A0A077ZC58_TRITR Loading...

SNARE domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZC58, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 107 aa.

						>A0A077ZC58_TRITR|A0A077ZC58
MVGGSSSSAAGMSKQHYLESDNDQMVDNLKHKVTTLKSLTIDIGDEVRRQNKELGGLEDHFESGRNVLEATMRRLGLISRSGSARFTLYLILFSFMVFVMMYYMLRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.7	Very low	62.5	Low	241 Å²	241	95.4 Å²	95.4	100%	1.187	67%	0.673	S	S	*	*				0	136	0	-76.1	171.5	157.5	0	0	107.2
2	V	52.9	Low	63.6	Low	158 Å²	158	99.5 Å²	99.5	96%	0.958	68%	0.676	S	S	*	*			trans	81.1	108.7	-176.1	-166.1	0	0	0	0	114.4
3	G	54.3	Low	64.9	Low	72 Å²	72	98.2 Å²	98.2	74%	0.742	67%	0.669	S	S	*	*			trans	172.7	-3.6	177.2	0	0	0	0	0	117
4	G	59.7	Low	66.2	Low	57 Å²	57	101.6 Å²	101.6	59%	0.588	67%	0.666	S	S	*	*			trans	-111.1	7.4	-169.5	0	0	0	0	0	117.6
5	S	60.2	Low	67.2	Low	100 Å²	100	103.6 Å²	103.6	70%	0.699	66%	0.663	S	S	*	*	S	Bend	trans	-98.7	-14	-168.8	-51	0	0	0	0	115.2	S8	S5-S8 PolarHBondContact O-OG 3.16Å; S5-S8 VanDerWaalsContact O-OG 3.14Å
6	S	61.7	Low	68.1	Low	95 Å²	95	105.5 Å²	105.5	66%	0.664	66%	0.66	S	S	*	*	H	α-helix	trans	-85.4	-27	-176.8	37.1	0	0	0	0	113.5	A10	S6-A10 PolarHBondContact O-N 3.43Å
7	S	65.8	Low	69	Low	89 Å²	89	108.9 Å²	108.9	62%	0.622	66%	0.659	S	S	*	*	H	α-helix	trans	-72.4	-33	178.9	53.2	0	0	0	0	113.1	G11	S7-G11 PolarHBondContact O-N 3.24Å; S7-G11 VanDerWaalsContact O-N 3.16Å
8	S	69	Low	69.9	Low	77 Å²	77	108.2 Å²	108.2	54%	0.538	65%	0.65	S	S	.	*	H	α-helix	trans	-71.1	-39.6	178.7	52.9	0	0	0	0	112.6	S5 G11 M12	S5-S8 PolarHBondContact O-OG 3.16Å; S5-S8 VanDerWaalsContact O-OG 3.14Å; S8-G11 PolarHBondContact O-N 3.14Å; S8-M12 PolarHBondContact O-N 3.44Å
9	A	71.2	Confident	70.7	Confident	57 Å²	57	108.5 Å²	108.5	47%	0.471	64%	0.644	S	S	.	*	H	α-helix	trans	-65.8	-44.8	177.9	0	0	0	0	0	112.1	G11 M12 S13	A9-G11 VanDerWaalsContact C-N 3.33Å; A9-G11 PolarHBondContact O-N 3.01Å; A9-M12 PolarHBondContact O-N 3.42Å; A9-S13 PolarHBondContact O-N 3.08Å; A9-S13 PolarHBondContact O-OG 3.36Å
10	A	73.2	Confident	71.4	Confident	63 Å²	63	105.5 Å²	105.5	52%	0.521	63%	0.629	S	S	.	*	H	α-helix	trans	-64.2	-37.2	176.7	0	0	0	0	0	112.4	S6 K14	S6-A10 PolarHBondContact O-N 3.43Å; A10-K14 WeakPolarHBondContact O-CB 3.43Å; A10-K14 PolarHBondContact O-N 3.05Å; A10-K14 VanDerWaalsContact O-N 3.08Å
11	G	75.8	Confident	72.1	Confident	40 Å²	40	103.3 Å²	103.3	41%	0.412	61%	0.614	S	S	.	*	H	α-helix	trans	-63.2	-41.8	173.4	0	0	0	0	0	112.8	S7 S8 A9 K14 Q15	S7-G11 PolarHBondContact O-N 3.24Å; S7-G11 VanDerWaalsContact O-N 3.16Å; S8-G11 PolarHBondContact O-N 3.14Å; A9-G11 VanDerWaalsContact C-N 3.33Å; A9-G11 PolarHBondContact O-N 3.01Å; G11-K14 PolarHBondContact O-N 2.96Å; G11-Q15 WeakPolarHBondContact O-CB 3.48Å; G11-Q15 PolarHBondContact O-N 3.49Å
12	M	76.2	Confident	74.3	Confident	145 Å²	145	96.4 Å²	96.4	71%	0.714	58%	0.582	S	S	*	*	H	α-helix	trans	-66.4	-42.7	178.6	-168.4	169.6	-169.8	0	0	112.3	S8 A9 Q15 H16	S8-M12 PolarHBondContact O-N 3.44Å; A9-M12 PolarHBondContact O-N 3.42Å; M12-Q15 PolarHBondContact O-N 2.93Å; M12-H16 WeakPolarHBondContact O-CB 3.35Å; M12-H16 PolarHBondContact O-N 3.16Å
13	S	80.4	Confident	76.1	Confident	82 Å²	82	93.7 Å²	93.7	57%	0.573	56%	0.562	S	S	*	*	H	α-helix	trans	-64.4	-40.3	175.4	-52.3	0	0	0	0	112.3	A9 H16 Y17	A9-S13 PolarHBondContact O-N 3.08Å; A9-S13 PolarHBondContact O-OG 3.36Å; S13-H16 PolarHBondContact O-N 3.38Å; S13-Y17 WeakPolarHBondContact O-CB 3.41Å; S13-Y17 PolarHBondContact O-N 2.9Å
14	K	82.4	Confident	77.8	Confident	146 Å²	146	95.8 Å²	95.8	64%	0.635	55%	0.553	S	S	*	*	H	α-helix	trans	-65.9	-42.4	176.2	-173	177	-179.6	-177.9	0	111.5	A10 G11 Y17 L18	A10-K14 WeakPolarHBondContact O-CB 3.43Å; A10-K14 PolarHBondContact O-N 3.05Å; A10-K14 VanDerWaalsContact O-N 3.08Å; G11-K14 PolarHBondContact O-N 2.96Å; K14-Y17 PolarHBondContact O-N 3.4Å; K14-L18 HydrophobicContact CG-CD1 4.09Å; K14-L18 WeakPolarHBondContact O-CB 3.48Å; K14-L18 VanDerWaalsContact O-CG 3.27Å; K14-L18 WeakPolarHBondContact O-CG 3.27Å; K14-L18 PolarHBondContact O-N 2.97Å
15	Q	81.9	Confident	79.1	Confident	132 Å²	132	97.9 Å²	97.9	62%	0.617	55%	0.549	S	S	*	.	H	α-helix	trans	-63.6	-44.3	177	-168.1	171.3	-85.3	0	0	111.2	G11 M12 Y17 L18 E19	G11-Q15 WeakPolarHBondContact O-CB 3.48Å; G11-Q15 PolarHBondContact O-N 3.49Å; M12-Q15 PolarHBondContact O-N 2.93Å; Q15-Y17 VanDerWaalsContact C-N 3.35Å; Q15-Y17 PolarHBondContact O-N 2.94Å; Q15-L18 PolarHBondContact O-N 3.28Å; Q15-E19 VanDerWaalsContact O-CB 3.28Å; Q15-E19 WeakPolarHBondContact O-CB 3.39Å; Q15-E19 PolarHBondContact O-N 3.5Å
16	H	81.7	Confident	80.6	Confident	134 Å²	134	95.7 Å²	95.7	62%	0.62	53%	0.531	S	S	*	.	H	α-helix	trans	-62.7	-38.8	175.8	-174.9	-80.4	0	0	0	112.7	M12 S13 E19 S20	M12-H16 WeakPolarHBondContact O-CB 3.35Å; M12-H16 PolarHBondContact O-N 3.16Å; S13-H16 PolarHBondContact O-N 3.38Å; H16-E19 PolarHBondContact O-N 2.92Å; H16-S20 WeakPolarHBondContact O-CB 3.38Å; H16-S20 PolarHBondContact O-N 3.49Å
17	Y	82.6	Confident	82	Confident	163 Å²	163	96.2 Å²	96.2	64%	0.639	53%	0.526	S	S	*	.	H	α-helix	trans	-65.4	-44.6	175.1	-173.8	-88	0	0	0	111.8	S13 K14 Q15 E19 S20 D21	S13-Y17 WeakPolarHBondContact O-CB 3.41Å; S13-Y17 PolarHBondContact O-N 2.9Å; K14-Y17 PolarHBondContact O-N 3.4Å; Q15-Y17 VanDerWaalsContact C-N 3.35Å; Q15-Y17 PolarHBondContact O-N 2.94Å; Y17-E19 VanDerWaalsContact C-N 3.33Å; Y17-E19 PolarHBondContact O-N 3.4Å; Y17-S20 PolarHBondContact O-N 2.99Å; Y17-D21 WeakPolarHBondContact O-CB 3.34Å; Y17-D21 PolarHBondContact O-N 2.83Å
18	L	85.2	Confident	83.2	Confident	96 Å²	96	96.4 Å²	96.4	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-65.7	-36.1	177	-69.6	170.6	0	0	0	112.3	K14 Q15 N22	K14-L18 HydrophobicContact CG-CD1 4.09Å; K14-L18 WeakPolarHBondContact O-CB 3.48Å; K14-L18 VanDerWaalsContact O-CG 3.27Å; K14-L18 WeakPolarHBondContact O-CG 3.27Å; K14-L18 PolarHBondContact O-N 2.97Å; Q15-L18 PolarHBondContact O-N 3.28Å; L18-N22 WeakPolarHBondContact O-CB 3.31Å; L18-N22 PolarHBondContact O-N 3.42Å
19	E	84.6	Confident	84.3	Confident	114 Å²	114	97.8 Å²	97.8	53%	0.533	52%	0.521	S	S	.	.	H	α-helix	trans	-67.2	-46.3	175.5	-168.9	172.5	131.8	0	0	110.9	Q15 H16 Y17 D21 N22 D23	Q15-E19 VanDerWaalsContact O-CB 3.28Å; Q15-E19 WeakPolarHBondContact O-CB 3.39Å; Q15-E19 PolarHBondContact O-N 3.5Å; H16-E19 PolarHBondContact O-N 2.92Å; Y17-E19 VanDerWaalsContact C-N 3.33Å; Y17-E19 PolarHBondContact O-N 3.4Å; E19-D21 VanDerWaalsContact C-N 3.32Å; E19-D21 PolarHBondContact O-N 3.44Å; E19-N22 PolarHBondContact O-N 3.13Å; E19-D23 WeakPolarHBondContact O-CB 3.38Å; E19-D23 PolarHBondContact O-N 3.31Å
