWaalsContact O-CG 3.26Å; T61-Q65 WeakPolarHBondContact O-CG 3.41Å; T61-Q65 PolarHBondContact O-N 3.03Å
62	Q	92.1	Very high	86.1	Confident	109 Å²	109	113.3 Å²	113.3	51%	0.509	56%	0.558	S	S	.	*	H	α-helix	trans	-62.9	-41.6	175.2	-76	-176.6	3.3	0	0	112.2	A58 L59 E60 W64 Q65 N66	A58-Q62 WeakPolarHBondContact O-CG 3.4Å; A58-Q62 PolarHBondContact O-N 3.18Å; L59-Q62 WeakPolarHBondContact O-CB 3.29Å; L59-Q62 PolarHBondContact O-N 3.16Å; E60-Q62 VanDerWaalsContact C-N 3.3Å; E60-Q62 PolarHBondContact O-N 2.94Å; Q62-W64 PolarHBondContact O-N 3.4Å; Q62-Q65 PolarHBondContact O-N 3.25Å; Q62-N66 WeakPolarHBondContact O-CB 3.37Å; Q62-N66 PolarHBondContact O-N 3.15Å; Q62-N66 PolarHBondContact O-ND2 3.32Å
63	T	90.7	Very high	84.1	Confident	71 Å²	71	109.6 Å²	109.6	44%	0.436	55%	0.551	S	S	.	*	H	α-helix	trans	-63.1	-42	177	64	0	0	0	0	111.9	L59 E60 T61 N66 R67	L59-T63 WeakPolarHBondContact O-CG2 3.43Å; L59-T63 PolarHBondContact O-N 3.48Å; E60-T63 PolarHBondContact O-N 3.29Å; E60-T63 PolarHBondContact O-OG1 2.84Å; T61-T63 PolarHBondContact O-N 3.48Å; T63-N66 PolarHBondContact O-N 3.09Å; T63-R67 WeakPolarHBondContact O-CG 3.36Å; T63-R67 PolarHBondContact O-N 2.91Å
64	W	86	Confident	82.2	Confident	136 Å²	136	109.6 Å²	109.6	52%	0.515	55%	0.551	S	S	.	*	H	α-helix	trans	-65	-44.7	174.7	-71.4	117.8	0	0	0	111.6	E60 T61 Q62 N66 R67 V68	E60-W64 VanDerWaalsContact CG-NE1 3.34Å; E60-W64 PolarHBondContact O-N 3.35Å; E60-W64 PolarHBondContact OE1-NE1 3.31Å; T61-W64 PolarHBondContact O-N 2.93Å; Q62-W64 PolarHBondContact O-N 3.4Å; W64-N66 VanDerWaalsContact C-N 3.3Å; W64-N66 PolarHBondContact O-N 3.2Å; W64-R67 WeakPolarHBondContact O-CB 3.38Å; W64-R67 PolarHBondContact O-N 2.91Å; W64-R67 VanDerWaalsContact O-N 3.11Å; W64-V68 WeakPolarHBondContact O-CG2 3.48Å; W64-V68 PolarHBondContact O-N 3.11Å
65	Q	86.9	Confident	80.6	Confident	98 Å²	98	107.8 Å²	107.8	46%	0.458	54%	0.54	S	S	.	.	H	α-helix	trans	-58.9	-41	175.4	-76.9	-179.4	-0.3	0	0	111.9	T61 Q62 R67 V68 K69	T61-Q65 HydrophobicContact CG2-CG 4.34Å; T61-Q65 WeakPolarHBondContact O-CB 3.43Å; T61-Q65 VanDerWaalsContact O-CG 3.26Å; T61-Q65 WeakPolarHBondContact O-CG 3.41Å; T61-Q65 PolarHBondContact O-N 3.03Å; Q62-Q65 PolarHBondContact O-N 3.25Å; Q65-R67 VanDerWaalsContact C-N 3.34Å; Q65-V68 PolarHBondContact O-N 3.1Å; Q65-K69 VanDerWaalsContact O-CB 3.25Å; Q65-K69 WeakPolarHBondContact O-CB 3.39Å; Q65-K69 VanDerWaalsContact O-CG 3.31Å; Q65-K69 WeakPolarHBondContact O-CG 3.46Å; Q65-K69 PolarHBondContact O-N 3.23Å
