A0A077ZCF0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZCF0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 124 aa.

						>A0A077ZCF0_TRITR|A0A077ZCF0
MTHNSSEADVLSVPNARPSRRANRNRRRNRHLRRQKKHLTRRLNRKKINRMRKRLLKKHKRQTDTADEQMDVDLVIPTDNVEQPANDADMKETVNSEPGVECLAVSKDAKHRKRKKERQHRSLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.7	Low	61.2	Low	233 Å²	233	149.1 Å²	149.1	100%	1.148	84%	0.84	S	S	*	*				0	101	0	-71.6	-151.5	173.4	0	0	108.8
2	T	60.7	Low	61.7	Low	123 Å²	123	145.5 Å²	145.5	76%	0.755	83%	0.832	S	S	*	*			trans	-152.8	91.4	167.3	40.9	0	0	0	0	107.5	N4	T2-N4 PolarHBondContact O-N 2.95Å
3	H	61.4	Low	62.3	Low	182 Å²	182	143.6 Å²	143.6	84%	0.843	82%	0.824	S	S	*	*			trans	-81.2	104.2	170.6	-72.5	-76	0	0	0	108	S5	H3-S5 PolarHBondContact O-N 3.05Å
4	N	64.1	Low	62.8	Low	162 Å²	162	140.6 Å²	140.6	87%	0.866	81%	0.812	S	S	*	*			trans	-74.9	86.8	173.1	-65.8	-25.1	0	0	0	109.2	T2	T2-N4 PolarHBondContact O-N 2.95Å
5	S	61.9	Low	63.3	Low	112 Å²	112	142.3 Å²	142.3	78%	0.783	82%	0.817	S	S	*	*			trans	-103.6	96.4	168.8	56.5	0	0	0	0	109	H3	H3-S5 PolarHBondContact O-N 3.05Å
6	S	64.6	Low	64	Low	116 Å²	116	138.8 Å²	138.8	81%	0.811	81%	0.811	S	S	*	*			trans	-149.1	7.1	171.9	-165.8	0	0	0	0	116.8
7	E	59.5	Low	65.2	Low	185 Å²	185	144.7 Å²	144.7	86%	0.864	82%	0.816	S	S	*	*	S	Bend	trans	-118.7	0	-179.3	-68.3	-172.4	178.4	0	0	115.1
8	A	60.1	Low	66.3	Low	97 Å²	97	139.5 Å²	139.5	80%	0.802	79%	0.789	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	-14.2	-176.8	0	0	0	0	0	115	V10	A8-V10 PolarHBondContact O-N 2.85Å
9	D	60.9	Low	67.6	Low	152 Å²	152	135.9 Å²	135.9	81%	0.813	77%	0.774	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	19.3	-172.8	-75	-20.4	0	0	0	114.7	L11	D9-L11 PolarHBondContact O-N 3.31Å
10	V	63.7	Low	68.9	Low	125 Å²	125	139.6 Å²	139.6	76%	0.758	78%	0.775	S	S	*	*			trans	-74.5	83.1	159.4	-171.7	0	0	0	0	106.7	A8 S12	A8-V10 PolarHBondContact O-N 2.85Å; V10-S12 VanDerWaalsContact C-N 3.32Å; V10-S12 PolarHBondContact O-N 3.25Å
11	L	64	Low	70.2	Confident	153 Å²	153	141.9 Å²	141.9	80%	0.801	77%	0.772	S	S	*	*			trans	-47.1	103.7	166.1	-72.2	170	0	0	0	107	D9 V13	D9-L11 PolarHBondContact O-N 3.31Å; L11-V13 PolarHBondContact O-N 3.02Å
12	S	67.8	Low	72.2	Confident	106 Å²	106	132.4 Å²	132.4	74%	0.741	73%	0.73	S	S	*	*			trans	-59.8	97.3	173.4	-179.8	0	0	0	0	105.4	V10 P14	V10-S12 VanDerWaalsContact C-N 3.32Å; V10-S12 PolarHBondContact O-N 3.25Å; S12-P14 WeakPolarHBondContact O-CD 3.49Å