20	S	86.4	Confident	85.3	Confident	49 Å²	49	101.3 Å²	101.3	34%	0.343	53%	0.526	S	S	.	.	H	α-helix	trans	-62.3	-36.9	175	179.9	0	0	0	0	113	H16 Y17 Q24	H16-S20 WeakPolarHBondContact O-CB 3.38Å; H16-S20 PolarHBondContact O-N 3.49Å; Y17-S20 PolarHBondContact O-N 2.99Å; S20-Q24 WeakPolarHBondContact O-CG 3.5Å; S20-Q24 PolarHBondContact O-N 2.97Å; S20-Q24 VanDerWaalsContact O-N 3.13Å
21	D	85.8	Confident	86.3	Confident	60 Å²	60	104.4 Å²	104.4	32%	0.321	53%	0.529	S	S	.	.	H	α-helix	trans	-69.4	-42.2	177.4	-168.5	42.6	0	0	0	110.7	Y17 E19 Q24 M25	Y17-D21 WeakPolarHBondContact O-CB 3.34Å; Y17-D21 PolarHBondContact O-N 2.83Å; E19-D21 VanDerWaalsContact C-N 3.32Å; E19-D21 PolarHBondContact O-N 3.44Å; D21-Q24 PolarHBondContact O-N 3.14Å; D21-M25 WeakPolarHBondContact O-CG 3.46Å; D21-M25 PolarHBondContact O-N 3.28Å; D21-M25 VanDerWaalsContact OD2-CE 3.31Å; D21-M25 WeakPolarHBondContact OD2-CE 3.45Å
22	N	89.1	Confident	87.1	Confident	95 Å²	95	108.7 Å²	108.7	51%	0.508	54%	0.536	S	S	.	.	H	α-helix	trans	-63.1	-43.4	174.7	-165.4	3.9	0	0	0	111.9	L18 E19 Q24 M25 V26	L18-N22 WeakPolarHBondContact O-CB 3.31Å; L18-N22 PolarHBondContact O-N 3.42Å; E19-N22 PolarHBondContact O-N 3.13Å; N22-Q24 VanDerWaalsContact C-N 3.31Å; N22-Q24 PolarHBondContact O-N 2.87Å; N22-M25 PolarHBondContact O-N 2.81Å; N22-M25 VanDerWaalsContact O-N 3.14Å; N22-V26 WeakPolarHBondContact O-CB 3.28Å; N22-V26 VanDerWaalsContact O-CG2 3.29Å; N22-V26 WeakPolarHBondContact O-CG2 3.38Å; N22-V26 PolarHBondContact O-N 3.39Å
23	D	90.6	Very high	88	Confident	102 Å²	102	106.1 Å²	106.1	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-60.3	-40.3	176.1	-83.4	-8.7	0	0	0	112.1	E19 V26 D27	E19-D23 WeakPolarHBondContact O-CB 3.38Å; E19-D23 PolarHBondContact O-N 3.31Å; D23-V26 PolarHBondContact O-N 2.99Å; D23-D27 WeakPolarHBondContact O-CB 3.31Å; D23-D27 PolarHBondContact O-N 3.43Å
24	Q	90.1	Very high	88.5	Confident	115 Å²	115	106.7 Å²	106.7	54%	0.537	53%	0.529	S	S	.	.	H	α-helix	trans	-65.2	-41.7	173.8	-74.1	-178	20.1	0	0	112.1	S20 D21 N22 V26 D27 N28	S20-Q24 WeakPolarHBondContact O-CG 3.5Å; S20-Q24 PolarHBondContact O-N 2.97Å; S20-Q24 VanDerWaalsContact O-N 3.13Å; D21-Q24 PolarHBondContact O-N 3.14Å; N22-Q24 VanDerWaalsContact C-N 3.31Å; N22-Q24 PolarHBondContact O-N 2.87Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; Q24-D27 PolarHBondContact O-N 2.83Å; Q24-N28 WeakPolarHBondContact O-CB 3.49Å; Q24-N28 PolarHBondContact O-N 3.44Å; Q24-N28 PolarHBondContact O-ND2 2.91Å
25	M	86.9	Confident	89	Confident	102 Å²	102	103.3 Å²	103.3	50%	0.502	52%	0.521	S	S	.	.	H	α-helix	trans	-63.8	-41.7	175.8	-69.5	-174.3	-164.6	0	0	111.5	D21 N22 N28 L29	D21-M25 WeakPolarHBondContact O-CG 3.46Å; D21-M25 PolarHBondContact O-N 3.28Å; D21-M25 VanDerWaalsContact OD2-CE 3.31Å; D21-M25 WeakPolarHBondContact OD2-CE 3.45Å; N22-M25 PolarHBondContact O-N 2.81Å; N22-M25 VanDerWaalsContact O-N 3.14Å; M25-N28 PolarHBondContact O-N 2.89Å; M25-L29 WeakPolarHBondContact O-CB 3.5Å; M25-L29 VanDerWaalsContact O-CG 3.31Å; M25-L29 WeakPolarHBondContact O-CG 3.29Å; M25-L29 PolarHBondContact O-N 3.14Å
26	V	91.1	Very high	89.6	Confident	54 Å²	54	102 Å²	102	33%	0.327	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-42.2	177.1	169.5	0	0	0	0	111.2	N22 D23 Q24 L29 K30	N22-V26 WeakPolarHBondContact O-CB 3.28Å; N22-V26 VanDerWaalsContact O-CG2 3.29Å; N22-V26 WeakPolarHBondContact O-CG2 3.38Å; N22-V26 PolarHBondContact O-N 3.39Å; D23-V26 PolarHBondContact O-N 2.99Å; Q24-V26 VanDerWaalsContact C-N 3.35Å; V26-L29 PolarHBondContact O-N 3.4Å; V26-K30 HydrophobicContact CG1-CD 4.26Å; V26-K30 WeakPolarHBondContact O-CG 3.42Å; V26-K30 PolarHBondContact O-N 3.4Å
27	D	92.2	Very high	90.2	Very high	105 Å²	105	102.3 Å²	102.3	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-63.8	-43.7	176.3	-169.3	64.9	0	0	0	111.8	D23 Q24 L29 K30 H31	D23-D27 WeakPolarHBondContact O-CB 3.31Å; D23-D27 PolarHBondContact O-N 3.43Å; Q24-D27 PolarHBondContact O-N 2.83Å; D27-L29 VanDerWaalsContact C-N 3.34Å; D27-L29 PolarHBondContact O-N 3.31Å; D27-K30 WeakPolarHBondContact O-CB 3.49Å; D27-K30 PolarHBondContact O-N 2.91Å; D27-H31 PolarHBondContact O-N 2.97Å
28	N	91.6	Very high	90.6	Very high	93 Å²	93	97.5 Å²	97.5	50%	0.497	51%	0.507	S	S	.	.	H	α-helix	trans	-60.2	-41.7	173.6	-84.9	-77.2	0	0	0	112.4	Q24 M25 H31 K32	Q24-N28 WeakPolarHBondContact O-CB 3.49Å; Q24-N28 PolarHBondContact O-N 3.44Å; Q24-N28 PolarHBondContact O-ND2 2.91Å; M25-N28 PolarHBondContact O-N 2.89Å; N28-H31 PolarHBondContact O-N 2.87Å; N28-K32 WeakPolarHBondContact O-CB 3.34Å; N28-K32 VanDerWaalsContact O-CG 3.31Å; N28-K32 WeakPolarHBondContact O-CG 3.31Å; N28-K32 PolarHBondContact O-N 3.4Å
29	L	91.9	Very high	90.9	Very high	107 Å²	107	97.5 Å²	97.5	56%	0.56	51%	0.507	S	S	*	.	H	α-helix	trans	-64.4	-43.9	175.1	-74.3	170.1	0	0	0	111.3	M25 V26 D27 H31 K32 V33	M25-L29 WeakPolarHBondContact O-CB 3.5Å; M25-L29 VanDerWaalsContact O-CG 3.31Å; M25-L29 WeakPolarHBondContact O-CG 3.29Å; M25-L29 PolarHBondContact O-N 3.14Å; V26-L29 PolarHBondContact O-N 3.4Å; D27-L29 VanDerWaalsContact C-N 3.34Å; D27-L29 PolarHBondContact O-N 3.31Å; L29-H31 VanDerWaalsContact C-N 3.34Å; L29-H31 PolarHBondContact O-N 3.09Å; L29-K32 PolarHBondContact O-N 2.93Å; L29-V33 WeakPolarHBondContact O-CB 3.46Å; L29-V33 VanDerWaalsContact O-CG2 3.26Å; L29-V33 WeakPolarHBondContact O-CG2 3.36Å; L29-V33 PolarHBondContact O-N 2.79Å
30	K	92.4	Very high	91.2	Very high	131 Å²	131	96.5 Å²	96.5	57%	0.57	51%	0.509	S	S	*	.	H	α-helix	trans	-59.1	-44.2	175.2	-76.3	173.9	180	172.8	0	111.7	V26 D27 V33 T34	V26-K30 HydrophobicContact CG1-CD 4.26Å; V26-K30 WeakPolarHBondContact O-CG 3.42Å; V26-K30 PolarHBondContact O-N 3.4Å; D27-K30 WeakPolarHBondContact O-CB 3.49Å; D27-K30 PolarHBondContact O-N 2.91Å; K30-V33 PolarHBondContact O-N 3.45Å; K30-T34 WeakPolarHBondContact O-CB 3.48Å; K30-T34 PolarHBondContact O-N 2.87Å; K30-T34 PolarHBondContact O-OG1 3.19Å
31	H	93	Very high	91.5	Very high	127 Å²	127	98.3 Å²	98.3	59%	0.588	51%	0.513	S	S	*	.	H	α-helix	trans	-61.7	-49.5	176.6	-173.6	-72.3	0	0	0	111	D27 N28 L29 V33 T34 T35	D27-H31 PolarHBondContact O-N 2.97Å; N28-H31 PolarHBondContact O-N 2.87Å; L29-H31 VanDerWaalsContact C-N 3.34Å; L29-H31 PolarHBondContact O-N 3.09Å; H31-V33 VanDerWaalsContact C-N 3.35Å; H31-V33 PolarHBondContact O-N 3.4Å; H31-T34 WeakPolarHBondContact O-CB 3.45Å; H31-T34 PolarHBondContact O-N 3.42Å; H31-T34 VanDerWaalsContact O-N 3.14Å; H31-T35 PolarHBondContact O-N 2.87Å; H31-T35 PolarHBondContact O-OG1 3.47Å; H31-T35 VanDerWaalsContact O-OG1 3.09Å