66	N	85.3	Confident	79.3	Confident	103 Å²	103	105.2 Å²	105.2	55%	0.551	54%	0.537	S	S	*	.	H	α-helix	trans	-66.3	-36.6	176.4	-70.9	-17.7	0	0	0	112	Q62 T63 W64 M70	Q62-N66 WeakPolarHBondContact O-CB 3.37Å; Q62-N66 PolarHBondContact O-N 3.15Å; Q62-N66 PolarHBondContact O-ND2 3.32Å; T63-N66 PolarHBondContact O-N 3.09Å; W64-N66 VanDerWaalsContact C-N 3.3Å; W64-N66 PolarHBondContact O-N 3.2Å; N66-M70 PolarHBondContact O-N 3.45Å; N66-M70 VanDerWaalsContact O-N 3.13Å
67	R	80.4	Confident	78.2	Confident	174 Å²	174	110.5 Å²	110.5	66%	0.657	55%	0.548	S	S	*	.	H	α-helix	trans	-67.3	-36.4	173.6	-70.6	177.2	-172.2	-141.1	3.9	112.6	T63 W64 Q65 M70	T63-R67 WeakPolarHBondContact O-CG 3.36Å; T63-R67 PolarHBondContact O-N 2.91Å; W64-R67 WeakPolarHBondContact O-CB 3.38Å; W64-R67 PolarHBondContact O-N 2.91Å; W64-R67 VanDerWaalsContact O-N 3.11Å; Q65-R67 VanDerWaalsContact C-N 3.34Å; R67-M70 WeakPolarHBondContact O-CB 3.29Å
68	V	79.4	Confident	77.3	Confident	120 Å²	120	110.4 Å²	110.4	73%	0.727	55%	0.545	S	S	*	.	H	α-helix	trans	-76.9	-36.1	177.5	174.6	0	0	0	0	111.5	W64 Q65 M70	W64-V68 WeakPolarHBondContact O-CG2 3.48Å; W64-V68 PolarHBondContact O-N 3.11Å; Q65-V68 PolarHBondContact O-N 3.1Å; V68-M70 PolarHBondContact O-N 3.28Å
69	K	73.5	Confident	76.5	Confident	157 Å²	157	112 Å²	112	68%	0.683	55%	0.547	S	S	*	.	H	α-helix	trans	-71.2	-16.8	175.8	-79.2	-178.1	178.3	179.7	0	113.4	Q65 P71	Q65-K69 VanDerWaalsContact O-CB 3.25Å; Q65-K69 WeakPolarHBondContact O-CB 3.39Å; Q65-K69 VanDerWaalsContact O-CG 3.31Å; Q65-K69 WeakPolarHBondContact O-CG 3.46Å; Q65-K69 PolarHBondContact O-N 3.23Å; K69-P71 VanDerWaalsContact O-CD 3.25Å; K69-P71 WeakPolarHBondContact O-CD 3.42Å
70	M	63.1	Low	75.9	Confident	99 Å²	99	112.7 Å²	112.7	49%	0.488	55%	0.551	S	S	.	*	S	Bend	trans	-54.9	114	165.8	-83.7	-76.6	-126.2	0	0	107.8	N66 R67 V68	N66-M70 PolarHBondContact O-N 3.45Å; N66-M70 VanDerWaalsContact O-N 3.13Å; R67-M70 WeakPolarHBondContact O-CB 3.29Å; V68-M70 PolarHBondContact O-N 3.28Å
71	P	61.8	Low	75.3	Confident	79 Å²	79	112.8 Å²	112.8	51%	0.513	55%	0.554	S	S	.	*			trans	-62.9	150.5	-173.9	-5.5	15.5	0	0	0	108.8	K69 S73	K69-P71 VanDerWaalsContact O-CD 3.25Å; K69-P71 WeakPolarHBondContact O-CD 3.42Å; P71-S73 WeakPolarHBondContact CB-OG 3.39Å; P71-S73 PolarHBondContact O-N 3.43Å; P71-S73 PolarHBondContact O-OG 3.46Å
72	R	59.4	Low	74.9	Confident	225 Å²	225	114.8 Å²	114.8	85%	0.849	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-56.1	-0.1	166.3	-64.4	-163.1	-64.7	-130.2	1.3	113.2	K74 T75	R72-K74 PolarHBondContact O-N 3.26Å; R72-T75 PolarHBondContact O-N 3.02Å; R72-T75 PolarHBondContact O-OG1 2.92Å