13	V	69.8	Low	73.9	Confident	121 Å²	121	129.4 Å²	129.4	73%	0.733	71%	0.71	S	S	*	*			trans	-55.6	108.9	174.6	177.4	0	0	0	0	103.8	L11 N15	L11-V13 PolarHBondContact O-N 3.02Å; V13-N15 PolarHBondContact O-N 2.72Å
14	P	68.4	Low	75.6	Confident	101 Å²	101	128 Å²	128	66%	0.656	70%	0.697	S	S	*	*			trans	-57.5	135.1	-174.5	20.4	-29.2	0	0	0	106.1	S12 A16	S12-P14 WeakPolarHBondContact O-CD 3.49Å; P14-A16 WeakPolarHBondContact O-CA 3.29Å; P14-A16 PolarHBondContact O-N 2.89Å
15	N	70.1	Confident	77.2	Confident	166 Å²	166	123.4 Å²	123.4	89%	0.888	67%	0.673	S	S	*	*			trans	-51.6	85.3	176.3	-84.3	-42.4	0	0	0	108.9	V13 R17	V13-N15 PolarHBondContact O-N 2.72Å; N15-R17 PolarHBondContact O-N 2.92Å
16	A	75.5	Confident	78.8	Confident	86 Å²	86	124.5 Å²	124.5	71%	0.711	66%	0.66	S	S	*	*			trans	-72.7	107.2	-165.2	0	0	0	0	0	105.7	P14 P18	P14-A16 WeakPolarHBondContact O-CA 3.29Å; P14-A16 PolarHBondContact O-N 2.89Å; A16-P18 WeakPolarHBondContact O-CD 3.18Å
17	R	83.8	Confident	80.4	Confident	240 Å²	240	128.1 Å²	128.1	91%	0.906	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-53	121.9	176.6	-76.4	-176.6	173.4	-175.2	-1	107.1	N15 S19	N15-R17 PolarHBondContact O-N 2.92Å; R17-S19 PolarHBondContact O-N 2.73Å
18	P	85.3	Confident	82.2	Confident	51 Å²	51	126.9 Å²	126.9	33%	0.331	64%	0.643	S	S	.	*	P	Polyproline II helix	trans	-59.8	129.9	-176.9	21.8	-31.9	0	0	0	109	A16 A22 N23	A16-P18 WeakPolarHBondContact O-CD 3.18Å; P18-A22 HydrophobicContact CB-CB 4.19Å; P18-N23 WeakPolarHBondContact CG-OD1 3.46Å; P18-N23 PolarHBondContact O-ND2 3.3Å
19	S	91.7	Very high	84	Confident	71 Å²	71	126.4 Å²	126.4	50%	0.497	63%	0.627	S	S	.	*	P	Polyproline II helix	trans	-56.9	157.3	178.1	72.4	0	0	0	0	111.3	R17 R21 A22 N23	R17-S19 PolarHBondContact O-N 2.73Å; S19-R21 PolarHBondContact O-N 3.45Å; S19-R21 VanDerWaalsContact O-N 3.15Å; S19-A22 WeakPolarHBondContact O-CB 3.44Å; S19-A22 PolarHBondContact O-N 3.32Å; S19-A22 PolarHBondContact OG-N 3.26Å; S19-A22 VanDerWaalsContact OG-N 3.17Å; S19-N23 PolarHBondContact O-N 2.95Å
20	R	93.2	Very high	85.7	Confident	210 Å²	210	127 Å²	127	79%	0.792	62%	0.618	S	S	*	*	H	α-helix	trans	-52.7	-37.7	174.5	-70.4	178.9	176.2	144.1	-2.7	111.6	N23 R24	R20-N23 PolarHBondContact O-N 2.75Å; R20-R24 WeakPolarHBondContact O-CG 3.36Å; R20-R24 PolarHBondContact O-N 3.23Å