32	K	93.5	Very high	91.7	Very high	130 Å²	130	99.7 Å²	99.7	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-58.4	-43.9	177.3	-73.7	173.4	-174.6	-72	0	112.3	N28 L29 T34 T35 L36	N28-K32 WeakPolarHBondContact O-CB 3.34Å; N28-K32 VanDerWaalsContact O-CG 3.31Å; N28-K32 WeakPolarHBondContact O-CG 3.31Å; N28-K32 PolarHBondContact O-N 3.4Å; L29-K32 PolarHBondContact O-N 2.93Å; K32-T34 VanDerWaalsContact C-N 3.31Å; K32-T34 PolarHBondContact O-N 3.3Å; K32-T35 PolarHBondContact O-N 3.42Å; K32-L36 WeakPolarHBondContact O-CG 3.26Å; K32-L36 PolarHBondContact O-N 2.93Å
33	V	94	Very high	91.9	Very high	92 Å²	92	99.7 Å²	99.7	56%	0.558	52%	0.52	S	S	*	.	H	α-helix	trans	-63.7	-39.1	177	170.3	0	0	0	0	111	L29 K30 H31 L36 K37	L29-V33 WeakPolarHBondContact O-CB 3.46Å; L29-V33 VanDerWaalsContact O-CG2 3.26Å; L29-V33 WeakPolarHBondContact O-CG2 3.36Å; L29-V33 PolarHBondContact O-N 2.79Å; K30-V33 PolarHBondContact O-N 3.45Å; H31-V33 VanDerWaalsContact C-N 3.35Å; H31-V33 PolarHBondContact O-N 3.4Å; V33-L36 PolarHBondContact O-N 3.41Å; V33-K37 VanDerWaalsContact O-CB 3.28Å; V33-K37 WeakPolarHBondContact O-CB 3.41Å; V33-K37 PolarHBondContact O-N 3.22Å
34	T	92.3	Very high	91.9	Very high	93 Å²	93	96.3 Å²	96.3	57%	0.571	51%	0.509	S	S	*	.	H	α-helix	trans	-66.4	-41.8	177.1	-56.7	0	0	0	0	111.4	K30 H31 K32 K37 S38	K30-T34 WeakPolarHBondContact O-CB 3.48Å; K30-T34 PolarHBondContact O-N 2.87Å; K30-T34 PolarHBondContact O-OG1 3.19Å; H31-T34 WeakPolarHBondContact O-CB 3.45Å; H31-T34 PolarHBondContact O-N 3.42Å; H31-T34 VanDerWaalsContact O-N 3.14Å; K32-T34 VanDerWaalsContact C-N 3.31Å; K32-T34 PolarHBondContact O-N 3.3Å; T34-K37 WeakPolarHBondContact O-CB 3.28Å; T34-K37 PolarHBondContact O-N 2.97Å; T34-S38 PolarHBondContact O-N 3.34Å
35	T	91.7	Very high	92	Very high	76 Å²	76	95.4 Å²	95.4	47%	0.466	51%	0.508	S	S	.	.	H	α-helix	trans	-61.6	-47.2	173.5	-53.1	0	0	0	0	111.7	H31 K32 K37 S38 L39	H31-T35 PolarHBondContact O-N 2.87Å; H31-T35 PolarHBondContact O-OG1 3.47Å; H31-T35 VanDerWaalsContact O-OG1 3.09Å; K32-T35 PolarHBondContact O-N 3.42Å; T35-K37 VanDerWaalsContact C-N 3.3Å; T35-K37 PolarHBondContact O-N 2.94Å; T35-S38 PolarHBondContact O-N 3.34Å; T35-L39 PolarHBondContact O-N 2.85Å
36	L	94.3	Very high	92	Very high	105 Å²	105	93.3 Å²	93.3	55%	0.55	50%	0.497	S	S	.	.	H	α-helix	trans	-62.2	-38.8	177.1	-73.4	172.4	0	0	0	112	K32 V33 L39 T40	K32-L36 WeakPolarHBondContact O-CG 3.26Å; K32-L36 PolarHBondContact O-N 2.93Å; V33-L36 PolarHBondContact O-N 3.41Å; L36-L39 PolarHBondContact O-N 3.06Å; L36-T40 WeakPolarHBondContact O-CB 3.46Å; L36-T40 PolarHBondContact O-N 3.35Å; L36-T40 PolarHBondContact O-OG1 2.93Å
37	K	94	Very high	91.9	Very high	140 Å²	140	94.1 Å²	94.1	61%	0.609	50%	0.502	S	S	*	.	H	α-helix	trans	-60.5	-46.8	174.4	-176.6	-179.7	179.4	-176.7	0	110.9	V33 T34 T35 T40 I41	V33-K37 VanDerWaalsContact O-CB 3.28Å; V33-K37 WeakPolarHBondContact O-CB 3.41Å; V33-K37 PolarHBondContact O-N 3.22Å; T34-K37 WeakPolarHBondContact O-CB 3.28Å; T34-K37 PolarHBondContact O-N 2.97Å; T35-K37 VanDerWaalsContact C-N 3.3Å; T35-K37 PolarHBondContact O-N 2.94Å; K37-T40 PolarHBondContact O-N 2.9Å; K37-I41 HydrophobicContact CG-CD1 4.12Å; K37-I41 VanDerWaalsContact O-CG1 3.3Å; K37-I41 WeakPolarHBondContact O-CG1 3.2Å; K37-I41 PolarHBondContact O-N 2.88Å
38	S	91.8	Very high	91.7	Very high	61 Å²	61	98.1 Å²	98.1	43%	0.427	51%	0.509	S	S	.	.	H	α-helix	trans	-59.6	-51	175.6	-164.4	0	0	0	0	111.2	T34 T35 T40 I41 D42	T34-S38 PolarHBondContact O-N 3.34Å; T35-S38 PolarHBondContact O-N 3.34Å; S38-T40 PolarHBondContact O-N 3.41Å; S38-I41 WeakPolarHBondContact O-CB 3.48Å; S38-I41 PolarHBondContact O-N 2.73Å; S38-D42 PolarHBondContact O-N 3.45Å
39	L	92.3	Very high	91.4	Very high	96 Å²	96	100 Å²	100	50%	0.503	51%	0.509	S	S	.	.	H	α-helix	trans	-58.4	-37.9	179.8	-176.9	63.6	0	0	0	112.1	T35 L36 D42 I43	T35-L39 PolarHBondContact O-N 2.85Å; L36-L39 PolarHBondContact O-N 3.06Å; L39-D42 PolarHBondContact O-N 3.04Å; L39-I43 HydrophobicContact CD1-CD1 4.43Å; L39-I43 HydrophobicContact CG-CD1 4.06Å; L39-I43 WeakPolarHBondContact O-CB 3.48Å; L39-I43 WeakPolarHBondContact O-CD1 3.42Å; L39-I43 WeakPolarHBondContact O-CG1 3.29Å; L39-I43 PolarHBondContact O-N 3.22Å
40	T	90.7	Very high	90.9	Very high	94 Å²	94	99.3 Å²	99.3	58%	0.577	50%	0.503	S	S	*	.	H	α-helix	trans	-69.1	-38.3	178.2	-55.2	0	0	0	0	111.9	L36 K37 S38 G44	L36-T40 WeakPolarHBondContact O-CB 3.46Å; L36-T40 PolarHBondContact O-N 3.35Å; L36-T40 PolarHBondContact O-OG1 2.93Å; K37-T40 PolarHBondContact O-N 2.9Å; S38-T40 PolarHBondContact O-N 3.41Å; T40-G44 PolarHBondContact O-N 3.49Å
41	I	91.3	Very high	90.6	Very high	86 Å²	86	97.8 Å²	97.8	44%	0.441	50%	0.501	S	S	.	.	H	α-helix	trans	-64.3	-48.1	173.7	-67.7	164.8	0	0	0	109.6	K37 S38 I43 G44 D45	K37-I41 HydrophobicContact CG-CD1 4.12Å; K37-I41 VanDerWaalsContact O-CG1 3.3Å; K37-I41 WeakPolarHBondContact O-CG1 3.2Å; K37-I41 PolarHBondContact O-N 2.88Å; S38-I41 WeakPolarHBondContact O-CB 3.48Å; S38-I41 PolarHBondContact O-N 2.73Å; I41-I43 VanDerWaalsContact C-N 3.32Å; I41-I43 PolarHBondContact O-N 2.73Å; I41-G44 CarbonylContact O-C 3.6Å; I41-G44 WeakPolarHBondContact O-CA 3.45Å; I41-G44 PolarHBondContact O-N 3.41Å; I41-D45 PolarHBondContact O-N 2.87Å
42	D	91.7	Very high	90	Very high	90 Å²	90	100 Å²	100	48%	0.481	51%	0.509	S	S	.	.	H	α-helix	trans	-58.9	-42.6	179.5	-61.7	-28.1	0	0	0	111.4	S38 L39 D45 E46	S38-D42 PolarHBondContact O-N 3.45Å; L39-D42 PolarHBondContact O-N 3.04Å; D42-D45 PolarHBondContact O-N 2.99Å; D42-E46 VanDerWaalsContact O-CB 3.29Å; D42-E46 WeakPolarHBondContact O-CB 3.27Å; D42-E46 PolarHBondContact O-N 2.66Å
43	I	92.1	Very high	89.1	Confident	95 Å²	95	99.7 Å²	99.7	49%	0.487	51%	0.51	S	S	.	.	H	α-helix	trans	-62.5	-42.4	173.3	-69.7	164.8	0	0	0	111	L39 I41 D45 E46 V47	L39-I43 HydrophobicContact CD1-CD1 4.43Å; L39-I43 HydrophobicContact CG-CD1 4.06Å; L39-I43 WeakPolarHBondContact O-CB 3.48Å; L39-I43 WeakPolarHBondContact O-CD1 3.42Å; L39-I43 WeakPolarHBondContact O-CG1 3.29Å; L39-I43 PolarHBondContact O-N 3.22Å; I41-I43 VanDerWaalsContact C-N 3.32Å; I41-I43 PolarHBondContact O-N 2.73Å; I43-D45 VanDerWaalsContact C-N 3.35Å; I43-D45 PolarHBondContact O-N 3Å; I43-E46 PolarHBondContact O-N 2.8Å; I43-V47 HydrophobicContact CG2-CG2 4.37Å; I43-V47 WeakPolarHBondContact O-CB 3.3Å; I43-V47 VanDerWaalsContact O-CG2 3.27Å; I43-V47 WeakPolarHBondContact O-CG2 3.37Å; I43-V47 PolarHBondContact O-N 2.86Å