73	S	55.9	Low	74.6	Confident	69 Å²	69	117 Å²	117	48%	0.483	57%	0.57	S	S	.	*	G	3₁₀ helix	trans	-55	-16.8	173.4	63.3	0	0	0	0	114.4	P71 T75	P71-S73 WeakPolarHBondContact CB-OG 3.39Å; P71-S73 PolarHBondContact O-N 3.43Å; P71-S73 PolarHBondContact O-OG 3.46Å; S73-T75 PolarHBondContact O-N 2.9Å
74	K	56.3	Low	74.3	Confident	151 Å²	151	121.8 Å²	121.8	66%	0.657	58%	0.58	S	S	*	*	G	3₁₀ helix	trans	-72.1	0.8	170.7	-67.9	-162	174.8	-165.9	0	115.4	R72 P76	R72-K74 PolarHBondContact O-N 3.26Å; K74-P76 WeakPolarHBondContact O-CD 3.49Å
75	T	63.9	Low	74	Confident	61 Å²	61	124 Å²	124	37%	0.374	59%	0.59	S	S	.	*			trans	-101.6	77.8	164	57.6	0	0	0	0	109.5	R72 S73 Y77 V78 N79	R72-T75 PolarHBondContact O-N 3.02Å; R72-T75 PolarHBondContact O-OG1 2.92Å; S73-T75 PolarHBondContact O-N 2.9Å; T75-Y77 PolarHBondContact O-N 3Å; T75-Y77 VanDerWaalsContact O-N 3.16Å; T75-V78 HydrophobicContact CG2-CG2 4.17Å; T75-V78 PolarHBondContact O-N 3.48Å; T75-V78 WeakPolarHBondContact OG1-CB 3.48Å; T75-N79 PolarHBondContact O-N 2.76Å; T75-N79 VanDerWaalsContact O-N 3.13Å
76	P	69	Low	73.9	Confident	82 Å²	82	122.5 Å²	122.5	53%	0.532	59%	0.59	S	S	.	*	H	α-helix	trans	-54.7	-35.8	177.6	22.3	-32.1	0	0	0	110.5	K74 V78 N79 L80	K74-P76 WeakPolarHBondContact O-CD 3.49Å; P76-V78 PolarHBondContact O-N 2.71Å; P76-N79 PolarHBondContact O-N 3.31Å; P76-L80 WeakPolarHBondContact O-CB 3.44Å; P76-L80 PolarHBondContact O-N 3.44Å
77	Y	71.8	Confident	73.8	Confident	181 Å²	181	123.6 Å²	123.6	71%	0.71	59%	0.591	S	S	*	*	H	α-helix	trans	-59.2	-44.2	174.6	-65.3	-76.1	0	0	0	114.1	T75 L80 L81	T75-Y77 PolarHBondContact O-N 3Å; T75-Y77 VanDerWaalsContact O-N 3.16Å; Y77-L80 PolarHBondContact O-N 3.28Å; Y77-L81 VanDerWaalsContact O-CB 3.3Å; Y77-L81 WeakPolarHBondContact O-CB 3.41Å; Y77-L81 WeakPolarHBondContact O-CD1 3.44Å; Y77-L81 WeakPolarHBondContact O-CG 3.41Å; Y77-L81 PolarHBondContact O-N 3.22Å
78	V	73.9	Confident	73.5	Confident	73 Å²	73	121.6 Å²	121.6	44%	0.442	59%	0.587	S	S	.	*	H	α-helix	trans	-74.9	-36.3	-177.1	-174	0	0	0	0	110.7	T75 P76 L81 L82	T75-V78 HydrophobicContact CG2-CG2 4.17Å; T75-V78 PolarHBondContact O-N 3.48Å; T75-V78 WeakPolarHBondContact OG1-CB 3.48Å; P76-V78 PolarHBondContact O-N 2.71Å; V78-L81 PolarHBondContact O-N 3.12Å; V78-L82 HydrophobicContact CG1-CD1 4.35Å; V78-L82 WeakPolarHBondContact O-CB 3.49Å; V78-L82 WeakPolarHBondContact O-CG 3.42Å; V78-L82 PolarHBondContact O-N 3.32Å