21	R	95.7	Very high	87.4	Confident	187 Å²	187	126.2 Å²	126.2	71%	0.706	61%	0.605	S	S	*	*	H	α-helix	trans	-65.3	-45.2	176.1	-169.4	175.2	-176.2	175.1	0.1	111.9	S19 N23 R24 N25	S19-R21 PolarHBondContact O-N 3.45Å; S19-R21 VanDerWaalsContact O-N 3.15Å; R21-N23 VanDerWaalsContact C-N 3.33Å; R21-N23 PolarHBondContact O-N 3.47Å; R21-R24 PolarHBondContact O-N 3.35Å; R21-N25 PolarHBondContact O-N 3.48Å
22	A	94.6	Very high	89	Confident	34 Å²	34	123.5 Å²	123.5	28%	0.281	59%	0.591	S	S	.	*	H	α-helix	trans	-60.1	-43.1	175.7	0	0	0	0	0	111.8	P18 S19 N25 R26	P18-A22 HydrophobicContact CB-CB 4.19Å; S19-A22 WeakPolarHBondContact O-CB 3.44Å; S19-A22 PolarHBondContact O-N 3.32Å; S19-A22 PolarHBondContact OG-N 3.26Å; S19-A22 VanDerWaalsContact OG-N 3.17Å; A22-N25 PolarHBondContact O-N 3.48Å; A22-R26 WeakPolarHBondContact O-CG 3.48Å; A22-R26 PolarHBondContact O-N 3.38Å
23	N	95.9	Very high	90.4	Very high	61 Å²	61	127.6 Å²	127.6	33%	0.326	59%	0.59	S	S	.	*	H	α-helix	trans	-66	-40.8	177.3	-75.6	-30.3	0	0	0	113.1	P18 S19 R20 R21 R26 R27	P18-N23 WeakPolarHBondContact CG-OD1 3.46Å; P18-N23 PolarHBondContact O-ND2 3.3Å; S19-N23 PolarHBondContact O-N 2.95Å; R20-N23 PolarHBondContact O-N 2.75Å; R21-N23 VanDerWaalsContact C-N 3.33Å; R21-N23 PolarHBondContact O-N 3.47Å; N23-R26 PolarHBondContact O-N 3.4Å; N23-R27 WeakPolarHBondContact O-CG 3.35Å; N23-R27 PolarHBondContact O-N 3.16Å
24	R	96.9	Very high	91.7	Very high	151 Å²	151	130.9 Å²	130.9	57%	0.57	59%	0.59	S	S	*	*	H	α-helix	trans	-60.2	-45.3	172.6	-71.7	175.8	-161.3	156	2	111.3	R20 R21 R26 R27 R28	R20-R24 WeakPolarHBondContact O-CG 3.36Å; R20-R24 PolarHBondContact O-N 3.23Å; R21-R24 PolarHBondContact O-N 3.35Å; R24-R26 PolarHBondContact O-N 3.38Å; R24-R27 PolarHBondContact O-N 3.48Å; R24-R28 WeakPolarHBondContact O-CG 3.46Å; R24-R28 PolarHBondContact O-N 2.99Å
25	N	97.1	Very high	93.1	Very high	67 Å²	67	130.9 Å²	130.9	36%	0.358	58%	0.581	S	S	.	*	H	α-helix	trans	-63.3	-42	177.8	-73.5	-8	0	0	0	111.9	R21 A22 R27 R28 N29	R21-N25 PolarHBondContact O-N 3.48Å; A22-N25 PolarHBondContact O-N 3.48Å; N25-R27 VanDerWaalsContact C-N 3.35Å; N25-R27 PolarHBondContact O-N 3.5Å; N25-R28 PolarHBondContact O-N 2.99Å; N25-N29 WeakPolarHBondContact O-CB 3.49Å; N25-N29 VanDerWaalsContact O-CG 3.23Å; N25-N29 PolarHBondContact O-N 3.3Å; N25-N29 PolarHBondContact O-ND2 3.5Å