44	G	90.8	Very high	88.5	Confident	31 Å²	31	100.2 Å²	100.2	32%	0.32	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-41.1	178.2	0	0	0	0	0	113	T40 I41 R48	T40-G44 PolarHBondContact O-N 3.49Å; I41-G44 CarbonylContact O-C 3.6Å; I41-G44 WeakPolarHBondContact O-CA 3.45Å; I41-G44 PolarHBondContact O-N 3.41Å; G44-R48 PolarHBondContact O-N 2.9Å; G44-R48 VanDerWaalsContact O-N 3.09Å
45	D	92	Very high	87.8	Confident	95 Å²	95	98 Å²	98	51%	0.508	51%	0.505	S	S	.	.	H	α-helix	trans	-71.5	-39.7	177.2	-73.1	-16.3	0	0	0	111.6	I41 D42 I43 R48 R49	I41-D45 PolarHBondContact O-N 2.87Å; D42-D45 PolarHBondContact O-N 2.99Å; I43-D45 VanDerWaalsContact C-N 3.35Å; I43-D45 PolarHBondContact O-N 3Å; D45-R48 PolarHBondContact O-N 3.16Å; D45-R49 WeakPolarHBondContact O-CB 3.33Å; D45-R49 PolarHBondContact O-N 3.41Å
46	E	87.9	Confident	87.2	Confident	59 Å²	59	95.8 Å²	95.8	28%	0.276	50%	0.497	S	S	.	.	H	α-helix	trans	-60.7	-47.3	173.9	-175.1	62.5	-146.2	0	0	111.4	D42 I43 R48 R49 Q50	D42-E46 VanDerWaalsContact O-CB 3.29Å; D42-E46 WeakPolarHBondContact O-CB 3.27Å; D42-E46 PolarHBondContact O-N 2.66Å; I43-E46 PolarHBondContact O-N 2.8Å; E46-R48 VanDerWaalsContact C-N 3.32Å; E46-R48 PolarHBondContact O-N 3.41Å; E46-R49 PolarHBondContact O-N 3.29Å; E46-R49 VanDerWaalsContact O-N 3.15Å; E46-R49 IonicContact OE1-CZ 3.94Å; E46-R49 IonicContact OE1-NH2 2.8Å; E46-R49 PolarHBondContact OE1-NH2 2.92Å; E46-R49 IonicContact OE2-CZ 2.73Å; E46-R49 IonicContact OE2-NH1 2.8Å; E46-R49 PolarHBondContact OE2-NH1 2.88Å; E46-R49 IonicContact OE2-NH2 3.5Å; E46-R49 PolarHBondContact OE2-NH2 2.83Å; E46-Q50 HydrophobicContact CG-CG 4.48Å; E46-Q50 WeakPolarHBondContact O-CB 3.44Å; E46-Q50 WeakPolarHBondContact O-CG 3.33Å; E46-Q50 PolarHBondContact O-N 3.09Å; E46-Q50 PolarHBondContact OE1-NE2 3.36Å
47	V	89.2	Confident	86.5	Confident	70 Å²	70	94.7 Å²	94.7	42%	0.424	49%	0.491	S	S	.	.	H	α-helix	trans	-62.7	-38.5	177.1	169.9	0	0	0	0	111	I43 N51	I43-V47 HydrophobicContact CG2-CG2 4.37Å; I43-V47 WeakPolarHBondContact O-CB 3.3Å; I43-V47 VanDerWaalsContact O-CG2 3.27Å; I43-V47 WeakPolarHBondContact O-CG2 3.37Å; I43-V47 PolarHBondContact O-N 2.86Å; V47-N51 VanDerWaalsContact O-CB 3.25Å; V47-N51 WeakPolarHBondContact O-CB 3.44Å; V47-N51 PolarHBondContact O-N 3.15Å; V47-N51 PolarHBondContact O-ND2 2.84Å; V47-N51 VanDerWaalsContact O-ND2 3.16Å
48	R	86.9	Confident	86	Confident	190 Å²	190	95 Å²	95	72%	0.717	50%	0.495	S	S	*	.	H	α-helix	trans	-66.1	-40.5	173.1	-82.3	177	-155.5	-88.1	-6.6	112.3	G44 D45 E46 N51 K52	G44-R48 PolarHBondContact O-N 2.9Å; G44-R48 VanDerWaalsContact O-N 3.09Å; D45-R48 PolarHBondContact O-N 3.16Å; E46-R48 VanDerWaalsContact C-N 3.32Å; E46-R48 PolarHBondContact O-N 3.41Å; R48-N51 PolarHBondContact O-N 2.9Å; R48-K52 WeakPolarHBondContact O-CB 3.43Å; R48-K52 PolarHBondContact O-N 3.08Å
49	R	85.4	Confident	85.7	Confident	132 Å²	132	97.3 Å²	97.3	50%	0.498	50%	0.502	S	S	.	.	H	α-helix	trans	-63.9	-47.8	177.5	-166.6	175.4	78.8	-124.1	1	110.8	D45 E46 N51 K52 E53	D45-R49 WeakPolarHBondContact O-CB 3.33Å; D45-R49 PolarHBondContact O-N 3.41Å; E46-R49 PolarHBondContact O-N 3.29Å; E46-R49 VanDerWaalsContact O-N 3.15Å; E46-R49 IonicContact OE1-CZ 3.94Å; E46-R49 IonicContact OE1-NH2 2.8Å; E46-R49 PolarHBondContact OE1-NH2 2.92Å; E46-R49 IonicContact OE2-CZ 2.73Å; E46-R49 IonicContact OE2-NH1 2.8Å; E46-R49 PolarHBondContact OE2-NH1 2.88Å; E46-R49 IonicContact OE2-NH2 3.5Å; E46-R49 PolarHBondContact OE2-NH2 2.83Å; R49-N51 PolarHBondContact O-N 3.34Å; R49-K52 WeakPolarHBondContact O-CB 3.37Å; R49-K52 PolarHBondContact O-N 3.21Å; R49-K52 VanDerWaalsContact O-N 3.1Å; R49-E53 IonicContact NE-OE1 2.96Å; R49-E53 PolarHBondContact O-N 2.94Å
50	Q	82.5	Confident	85.4	Confident	93 Å²	93	99.3 Å²	99.3	44%	0.435	51%	0.509	S	S	.	.	H	α-helix	trans	-63.1	-40.6	176.4	-69.7	178.9	4.2	0	0	112.1	E46 K52 E53 L54	E46-Q50 HydrophobicContact CG-CG 4.48Å; E46-Q50 WeakPolarHBondContact O-CB 3.44Å; E46-Q50 WeakPolarHBondContact O-CG 3.33Å; E46-Q50 PolarHBondContact O-N 3.09Å; E46-Q50 PolarHBondContact OE1-NE2 3.36Å; Q50-K52 VanDerWaalsContact C-N 3.28Å; Q50-K52 PolarHBondContact O-N 2.85Å; Q50-E53 PolarHBondContact O-N 3.4Å; Q50-L54 WeakPolarHBondContact O-CG 3.25Å; Q50-L54 PolarHBondContact O-N 3.46Å
51	N	84.4	Confident	85.2	Confident	98 Å²	98	101.8 Å²	101.8	52%	0.524	51%	0.512	S	S	.	.	H	α-helix	trans	-63.9	-32.9	173.3	-78.7	-29	0	0	0	112.7	V47 R48 R49 L54 G55	V47-N51 VanDerWaalsContact O-CB 3.25Å; V47-N51 WeakPolarHBondContact O-CB 3.44Å; V47-N51 PolarHBondContact O-N 3.15Å; V47-N51 PolarHBondContact O-ND2 2.84Å; V47-N51 VanDerWaalsContact O-ND2 3.16Å; R48-N51 PolarHBondContact O-N 2.9Å; R49-N51 PolarHBondContact O-N 3.34Å; N51-L54 WeakPolarHBondContact O-CB 3.5Å; N51-G55 PolarHBondContact O-N 3.18Å
52	K	81.6	Confident	85.1	Confident	175 Å²	175	102.7 Å²	102.7	76%	0.761	51%	0.514	S	S	*	.	H	α-helix	trans	-70	-39.8	173.2	-172.5	-180	178.7	-177	0	111.7	R48 R49 Q50 L54 G55 G56	R48-K52 WeakPolarHBondContact O-CB 3.43Å; R48-K52 PolarHBondContact O-N 3.08Å; R49-K52 WeakPolarHBondContact O-CB 3.37Å; R49-K52 PolarHBondContact O-N 3.21Å; R49-K52 VanDerWaalsContact O-N 3.1Å; Q50-K52 VanDerWaalsContact C-N 3.28Å; Q50-K52 PolarHBondContact O-N 2.85Å; K52-L54 VanDerWaalsContact C-N 3.34Å; K52-G55 WeakPolarHBondContact O-CA 3.49Å; K52-G55 PolarHBondContact O-N 3.29Å; K52-G55 VanDerWaalsContact O-N 3.1Å; K52-G56 PolarHBondContact O-N 2.83Å
53	E	75.1	Confident	84.9	Confident	122 Å²	122	101.8 Å²	101.8	57%	0.57	52%	0.515	S	S	*	.	H	α-helix	trans	-66.4	-35.3	174.6	-71	174	-164.7	0	0	112.1	R49 Q50 G55 G56 L57	R49-E53 IonicContact NE-OE1 2.96Å; R49-E53 PolarHBondContact O-N 2.94Å; Q50-E53 PolarHBondContact O-N 3.4Å; E53-G55 PolarHBondContact O-N 3.1Å; E53-G56 CarbonylContact O-C 3.56Å; E53-G56 WeakPolarHBondContact O-CA 3.46Å; E53-G56 PolarHBondContact O-N 2.96Å; E53-L57 PolarHBondContact O-N 3.48Å; E53-L57 VanDerWaalsContact O-N 3.08Å
54	L	79.6	Confident	84.8	Confident	103 Å²	103	98.9 Å²	98.9	54%	0.539	51%	0.508	S	S	.	.	H	α-helix	trans	-59.5	-32.7	169	-79.9	156.8	0	0	0	112.1	Q50 N51 K52 G56 L57	Q50-L54 WeakPolarHBondContact O-CG 3.25Å; Q50-L54 PolarHBondContact O-N 3.46Å; N51-L54 WeakPolarHBondContact O-CB 3.5Å; K52-L54 VanDerWaalsContact C-N 3.34Å; L54-G56 VanDerWaalsContact C-N 3.31Å; L54-L57 VanDerWaalsContact O-CB 3.31Å; L54-L57 WeakPolarHBondContact O-CB 3.38Å; L54-L57 PolarHBondContact O-N 3.27Å
55	G	79.2	Confident	84.8	Confident	47 Å²	47	105.5 Å²	105.5	49%	0.485	52%	0.523	S	S	.	.	H	α-helix	trans	-67.1	-30	169.2	0	0	0	0	0	113.5	N51 K52 E53 L57	N51-G55 PolarHBondContact O-N 3.18Å; K52-G55 WeakPolarHBondContact O-CA 3.49Å; K52-G55 PolarHBondContact O-N 3.29Å; K52-G55 VanDerWaalsContact O-N 3.1Å; E53-G55 PolarHBondContact O-N 3.1Å; G55-L57 VanDerWaalsContact C-N 3.32Å