79	N	77.4	Confident	73.4	Confident	82 Å²	82	126 Å²	126	44%	0.439	59%	0.59	S	S	.	*	H	α-helix	trans	-65.8	-41.1	172	-79.3	-32	0	0	0	111.7	T75 P76 L82 F83	T75-N79 PolarHBondContact O-N 2.76Å; T75-N79 VanDerWaalsContact O-N 3.13Å; P76-N79 PolarHBondContact O-N 3.31Å; N79-L82 PolarHBondContact O-N 2.91Å; N79-F83 WeakPolarHBondContact O-CB 3.41Å; N79-F83 PolarHBondContact O-N 3.43Å
80	L	81.9	Confident	72.7	Confident	125 Å²	125	129.9 Å²	129.9	65%	0.654	60%	0.601	S	S	*	*	H	α-helix	trans	-65.4	-41.4	176.2	-159.6	80.7	0	0	0	111.4	P76 Y77 F83 R84	P76-L80 WeakPolarHBondContact O-CB 3.44Å; P76-L80 PolarHBondContact O-N 3.44Å; Y77-L80 PolarHBondContact O-N 3.28Å; L80-F83 PolarHBondContact O-N 2.88Å; L80-R84 WeakPolarHBondContact O-CB 3.48Å; L80-R84 PolarHBondContact O-N 3.39Å
81	L	81.9	Confident	72.4	Confident	112 Å²	112	135 Å²	135	59%	0.586	62%	0.624	S	S	*	*	H	α-helix	trans	-63.3	-47.4	174.8	-86.1	159.3	0	0	0	111.6	Y77 V78 F83 R84 Y85	Y77-L81 VanDerWaalsContact O-CB 3.3Å; Y77-L81 WeakPolarHBondContact O-CB 3.41Å; Y77-L81 WeakPolarHBondContact O-CD1 3.44Å; Y77-L81 WeakPolarHBondContact O-CG 3.41Å; Y77-L81 PolarHBondContact O-N 3.22Å; V78-L81 PolarHBondContact O-N 3.12Å; L81-F83 VanDerWaalsContact C-N 3.34Å; L81-F83 PolarHBondContact O-N 3.38Å; L81-R84 PolarHBondContact O-N 2.99Å; L81-Y85 WeakPolarHBondContact O-CB 3.35Å; L81-Y85 PolarHBondContact O-N 2.91Å
82	L	82.5	Confident	72.9	Confident	103 Å²	103	137.8 Å²	137.8	54%	0.539	63%	0.629	S	S	.	*	H	α-helix	trans	-60.3	-43.7	175.8	-84.7	165	0	0	0	111.6	V78 N79 R84 Y85 S86	V78-L82 HydrophobicContact CG1-CD1 4.35Å; V78-L82 WeakPolarHBondContact O-CB 3.49Å; V78-L82 WeakPolarHBondContact O-CG 3.42Å; V78-L82 PolarHBondContact O-N 3.32Å; N79-L82 PolarHBondContact O-N 2.91Å; L82-R84 VanDerWaalsContact C-N 3.34Å; L82-R84 PolarHBondContact O-N 3.33Å; L82-Y85 PolarHBondContact O-N 3Å; L82-S86 WeakPolarHBondContact O-CB 3.41Å; L82-S86 PolarHBondContact O-N 3.01Å; L82-S86 PolarHBondContact O-OG 3.46Å
83	F	85	Confident	73.6	Confident	156 Å²	156	133.2 Å²	133.2	68%	0.684	62%	0.617	S	S	*	*	H	α-helix	trans	-61.4	-44.6	176.9	-165	-96.7	0	0	0	111.2	N79 L80 L81 S86 F87	N79-F83 WeakPolarHBondContact O-CB 3.41Å; N79-F83 PolarHBondContact O-N 3.43Å; L80-F83 PolarHBondContact O-N 2.88Å; L81-F83 VanDerWaalsContact C-N 3.34Å; L81-F83 PolarHBondContact O-N 3.38Å; F83-S86 PolarHBondContact O-N 3.47Å; F83-F87 WeakPolarHBondContact O-CB 3.46Å; F83-F87 PolarHBondContact O-N 3.1Å