26	R	96.4	Very high	94.4	Very high	134 Å²	134	130.4 Å²	130.4	51%	0.506	57%	0.571	S	S	.	*	H	α-helix	trans	-58.7	-44.2	173.4	-73.7	174.3	-177.9	177.3	-1.5	111.9	A22 N23 R24 N29 R30	A22-R26 WeakPolarHBondContact O-CG 3.48Å; A22-R26 PolarHBondContact O-N 3.38Å; N23-R26 PolarHBondContact O-N 3.4Å; R24-R26 PolarHBondContact O-N 3.38Å; R26-N29 PolarHBondContact O-N 2.98Å; R26-R30 VanDerWaalsContact O-CG 3.3Å; R26-R30 WeakPolarHBondContact O-CG 3.46Å; R26-R30 PolarHBondContact O-N 3.08Å
27	R	97.1	Very high	95.5	Very high	193 Å²	193	132.2 Å²	132.2	73%	0.728	56%	0.563	S	S	*	*	H	α-helix	trans	-63.1	-46.8	176.8	-71.3	178.3	-176.8	-171.3	1	111.7	N23 R24 N25 R30 H31	N23-R27 WeakPolarHBondContact O-CG 3.35Å; N23-R27 PolarHBondContact O-N 3.16Å; R24-R27 PolarHBondContact O-N 3.48Å; N25-R27 VanDerWaalsContact C-N 3.35Å; N25-R27 PolarHBondContact O-N 3.5Å; R27-R30 PolarHBondContact O-N 3.24Å; R27-H31 PolarHBondContact O-N 2.81Å
28	R	97.4	Very high	96.2	Very high	158 Å²	158	126.8 Å²	126.8	60%	0.596	55%	0.547	S	S	*	.	H	α-helix	trans	-58.4	-48.6	175.2	-72	176.3	-177.1	168.3	-4	111.5	R24 N25 R30 H31 L32	R24-R28 WeakPolarHBondContact O-CG 3.46Å; R24-R28 PolarHBondContact O-N 2.99Å; N25-R28 PolarHBondContact O-N 2.99Å; R28-R30 VanDerWaalsContact C-N 3.34Å; R28-R30 PolarHBondContact O-N 2.93Å; R28-H31 WeakPolarHBondContact O-CB 3.38Å; R28-H31 PolarHBondContact O-N 2.91Å; R28-H31 VanDerWaalsContact O-N 3.09Å; R28-L32 WeakPolarHBondContact O-CG 3.3Å; R28-L32 PolarHBondContact O-N 2.69Å
29	N	97.9	Very high	96.8	Very high	87 Å²	87	129 Å²	129	47%	0.465	56%	0.556	S	S	.	*	H	α-helix	trans	-61.9	-39.9	179.1	-72.5	-13.8	0	0	0	112.4	N25 R26 L32 R33	N25-N29 WeakPolarHBondContact O-CB 3.49Å; N25-N29 VanDerWaalsContact O-CG 3.23Å; N25-N29 PolarHBondContact O-N 3.3Å; N25-N29 PolarHBondContact O-ND2 3.5Å; R26-N29 PolarHBondContact O-N 2.98Å; N29-L32 PolarHBondContact O-N 3.13Å; N29-R33 WeakPolarHBondContact O-CB 3.48Å; N29-R33 VanDerWaalsContact O-CG 3.23Å; N29-R33 WeakPolarHBondContact O-CG 3.37Å; N29-R33 PolarHBondContact O-N 2.79Å