56	G	78.7	Confident	84.7	Confident	29 Å²	29	104.8 Å²	104.8	30%	0.299	52%	0.52	S	S	.	.	H	α-helix	trans	-74	-21.6	172.5	0	0	0	0	0	113.7	K52 E53 L54 E58 D59 H60	K52-G56 PolarHBondContact O-N 2.83Å; E53-G56 CarbonylContact O-C 3.56Å; E53-G56 WeakPolarHBondContact O-CA 3.46Å; E53-G56 PolarHBondContact O-N 2.96Å; L54-G56 VanDerWaalsContact C-N 3.31Å; G56-E58 VanDerWaalsContact C-N 3.27Å; G56-E58 PolarHBondContact O-N 3.35Å; G56-D59 PolarHBondContact O-N 3.41Å; G56-H60 PolarHBondContact O-CD2 3.28Å; G56-H60 PolarHBondContact O-N 3.38Å
57	L	80.3	Confident	84.9	Confident	82 Å²	82	106.3 Å²	106.3	43%	0.429	53%	0.532	S	S	.	.	H	α-helix	trans	-64.7	-32.5	175.7	-174.5	60.9	0	0	0	111.9	E53 L54 G55 H60 F61	E53-L57 PolarHBondContact O-N 3.48Å; E53-L57 VanDerWaalsContact O-N 3.08Å; L54-L57 VanDerWaalsContact O-CB 3.31Å; L54-L57 WeakPolarHBondContact O-CB 3.38Å; L54-L57 PolarHBondContact O-N 3.27Å; G55-L57 VanDerWaalsContact C-N 3.32Å; L57-H60 PolarHBondContact O-N 3.2Å; L57-F61 HydrophobicContact CD1-CD2 3.64Å; L57-F61 HydrophobicContact CD1-CE2 3.75Å; L57-F61 HydrophobicContact CD2-CD2 4.4Å; L57-F61 HydrophobicContact CD2-CE2 4.18Å; L57-F61 HydrophobicContact CG-CD2 3.69Å; L57-F61 HydrophobicContact CG-CE2 3.91Å; L57-F61 WeakPolarHBondContact O-CB 3.31Å; L57-F61 WeakPolarHBondContact O-CD2 3.38Å; L57-F61 PolarHBondContact O-N 3.25Å
58	E	83.3	Confident	85.1	Confident	148 Å²	148	107.8 Å²	107.8	69%	0.692	54%	0.537	S	S	*	.	H	α-helix	trans	-60.4	-45.9	175.8	-173.7	170.7	-179.4	0	0	111.5	G56 F61 E62	G56-E58 VanDerWaalsContact C-N 3.27Å; G56-E58 PolarHBondContact O-N 3.35Å; E58-F61 PolarHBondContact O-N 3.1Å; E58-E62 WeakPolarHBondContact O-CB 3.36Å; E58-E62 PolarHBondContact O-N 3.23Å
59	D	85.1	Confident	85.2	Confident	109 Å²	109	102 Å²	102	58%	0.583	52%	0.519	S	S	*	.	H	α-helix	trans	-64.7	-41.6	177.5	-172.6	49	0	0	0	111.8	G56 E62 S63	G56-D59 PolarHBondContact O-N 3.41Å; D59-E62 PolarHBondContact O-N 3.45Å; D59-S63 WeakPolarHBondContact O-CB 3.4Å; D59-S63 PolarHBondContact O-N 2.78Å
60	H	85.1	Confident	85.4	Confident	137 Å²	137	97.8 Å²	97.8	63%	0.634	51%	0.512	S	S	*	.	H	α-helix	trans	-65.2	-40.8	174.3	-70	-49	0	0	0	112.8	G56 L57 G64	G56-H60 PolarHBondContact O-CD2 3.28Å; G56-H60 PolarHBondContact O-N 3.38Å; L57-H60 PolarHBondContact O-N 3.2Å; H60-G64 PolarHBondContact O-N 3.47Å
61	F	87.9	Confident	85.7	Confident	146 Å²	146	96.6 Å²	96.6	64%	0.64	51%	0.511	S	S	*	.	H	α-helix	trans	-66.7	-39.4	174.8	-102.7	-90.6	0	0	0	111.7	L57 E58 G64 R65	L57-F61 HydrophobicContact CD1-CD2 3.64Å; L57-F61 HydrophobicContact CD1-CE2 3.75Å; L57-F61 HydrophobicContact CD2-CD2 4.4Å; L57-F61 HydrophobicContact CD2-CE2 4.18Å; L57-F61 HydrophobicContact CG-CD2 3.69Å; L57-F61 HydrophobicContact CG-CE2 3.91Å; L57-F61 WeakPolarHBondContact O-CB 3.31Å; L57-F61 WeakPolarHBondContact O-CD2 3.38Å; L57-F61 PolarHBondContact O-N 3.25Å; E58-F61 PolarHBondContact O-N 3.1Å; F61-G64 PolarHBondContact O-N 2.95Å; F61-R65 WeakPolarHBondContact O-CB 3.46Å; F61-R65 PolarHBondContact O-N 2.91Å
62	E	88.5	Confident	85.8	Confident	106 Å²	106	98 Å²	98	50%	0.495	52%	0.516	S	S	.	.	H	α-helix	trans	-64.1	-46.6	176.4	-169	-176.3	157.3	0	0	110.8	E58 D59 G64 R65 N66	E58-E62 WeakPolarHBondContact O-CB 3.36Å; E58-E62 PolarHBondContact O-N 3.23Å; D59-E62 PolarHBondContact O-N 3.45Å; E62-G64 PolarHBondContact O-N 3.49Å; E62-R65 WeakPolarHBondContact O-CB 3.1Å; E62-R65 PolarHBondContact O-N 3.37Å; E62-N66 WeakPolarHBondContact O-CB 3.28Å; E62-N66 PolarHBondContact O-N 2.85Å; E62-N66 PolarHBondContact O-ND2 3.18Å
63	S	87.2	Confident	86	Confident	71 Å²	71	97.4 Å²	97.4	50%	0.497	51%	0.509	S	S	.	.	H	α-helix	trans	-59.1	-48.1	175.2	-176	0	0	0	0	112	D59 R65 N66 V67	D59-S63 WeakPolarHBondContact O-CB 3.4Å; D59-S63 PolarHBondContact O-N 2.78Å; S63-R65 VanDerWaalsContact C-N 3.35Å; S63-R65 PolarHBondContact O-N 2.81Å; S63-N66 PolarHBondContact O-N 2.92Å; S63-V67 WeakPolarHBondContact O-CG2 3.39Å; S63-V67 PolarHBondContact O-N 3.36Å; S63-V67 VanDerWaalsContact O-N 3.14Å
64	G	89.1	Confident	86.4	Confident	33 Å²	33	99.9 Å²	99.9	34%	0.34	51%	0.513	S	S	.	.	H	α-helix	trans	-61.3	-41.5	175	0	0	0	0	0	112.7	H60 F61 E62 V67 L68	H60-G64 PolarHBondContact O-N 3.47Å; F61-G64 PolarHBondContact O-N 2.95Å; E62-G64 PolarHBondContact O-N 3.49Å; G64-V67 PolarHBondContact O-N 3.14Å; G64-L68 WeakPolarHBondContact O-CD1 3.2Å; G64-L68 PolarHBondContact O-N 3.27Å
65	R	90.8	Very high	86.6	Confident	171 Å²	171	100.2 Å²	100.2	65%	0.645	52%	0.515	S	S	*	.	H	α-helix	trans	-62.8	-41.9	175.6	176.8	-176	159.7	96	4.8	111.5	F61 E62 S63 V67 L68 E69	F61-R65 WeakPolarHBondContact O-CB 3.46Å; F61-R65 PolarHBondContact O-N 2.91Å; E62-R65 WeakPolarHBondContact O-CB 3.1Å; E62-R65 PolarHBondContact O-N 3.37Å; S63-R65 VanDerWaalsContact C-N 3.35Å; S63-R65 PolarHBondContact O-N 2.81Å; R65-V67 VanDerWaalsContact C-N 3.35Å; R65-V67 PolarHBondContact O-N 3.47Å; R65-L68 CarbonylContact O-C 3.48Å; R65-L68 PolarHBondContact O-N 3.27Å; R65-E69 VanDerWaalsContact O-CB 3.28Å; R65-E69 WeakPolarHBondContact O-CB 3.48Å; R65-E69 PolarHBondContact O-N 2.74Å
66	N	91.4	Very high	86.7	Confident	80 Å²	80	99.6 Å²	99.6	43%	0.428	51%	0.509	S	S	.	.	H	α-helix	trans	-63.2	-41.1	177.8	-72.5	-25.8	0	0	0	111.6	E62 S63 E69 A70	E62-N66 WeakPolarHBondContact O-CB 3.28Å; E62-N66 PolarHBondContact O-N 2.85Å; E62-N66 PolarHBondContact O-ND2 3.18Å; S63-N66 PolarHBondContact O-N 2.92Å; N66-E69 PolarHBondContact O-N 2.89Å; N66-A70 WeakPolarHBondContact O-CB 3.42Å; N66-A70 PolarHBondContact O-N 3.17Å
67	V	91.4	Very high	86.3	Confident	90 Å²	90	103.8 Å²	103.8	55%	0.545	52%	0.524	S	S	.	.	H	α-helix	trans	-65.6	-43.7	174.3	174.9	0	0	0	0	111.4	S63 G64 R65 A70 T71	S63-V67 WeakPolarHBondContact O-CG2 3.39Å; S63-V67 PolarHBondContact O-N 3.36Å; S63-V67 VanDerWaalsContact O-N 3.14Å; G64-V67 PolarHBondContact O-N 3.14Å; R65-V67 VanDerWaalsContact C-N 3.35Å; R65-V67 PolarHBondContact O-N 3.47Å; V67-A70 PolarHBondContact O-N 2.99Å; V67-T71 PolarHBondContact O-N 2.91Å; V67-T71 PolarHBondContact O-OG1 2.82Å
68	L	92.8	Very high	85.8	Confident	101 Å²	101	105.4 Å²	105.4	53%	0.529	53%	0.532	S	S	.	.	H	α-helix	trans	-64.1	-40.9	174.6	-99.8	74.1	0	0	0	111.5	G64 R65 T71 M72	G64-L68 WeakPolarHBondContact O-CD1 3.2Å; G64-L68 PolarHBondContact O-N 3.27Å; R65-L68 CarbonylContact O-C 3.48Å; R65-L68 PolarHBondContact O-N 3.27Å; L68-T71 CarbonylContact O-C 3.55Å; L68-T71 WeakPolarHBondContact O-CA 3.44Å; L68-T71 WeakPolarHBondContact O-CB 3.28Å; L68-T71 PolarHBondContact O-N 2.77Å; L68-M72 HydrophobicContact CB-CE 4.43Å; L68-M72 HydrophobicContact CD2-CE 4.42Å; L68-M72 WeakPolarHBondContact O-CB 3.5Å; L68-M72 WeakPolarHBondContact O-CG 3.34Å; L68-M72 PolarHBondContact O-N 3.29Å