84	R	85.2	Confident	74.6	Confident	172 Å²	172	136.8 Å²	136.8	65%	0.649	63%	0.625	S	S	*	*	H	α-helix	trans	-66.9	-41.2	178.1	-169.8	147.1	170.7	162.6	-6	112.7	L80 L81 L82 S86 F87 F88	L80-R84 WeakPolarHBondContact O-CB 3.48Å; L80-R84 PolarHBondContact O-N 3.39Å; L81-R84 PolarHBondContact O-N 2.99Å; L82-R84 VanDerWaalsContact C-N 3.34Å; L82-R84 PolarHBondContact O-N 3.33Å; R84-S86 VanDerWaalsContact C-N 3.3Å; R84-S86 PolarHBondContact O-N 3.45Å; R84-F87 PolarHBondContact O-N 2.93Å; R84-F88 HydrophobicContact CG-CD2 3.99Å; R84-F88 HydrophobicContact CG-CE2 4.17Å; R84-F88 WeakPolarHBondContact O-CD2 3.28Å; R84-F88 PolarHBondContact O-N 2.84Å
85	Y	79.5	Confident	75.7	Confident	181 Å²	181	135.9 Å²	135.9	71%	0.71	62%	0.623	S	S	*	*	H	α-helix	trans	-62.5	-38.4	174.5	-123.8	-87.6	0	0	0	112	L81 L82 R89	L81-Y85 WeakPolarHBondContact O-CB 3.35Å; L81-Y85 PolarHBondContact O-N 2.91Å; L82-Y85 PolarHBondContact O-N 3Å; Y85-R89 WeakPolarHBondContact O-CB 3.49Å; Y85-R89 PolarHBondContact O-N 3.27Å
86	S	84.8	Confident	76.4	Confident	67 Å²	67	140.6 Å²	140.6	47%	0.469	64%	0.639	S	S	.	*	H	α-helix	trans	-70.5	-40	179.1	-52.8	0	0	0	0	111.5	L82 F83 R84 R89	L82-S86 WeakPolarHBondContact O-CB 3.41Å; L82-S86 PolarHBondContact O-N 3.01Å; L82-S86 PolarHBondContact O-OG 3.46Å; F83-S86 PolarHBondContact O-N 3.47Å; R84-S86 VanDerWaalsContact C-N 3.3Å; R84-S86 PolarHBondContact O-N 3.45Å; S86-R89 PolarHBondContact O-N 3.36Å
87	F	83.1	Confident	76.9	Confident	127 Å²	127	144.5 Å²	144.5	56%	0.557	65%	0.646	S	S	*	*	H	α-helix	trans	-64.6	-46.5	176.7	-175	-97.4	0	0	0	112	F83 R84 R89 W90	F83-F87 WeakPolarHBondContact O-CB 3.46Å; F83-F87 PolarHBondContact O-N 3.1Å; R84-F87 PolarHBondContact O-N 2.93Å; F87-R89 PolarHBondContact O-N 3.14Å; F87-W90 PolarHBondContact O-N 3.12Å
88	F	75.2	Confident	77.3	Confident	131 Å²	131	141.9 Å²	141.9	58%	0.575	64%	0.641	S	S	*	*	H	α-helix	trans	-69.4	-17.6	178.6	-93.1	-85.5	0	0	0	114.4	R84	R84-F88 HydrophobicContact CG-CD2 3.99Å; R84-F88 HydrophobicContact CG-CE2 4.17Å; R84-F88 WeakPolarHBondContact O-CD2 3.28Å; R84-F88 PolarHBondContact O-N 2.84Å
89	R	75.8	Confident	77.6	Confident	214 Å²	214	147.2 Å²	147.2	81%	0.808	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.7	-14.7	176.8	-165	177.1	-167.7	-164.7	3.3	113.1	Y85 S86 F87	Y85-R89 WeakPolarHBondContact O-CB 3.49Å; Y85-R89 PolarHBondContact O-N 3.27Å; S86-R89 PolarHBondContact O-N 3.36Å; F87-R89 PolarHBondContact O-N 3.14Å
90	W	59.2	Low	77.6	Confident	237 Å²	237	152.7 Å²	152.7	90%	0.898	68%	0.675	S	S	*	*			trans	-108.9	10.4	-178.3	-86.4	90.1	0	0	0	113.4	F87	F87-W90 PolarHBondContact O-N 3.12Å
91	Q	56.9	Low	77.2	Confident	207 Å²	207	155.2 Å²	155.2	97%	0.967	68%	0.676	S	S	*	*			trans	-107.4	0	160.4	-85.1	-150.1	-59.9	0	0	109.5

Retrieved 91 of 91 residues in 122.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).