69	E	90.5	Very high	85.1	Confident	69 Å²	69	103.1 Å²	103.1	32%	0.322	53%	0.532	S	S	.	.	H	α-helix	trans	-63.2	-43.6	177.4	-167	-166.8	129.4	0	0	110.4	R65 N66 T71 M72 R73	R65-E69 VanDerWaalsContact O-CB 3.28Å; R65-E69 WeakPolarHBondContact O-CB 3.48Å; R65-E69 PolarHBondContact O-N 2.74Å; N66-E69 PolarHBondContact O-N 2.89Å; E69-T71 VanDerWaalsContact C-N 3.29Å; E69-T71 PolarHBondContact O-N 3.39Å; E69-M72 PolarHBondContact O-N 2.72Å; E69-R73 HydrophobicContact CG-CG 4.42Å; E69-R73 WeakPolarHBondContact O-CB 3.36Å; E69-R73 WeakPolarHBondContact O-CG 3.48Å; E69-R73 PolarHBondContact O-N 3.41Å; E69-R73 IonicContact OE1-CZ 3.72Å; E69-R73 IonicContact OE1-NH1 2.66Å; E69-R73 PolarHBondContact OE1-NH1 3.4Å
70	A	89.2	Confident	84	Confident	44 Å²	44	108.8 Å²	108.8	36%	0.364	55%	0.545	S	S	.	.	H	α-helix	trans	-59.4	-43	173.6	0	0	0	0	0	111.3	N66 V67 R73 R74	N66-A70 WeakPolarHBondContact O-CB 3.42Å; N66-A70 PolarHBondContact O-N 3.17Å; V67-A70 PolarHBondContact O-N 2.99Å; A70-R73 PolarHBondContact O-N 3.43Å; A70-R74 VanDerWaalsContact O-CG 3.29Å; A70-R74 WeakPolarHBondContact O-CG 3.13Å; A70-R74 PolarHBondContact O-N 3.5Å
71	T	88.5	Confident	82.7	Confident	68 Å²	68	106.2 Å²	106.2	42%	0.417	54%	0.542	S	S	.	.	H	α-helix	trans	-62.9	-47.1	174.9	-56	0	0	0	0	111.8	V67 L68 E69 R73 R74 L75	V67-T71 PolarHBondContact O-N 2.91Å; V67-T71 PolarHBondContact O-OG1 2.82Å; L68-T71 CarbonylContact O-C 3.55Å; L68-T71 WeakPolarHBondContact O-CA 3.44Å; L68-T71 WeakPolarHBondContact O-CB 3.28Å; L68-T71 PolarHBondContact O-N 2.77Å; E69-T71 VanDerWaalsContact C-N 3.29Å; E69-T71 PolarHBondContact O-N 3.39Å; T71-R73 PolarHBondContact O-N 2.71Å; T71-R74 WeakPolarHBondContact O-CB 3.46Å; T71-R74 PolarHBondContact O-N 3.28Å; T71-L75 HydrophobicContact CG2-CD1 3.94Å; T71-L75 VanDerWaalsContact O-CD1 3.28Å; T71-L75 WeakPolarHBondContact O-CD1 3.37Å; T71-L75 PolarHBondContact O-N 3.49Å
72	M	87.2	Confident	81.3	Confident	127 Å²	127	101.5 Å²	101.5	63%	0.626	54%	0.535	S	S	*	.	H	α-helix	trans	-65	-36.9	177.3	-72.4	-166.1	-144.9	0	0	112.2	L68 E69 R74 L75 G76	L68-M72 HydrophobicContact CB-CE 4.43Å; L68-M72 HydrophobicContact CD2-CE 4.42Å; L68-M72 WeakPolarHBondContact O-CB 3.5Å; L68-M72 WeakPolarHBondContact O-CG 3.34Å; L68-M72 PolarHBondContact O-N 3.29Å; E69-M72 PolarHBondContact O-N 2.72Å; M72-R74 VanDerWaalsContact C-N 3.34Å; M72-L75 PolarHBondContact O-N 3.48Å; M72-G76 WeakPolarHBondContact O-CA 3.47Å; M72-G76 PolarHBondContact O-N 3.33Å
73	R	85.4	Confident	80.1	Confident	162 Å²	162	97.8 Å²	97.8	61%	0.611	52%	0.52	S	S	*	.	H	α-helix	trans	-64.1	-41.4	173.2	-72.8	169.4	96.5	154.8	-0.7	110.3	E69 A70 T71 G76 L77	E69-R73 HydrophobicContact CG-CG 4.42Å; E69-R73 WeakPolarHBondContact O-CB 3.36Å; E69-R73 WeakPolarHBondContact O-CG 3.48Å; E69-R73 PolarHBondContact O-N 3.41Å; E69-R73 IonicContact OE1-CZ 3.72Å; E69-R73 IonicContact OE1-NH1 2.66Å; E69-R73 PolarHBondContact OE1-NH1 3.4Å; A70-R73 PolarHBondContact O-N 3.43Å; T71-R73 PolarHBondContact O-N 2.71Å; R73-G76 PolarHBondContact O-N 2.8Å; R73-L77 VanDerWaalsContact O-CB 3.23Å; R73-L77 WeakPolarHBondContact O-CB 3.49Å; R73-L77 WeakPolarHBondContact O-CG 3.33Å; R73-L77 PolarHBondContact O-N 3.35Å
74	R	83	Confident	79.1	Confident	175 Å²	175	98.1 Å²	98.1	66%	0.66	53%	0.527	S	S	*	.	H	α-helix	trans	-63.1	-46.9	172.8	-70.1	172.2	-174.2	-164.6	2.2	111.5	A70 T71 M72 G76 L77 I78	A70-R74 VanDerWaalsContact O-CG 3.29Å; A70-R74 WeakPolarHBondContact O-CG 3.13Å; A70-R74 PolarHBondContact O-N 3.5Å; T71-R74 WeakPolarHBondContact O-CB 3.46Å; T71-R74 PolarHBondContact O-N 3.28Å; M72-R74 VanDerWaalsContact C-N 3.34Å; R74-G76 PolarHBondContact O-N 2.98Å; R74-L77 PolarHBondContact O-N 2.82Å; R74-I78 WeakPolarHBondContact O-CB 3.14Å; R74-I78 WeakPolarHBondContact O-CD1 3.15Å; R74-I78 WeakPolarHBondContact O-CG1 3.23Å; R74-I78 PolarHBondContact O-N 3.45Å
75	L	83.6	Confident	78.1	Confident	109 Å²	109	105.8 Å²	105.8	57%	0.571	55%	0.546	S	S	*	.	H	α-helix	trans	-64.5	-39.7	177.2	-94.3	70.1	0	0	0	112.4	T71 M72 I78 S79	T71-L75 HydrophobicContact CG2-CD1 3.94Å; T71-L75 VanDerWaalsContact O-CD1 3.28Å; T71-L75 WeakPolarHBondContact O-CD1 3.37Å; T71-L75 PolarHBondContact O-N 3.49Å; M72-L75 PolarHBondContact O-N 3.48Å; L75-I78 PolarHBondContact O-N 2.87Å; L75-S79 WeakPolarHBondContact O-CB 3.41Å; L75-S79 PolarHBondContact O-N 2.75Å
76	G	80.9	Confident	77.3	Confident	34 Å²	34	104.8 Å²	104.8	35%	0.351	55%	0.547	S	S	.	.	H	α-helix	trans	-69.3	-39.1	177.6	0	0	0	0	0	112	M72 R73 R74 S79 R80	M72-G76 WeakPolarHBondContact O-CA 3.47Å; M72-G76 PolarHBondContact O-N 3.33Å; R73-G76 PolarHBondContact O-N 2.8Å; R74-G76 PolarHBondContact O-N 2.98Å; G76-S79 PolarHBondContact O-N 3.49Å; G76-R80 WeakPolarHBondContact O-CB 3.29Å; G76-R80 PolarHBondContact O-N 2.8Å
77	L	71.9	Confident	76.6	Confident	118 Å²	118	104.7 Å²	104.7	62%	0.618	55%	0.549	S	S	*	.	H	α-helix	trans	-65.3	-42.5	169.8	-72.7	170.8	0	0	0	110.7	R73 R74 S79 S81	R73-L77 VanDerWaalsContact O-CB 3.23Å; R73-L77 WeakPolarHBondContact O-CB 3.49Å; R73-L77 WeakPolarHBondContact O-CG 3.33Å; R73-L77 PolarHBondContact O-N 3.35Å; R74-L77 PolarHBondContact O-N 2.82Å; L77-S79 VanDerWaalsContact C-N 3.34Å; L77-S79 PolarHBondContact O-N 2.88Å; L77-S81 WeakPolarHBondContact O-CA 3.45Å; L77-S81 WeakPolarHBondContact O-CB 2.92Å; L77-S81 PolarHBondContact O-N 2.7Å; L77-S81 PolarHBondContact O-OG 2.95Å; L77-S81 VanDerWaalsContact O-OG 3.06Å
78	I	68.4	Low	76.2	Confident	116 Å²	116	105.6 Å²	105.6	60%	0.595	55%	0.551	S	S	*	*	H	α-helix	trans	-66.8	-37.3	176.7	-68.7	160.9	0	0	0	111.1	R74 L75 S81 G82	R74-I78 WeakPolarHBondContact O-CB 3.14Å; R74-I78 WeakPolarHBondContact O-CD1 3.15Å; R74-I78 WeakPolarHBondContact O-CG1 3.23Å; R74-I78 PolarHBondContact O-N 3.45Å; L75-I78 PolarHBondContact O-N 2.87Å; I78-S81 CarbonylContact O-C 3.54Å; I78-G82 PolarHBondContact O-N 3.47Å
79	S	68.7	Low	75.9	Confident	99 Å²	99	108 Å²	108	69%	0.692	55%	0.553	S	S	*	*	H	α-helix	trans	-69.3	-44.2	178.2	-180	0	0	0	0	111.8	L75 G76 L77	L75-S79 WeakPolarHBondContact O-CB 3.41Å; L75-S79 PolarHBondContact O-N 2.75Å; G76-S79 PolarHBondContact O-N 3.49Å; L77-S79 VanDerWaalsContact C-N 3.34Å; L77-S79 PolarHBondContact O-N 2.88Å
80	R	62.6	Low	75.7	Confident	229 Å²	229	110.6 Å²	110.6	86%	0.864	57%	0.569	S	S	*	*	H	α-helix	trans	-81.8	-26.6	175.3	-85.2	173.7	76.4	177.5	3.8	114.2	G76 G82	G76-R80 WeakPolarHBondContact O-CB 3.29Å; G76-R80 PolarHBondContact O-N 2.8Å; R80-G82 VanDerWaalsContact C-N 3.33Å
81	S	58.5	Low	75.7	Confident	82 Å²	82	113.7 Å²	113.7	57%	0.573	58%	0.578	S	S	*	*			trans	-95.2	12.6	175.4	104.5	0	0	0	0	112.4	L77 I78 S83	L77-S81 WeakPolarHBondContact O-CA 3.45Å; L77-S81 WeakPolarHBondContact O-CB 2.92Å; L77-S81 PolarHBondContact O-N 2.7Å; L77-S81 PolarHBondContact O-OG 2.95Å; L77-S81 VanDerWaalsContact O-OG 3.06Å; I78-S81 CarbonylContact O-C 3.54Å; S81-S83 WeakPolarHBondContact O-CA 3.44Å; S81-S83 PolarHBondContact O-N 3.06Å
82	G	58	Low	75.9	Confident	47 Å²	47	115.4 Å²	115.4	49%	0.485	59%	0.585	S	S	.	*	S	Bend	trans	-54.8	82.9	144.4	0	0	0	0	0	106.7	I78 R80 A84	I78-G82 PolarHBondContact O-N 3.47Å; R80-G82 VanDerWaalsContact C-N 3.33Å; G82-A84 PolarHBondContact O-N 2.95Å
83	S	63.8	Low	76.2	Confident	28 Å²	28	116 Å²	116	20%	0.196	58%	0.584	C	S	.	*			trans	-43.2	112.7	-158	177.7	0	0	0	0	110.4	S81 R85 F86 T87	S81-S83 WeakPolarHBondContact O-CA 3.44Å; S81-S83 PolarHBondContact O-N 3.06Å; S83-R85 CarbonylContact O-C 3.56Å; S83-R85 PolarHBondContact O-N 3.47Å; S83-R85 VanDerWaalsContact OG-CB 3.28Å; S83-R85 WeakPolarHBondContact OG-CB 3.45Å; S83-R85 PolarHBondContact OG-N 3.25Å; S83-F86 WeakPolarHBondContact O-CA 3.35Å; S83-F86 PolarHBondContact O-N 3.32Å; S83-F86 PolarHBondContact OG-N 3.42Å; S83-T87 PolarHBondContact O-N 2.92Å; S83-T87 PolarHBondContact O-OG1 3.06Å
84	A	64.5	Low	76.5	Confident	78 Å²	78	110.9 Å²	110.9	65%	0.645	57%	0.573	S	S	*	*	H	α-helix	trans	-49	-27.4	167.8	0	0	0	0	0	110.7	G82 L88	G82-A84 PolarHBondContact O-N 2.95Å; A84-L88 WeakPolarHBondContact O-CB 3.48Å; A84-L88 PolarHBondContact O-N 2.64Å
85	R	68.4	Low	77	Confident	194 Å²	194	109.5 Å²	109.5	73%	0.732	57%	0.572	S	S	*	*	H	α-helix	trans	-68.8	-48.5	170.6	-46.8	177.5	-179.5	148.7	-0.6	112.5	S83 L88 Y89	S83-R85 CarbonylContact O-C 3.56Å; S83-R85 PolarHBondContact O-N 3.47Å; S83-R85 VanDerWaalsContact OG-CB 3.28Å; S83-R85 WeakPolarHBondContact OG-CB 3.45Å; S83-R85 PolarHBondContact OG-N 3.25Å; R85-L88 PolarHBondContact O-N 2.96Å; R85-Y89 HydrophobicContact CB-CD2 4.38Å; R85-Y89 HydrophobicContact CB-CE2 4.16Å; R85-Y89 WeakPolarHBondContact O-CB 3.2Å; R85-Y89 WeakPolarHBondContact O-CD2 3.23Å; R85-Y89 PolarHBondContact O-N 3.25Å
86	F	74.6	Confident	77.5	Confident	151 Å²	151	108.9 Å²	108.9	66%	0.662	57%	0.567	S	S	*	*	H	α-helix	trans	-61.6	-44.8	175.3	-74.1	-60.4	0	0	0	111.6	S83 L88 Y89 L90	S83-F86 WeakPolarHBondContact O-CA 3.35Å; S83-F86 PolarHBondContact O-N 3.32Å; S83-F86 PolarHBondContact OG-N 3.42Å; F86-L88 VanDerWaalsContact C-N 3.32Å; F86-L88 PolarHBondContact O-N 3.34Å; F86-Y89 PolarHBondContact O-N 2.88Å; F86-L90 WeakPolarHBondContact O-CG 3.34Å; F86-L90 PolarHBondContact O-N 2.79Å
87	T	76.8	Confident	78.1	Confident	78 Å²	78	110.7 Å²	110.7	48%	0.479	57%	0.572	S	S	.	*	H	α-helix	trans	-60.7	-41.8	175.3	-51.1	0	0	0	0	111.2	S83 L90 I91	S83-T87 PolarHBondContact O-N 2.92Å; S83-T87 PolarHBondContact O-OG1 3.06Å; T87-L90 PolarHBondContact O-N 3.02Å; T87-I91 HydrophobicContact CG2-CD1 4.23Å; T87-I91 WeakPolarHBondContact O-CG1 3.5Å; T87-I91 PolarHBondContact O-N 3.32Å
88	L	82.7	Confident	79.1	Confident	109 Å²	109	112.2 Å²	112.2	57%	0.571	57%	0.573	S	S	*	*	H	α-helix	trans	-67.2	-39	175.9	-175.2	126.6	0	0	0	112.7	A84 R85 F86 L90 I91 L92	A84-L88 WeakPolarHBondContact O-CB 3.48Å; A84-L88 PolarHBondContact O-N 2.64Å; R85-L88 PolarHBondContact O-N 2.96Å; F86-L88 VanDerWaalsContact C-N 3.32Å; F86-L88 PolarHBondContact O-N 3.34Å; L88-L90 VanDerWaalsContact C-N 3.35Å; L88-I91 PolarHBondContact O-N 3.07Å; L88-L92 WeakPolarHBondContact O-CB 3.32Å; L88-L92 PolarHBondContact O-N 3.28Å
89	Y	87	Confident	80.2	Confident	150 Å²	150	109.4 Å²	109.4	59%	0.588	56%	0.562	S	S	*	*	H	α-helix	trans	-62	-41.4	172.9	-77.8	-62.7	0	0	0	111.5	R85 F86 L92 F93	R85-Y89 HydrophobicContact CB-CD2 4.38Å; R85-Y89 HydrophobicContact CB-CE2 4.16Å; R85-Y89 WeakPolarHBondContact O-CB 3.2Å; R85-Y89 WeakPolarHBondContact O-CD2 3.23Å; R85-Y89 PolarHBondContact O-N 3.25Å; F86-Y89 PolarHBondContact O-N 2.88Å; Y89-L92 PolarHBondContact O-N 3.4Å; Y89-F93 WeakPolarHBondContact O-CB 3.46Å; Y89-F93 PolarHBondContact O-N 3.46Å
90	L	86.8	Confident	81.3	Confident	124 Å²	124	110 Å²	110	65%	0.649	56%	0.555	S	S	*	*	H	α-helix	trans	-64.9	-40	175.5	-69.8	-169.4	0	0	0	112.3	F86 T87 L88 S94	F86-L90 WeakPolarHBondContact O-CG 3.34Å; F86-L90 PolarHBondContact O-N 2.79Å; T87-L90 PolarHBondContact O-N 3.02Å; L88-L90 VanDerWaalsContact C-N 3.35Å; L90-S94 WeakPolarHBondContact O-CB 3.43Å; L90-S94 PolarHBondContact O-N 2.79Å
91	I	89.3	Confident	82.7	Confident	110 Å²	110	104.9 Å²	104.9	56%	0.564	54%	0.542	S	S	*	.	H	α-helix	trans	-64.6	-46.5	175.5	-69	165.4	0	0	0	110.9	T87 L88 S94 F95	T87-I91 HydrophobicContact CG2-CD1 4.23Å; T87-I91 WeakPolarHBondContact O-CG1 3.5Å; T87-I91 PolarHBondContact O-N 3.32Å; L88-I91 PolarHBondContact O-N 3.07Å; I91-S94 WeakPolarHBondContact O-CB 3.21Å; I91-S94 PolarHBondContact O-N 3.27Å; I91-F95 PolarHBondContact O-N 3.44Å
92	L	91.7	Very high	84.3	Confident	104 Å²	104	107.3 Å²	107.3	55%	0.545	54%	0.54	S	S	.	.	H	α-helix	trans	-63.1	-45.1	179.1	-163	169.7	0	0	0	110.7	L88 Y89 S94 F95 M96	L88-L92 WeakPolarHBondContact O-CB 3.32Å; L88-L92 PolarHBondContact O-N 3.28Å; Y89-L92 PolarHBondContact O-N 3.4Å; L92-S94 PolarHBondContact O-N 2.89Å; L92-F95 PolarHBondContact O-N 3.24Å; L92-M96 WeakPolarHBondContact O-CB 2.94Å; L92-M96 PolarHBondContact O-N 2.94Å
93	F	93.4	Very high	86	Confident	139 Å²	139	112.6 Å²	112.6	61%	0.61	55%	0.546	S	S	*	.	H	α-helix	trans	-57.9	-47.1	175.3	179.5	-100.5	0	0	0	111.7	Y89 F95 M96 V97	Y89-F93 WeakPolarHBondContact O-CB 3.46Å; Y89-F93 PolarHBondContact O-N 3.46Å; F93-F95 PolarHBondContact O-N 2.86Å; F93-M96 PolarHBondContact O-N 3.35Å; F93-V97 HydrophobicContact CE1-CG2 4.21Å; F93-V97 HydrophobicContact CZ-CG2 4.19Å; F93-V97 WeakPolarHBondContact O-CG2 3.28Å; F93-V97 PolarHBondContact O-N 3.44Å; F93-V97 VanDerWaalsContact O-N 3.07Å
94	S	91.8	Very high	87.3	Confident	55 Å²	55	118.4 Å²	118.4	39%	0.385	57%	0.572	S	S	.	*	H	α-helix	trans	-58.2	-47.2	175.3	-176.6	0	0	0	0	111.7	L90 I91 L92 M96 V97 F98	L90-S94 WeakPolarHBondContact O-CB 3.43Å; L90-S94 PolarHBondContact O-N 2.79Å; I91-S94 WeakPolarHBondContact O-CB 3.21Å; I91-S94 PolarHBondContact O-N 3.27Å; L92-S94 PolarHBondContact O-N 2.89Å; S94-M96 VanDerWaalsContact C-N 3.33Å; S94-M96 PolarHBondContact O-N 3.03Å; S94-V97 PolarHBondContact O-N 3.27Å; S94-F98 WeakPolarHBondContact O-CD2 3.41Å; S94-F98 PolarHBondContact O-N 2.93Å
95	F	94	Very high	88.5	Confident	145 Å²	145	120.8 Å²	120.8	64%	0.636	57%	0.573	S	S	*	*	H	α-helix	trans	-61.8	-40.8	178.6	-160	-97.7	0	0	0	112.3	I91 L92 F93 V97 F98 V99	I91-F95 PolarHBondContact O-N 3.44Å; L92-F95 PolarHBondContact O-N 3.24Å; F93-F95 PolarHBondContact O-N 2.86Å; F95-V97 PolarHBondContact O-N 3.5Å; F95-F98 PolarHBondContact O-N 3.41Å; F95-V99 HydrophobicContact CD1-CG2 3.93Å; F95-V99 HydrophobicContact CE1-CG2 3.79Å; F95-V99 VanDerWaalsContact O-CG2 3.3Å; F95-V99 WeakPolarHBondContact O-CG2 3.49Å; F95-V99 PolarHBondContact O-N 2.9Å
96	M	93.4	Very high	89.5	Confident	97 Å²	97	120.5 Å²	120.5	48%	0.478	57%	0.572	S	S	.	*	H	α-helix	trans	-62	-43.1	177.4	-163.2	-79.2	177.7	0	0	111.5	L92 F93 S94 V99 M100	L92-M96 WeakPolarHBondContact O-CB 2.94Å; L92-M96 PolarHBondContact O-N 2.94Å; F93-M96 PolarHBondContact O-N 3.35Å; S94-M96 VanDerWaalsContact C-N 3.33Å; S94-M96 PolarHBondContact O-N 3.03Å; M96-V99 PolarHBondContact O-N 3.21Å; M96-M100 HydrophobicContact CE-CE 3.51Å; M96-M100 HydrophobicContact CE-CG 3.93Å; M96-M100 PolarHBondContact O-N 2.9Å; M96-M100 HydrophobicContact SD-CG 3.8Å
97	V	93.2	Very high	89.5	Confident	72 Å²	72	126.2 Å²	126.2	44%	0.436	59%	0.589	S	S	.	*	H	α-helix	trans	-63.6	-44.1	174.8	173.4	0	0	0	0	111.6	F93 S94 F95 V99 M100 M101	F93-V97 HydrophobicContact CE1-CG2 4.21Å; F93-V97 HydrophobicContact CZ-CG2 4.19Å; F93-V97 WeakPolarHBondContact O-CG2 3.28Å; F93-V97 PolarHBondContact O-N 3.44Å; F93-V97 VanDerWaalsContact O-N 3.07Å; S94-V97 PolarHBondContact O-N 3.27Å; F95-V97 PolarHBondContact O-N 3.5Å; V97-V99 VanDerWaalsContact C-N 3.34Å; V97-V99 PolarHBondContact O-N 3.49Å; V97-M100 PolarHBondContact O-N 3.4Å; V97-M101 WeakPolarHBondContact O-CB 3.45Å; V97-M101 PolarHBondContact O-N 3.43Å
98	F	93.7	Very high	90.2	Very high	150 Å²	150	128.7 Å²	128.7	66%	0.658	60%	0.595	S	S	*	*	H	α-helix	trans	-60	-42.9	175.5	-93.5	-76.9	0	0	0	112.4	S94 F95 M101 Y102	S94-F98 WeakPolarHBondContact O-CD2 3.41Å; S94-F98 PolarHBondContact O-N 2.93Å; F95-F98 PolarHBondContact O-N 3.41Å; F98-M101 PolarHBondContact O-N 2.9Å; F98-Y102 WeakPolarHBondContact O-CB 3.03Å; F98-Y102 PolarHBondContact O-N 2.93Å
99	V	91.9	Very high	90.5	Very high	57 Å²	57	129.7 Å²	129.7	35%	0.345	60%	0.596	S	S	.	*	H	α-helix	trans	-64.5	-47.2	176.8	170.6	0	0	0	0	110.7	F95 M96 V97 M101 Y102 Y103	F95-V99 HydrophobicContact CD1-CG2 3.93Å; F95-V99 HydrophobicContact CE1-CG2 3.79Å; F95-V99 VanDerWaalsContact O-CG2 3.3Å; F95-V99 WeakPolarHBondContact O-CG2 3.49Å; F95-V99 PolarHBondContact O-N 2.9Å; M96-V99 PolarHBondContact O-N 3.21Å; V97-V99 VanDerWaalsContact C-N 3.34Å; V97-V99 PolarHBondContact O-N 3.49Å; V99-M101 VanDerWaalsContact C-N 3.31Å; V99-M101 PolarHBondContact O-N 3.33Å; V99-Y102 PolarHBondContact O-N 3.45Å; V99-Y103 HydrophobicContact CG1-CD2 3.59Å; V99-Y103 HydrophobicContact CG1-CE2 3.63Å; V99-Y103 VanDerWaalsContact O-CD2 3.31Å; V99-Y103 WeakPolarHBondContact O-CD2 3.31Å; V99-Y103 PolarHBondContact O-N 2.92Å
100	M	91.1	Very high	90.7	Very high	112 Å²	112	128.6 Å²	128.6	55%	0.552	60%	0.596	S	S	*	*	H	α-helix	trans	-57.6	-44.3	176.1	-83.8	-67.7	172.7	0	0	111.9	M96 V97 Y103 M104	M96-M100 HydrophobicContact CE-CE 3.51Å; M96-M100 HydrophobicContact CE-CG 3.93Å; M96-M100 PolarHBondContact O-N 2.9Å; M96-M100 HydrophobicContact SD-CG 3.8Å; V97-M100 PolarHBondContact O-N 3.4Å; M100-Y103 PolarHBondContact O-N 3.3Å; M100-M104 WeakPolarHBondContact O-CB 3.3Å; M100-M104 PolarHBondContact O-N 3.24Å
101	M	91.4	Very high	91	Very high	121 Å²	121	128.8 Å²	128.8	60%	0.596	59%	0.593	S	S	*	*	H	α-helix	trans	-64.6	-42.8	176.5	-170.4	154.9	-177.8	0	0	112	V97 F98 V99 Y103 M104 L105	V97-M101 WeakPolarHBondContact O-CB 3.45Å; V97-M101 PolarHBondContact O-N 3.43Å; F98-M101 PolarHBondContact O-N 2.9Å; V99-M101 VanDerWaalsContact C-N 3.31Å; V99-M101 PolarHBondContact O-N 3.33Å; M101-Y103 PolarHBondContact O-N 3.49Å; M101-M104 PolarHBondContact O-N 2.92Å; M101-L105 HydrophobicContact CE-CD1 3.91Å; M101-L105 HydrophobicContact CG-CD1 3.53Å; M101-L105 VanDerWaalsContact O-CD1 3.23Å; M101-L105 WeakPolarHBondContact O-CD1 3.37Å; M101-L105 PolarHBondContact O-N 2.94Å
102	Y	93.5	Very high	91.1	Very high	133 Å²	133	130 Å²	130	52%	0.522	60%	0.595	S	S	.	*	H	α-helix	trans	-61.5	-43.6	175.6	179.8	-96.5	0	0	0	112.4	F98 V99 M104 L105 R106	F98-Y102 WeakPolarHBondContact O-CB 3.03Å; F98-Y102 PolarHBondContact O-N 2.93Å; V99-Y102 PolarHBondContact O-N 3.45Å; Y102-M104 VanDerWaalsContact C-N 3.34Å; Y102-M104 PolarHBondContact O-N 2.88Å; Y102-L105 PolarHBondContact O-N 2.97Å; Y102-R106 VanDerWaalsContact O-CB 3.24Å; Y102-R106 WeakPolarHBondContact O-CB 3.24Å; Y102-R106 PolarHBondContact O-N 2.98Å; Y102-R106 PolarHBondContact OH-NH1 3.37Å
103	Y	93.1	Very high	91	Very high	158 Å²	158	131.7 Å²	131.7	62%	0.62	60%	0.599	S	S	*	*	H	α-helix	trans	-64.2	-38.3	175.4	-88.8	-78.1	0	0	0	112	V99 M100 M101 R107	V99-Y103 HydrophobicContact CG1-CD2 3.59Å; V99-Y103 HydrophobicContact CG1-CE2 3.63Å; V99-Y103 VanDerWaalsContact O-CD2 3.31Å; V99-Y103 WeakPolarHBondContact O-CD2 3.31Å; V99-Y103 PolarHBondContact O-N 2.92Å; M100-Y103 PolarHBondContact O-N 3.3Å; M101-Y103 PolarHBondContact O-N 3.49Å; Y103-R107 WeakPolarHBondContact O-CB 3.16Å; Y103-R107 PolarHBondContact O-N 2.9Å
104	M	91.4	Very high	90.9	Very high	150 Å²	150	131.2 Å²	131.2	74%	0.739	60%	0.598	S	S	*	*	H	α-helix	trans	-72.4	-31	179	-153.7	-163.1	104.9	0	0	113.1	M100 M101 Y102	M100-M104 WeakPolarHBondContact O-CB 3.3Å; M100-M104 PolarHBondContact O-N 3.24Å; M101-M104 PolarHBondContact O-N 2.92Å; Y102-M104 VanDerWaalsContact C-N 3.34Å; Y102-M104 PolarHBondContact O-N 2.88Å
105	L	90.1	Very high	90.8	Very high	128 Å²	128	137.1 Å²	137.1	67%	0.67	61%	0.614	S	S	*	*	H	α-helix	trans	-80.1	-28.4	173.7	-91.2	109.6	0	0	0	113.3	M101 Y102	M101-L105 HydrophobicContact CE-CD1 3.91Å; M101-L105 HydrophobicContact CG-CD1 3.53Å; M101-L105 VanDerWaalsContact O-CD1 3.23Å; M101-L105 WeakPolarHBondContact O-CD1 3.37Å; M101-L105 PolarHBondContact O-N 2.94Å; Y102-L105 PolarHBondContact O-N 2.97Å
106	R	89.7	Confident	90.5	Very high	188 Å²	188	136.4 Å²	136.4	71%	0.709	61%	0.612	S	S	*	*	H	α-helix	trans	-86.1	-20.5	178.8	-174.4	169.3	176	177.1	-3.4	112.9	Y102	Y102-R106 VanDerWaalsContact O-CB 3.24Å; Y102-R106 WeakPolarHBondContact O-CB 3.24Å; Y102-R106 PolarHBondContact O-N 2.98Å; Y102-R106 PolarHBondContact OH-NH1 3.37Å
107	R	74	Confident	90.3	Very high	271 Å²	271	140 Å²	140	100%	1.023	63%	0.625	S	S	*	*			trans	-82.4	0	171.9	-178.2	73.5	169.9	136.2	0.3	110.4	Y103	Y103-R107 WeakPolarHBondContact O-CB 3.16Å; Y103-R107 PolarHBondContact O-N 2.9Å

Retrieved 107 of 107 residues in 195.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).