30	R	97.9	Very high	97	Very high	166 Å²	166	128.9 Å²	128.9	63%	0.626	55%	0.553	S	S	*	*	H	α-helix	trans	-62	-43.5	173.1	-74.1	175.5	-173.9	178.4	1.6	111.6	R26 R27 R28 R33 R34	R26-R30 VanDerWaalsContact O-CG 3.3Å; R26-R30 WeakPolarHBondContact O-CG 3.46Å; R26-R30 PolarHBondContact O-N 3.08Å; R27-R30 PolarHBondContact O-N 3.24Å; R28-R30 VanDerWaalsContact C-N 3.34Å; R28-R30 PolarHBondContact O-N 2.93Å; R30-R33 PolarHBondContact O-N 3.19Å; R30-R34 WeakPolarHBondContact O-CG 3.37Å; R30-R34 PolarHBondContact O-N 2.88Å; R30-R34 VanDerWaalsContact O-N 3.09Å
31	H	98.1	Very high	97.3	Very high	107 Å²	107	126.6 Å²	126.6	50%	0.495	54%	0.544	S	S	.	.	H	α-helix	trans	-63.3	-48.2	177.4	-174.4	74.1	0	0	0	111.8	R27 R28 R33 R34 Q35	R27-H31 PolarHBondContact O-N 2.81Å; R28-H31 WeakPolarHBondContact O-CB 3.38Å; R28-H31 PolarHBondContact O-N 2.91Å; R28-H31 VanDerWaalsContact O-N 3.09Å; H31-R33 VanDerWaalsContact C-N 3.33Å; H31-R33 PolarHBondContact O-N 3.29Å; H31-R34 WeakPolarHBondContact O-CB 3.42Å; H31-R34 PolarHBondContact O-N 3.32Å; H31-R34 VanDerWaalsContact O-N 3.09Å; H31-Q35 PolarHBondContact NE2-NE2 2.83Å; H31-Q35 PolarHBondContact O-N 3.29Å
32	L	98	Very high	97.4	Very high	97 Å²	97	124.8 Å²	124.8	51%	0.508	54%	0.537	S	S	.	.	H	α-helix	trans	-59.3	-41.7	176.6	-69.7	172.6	0	0	0	112.1	R28 N29 R34 Q35 K36	R28-L32 WeakPolarHBondContact O-CG 3.3Å; R28-L32 PolarHBondContact O-N 2.69Å; N29-L32 PolarHBondContact O-N 3.13Å; L32-R34 VanDerWaalsContact C-N 3.34Å; L32-R34 PolarHBondContact O-N 3.34Å; L32-Q35 PolarHBondContact O-N 3.1Å; L32-K36 WeakPolarHBondContact O-CB 3.37Å; L32-K36 PolarHBondContact O-N 3.26Å
33	R	98	Very high	97.5	Very high	191 Å²	191	127.7 Å²	127.7	72%	0.721	55%	0.547	S	S	*	.	H	α-helix	trans	-60.3	-42.4	174.4	-75.1	175.2	-172	-160.2	2.7	111.9	N29 R30 H31 K37	N29-R33 WeakPolarHBondContact O-CB 3.48Å; N29-R33 VanDerWaalsContact O-CG 3.23Å; N29-R33 WeakPolarHBondContact O-CG 3.37Å; N29-R33 PolarHBondContact O-N 2.79Å; R30-R33 PolarHBondContact O-N 3.19Å; H31-R33 VanDerWaalsContact C-N 3.33Å; H31-R33 PolarHBondContact O-N 3.29Å; R33-K37 WeakPolarHBondContact O-CB 3.45Å; R33-K37 PolarHBondContact O-N 3.1Å
34	R	97.8	Very high	97.6	Very high	190 Å²	190	129 Å²	129	72%	0.717	55%	0.554	S	S	*	*	H	α-helix	trans	-65.4	-45.2	176.6	-71.2	176.1	-179.6	-174.3	-0.7	111.6	R30 H31 L32 K37 H38	R30-R34 WeakPolarHBondContact O-CG 3.37Å; R30-R34 PolarHBondContact O-N 2.88Å; R30-R34 VanDerWaalsContact O-N 3.09Å; H31-R34 WeakPolarHBondContact O-CB 3.42Å; H31-R34 PolarHBondContact O-N 3.32Å; H31-R34 VanDerWaalsContact O-N 3.09Å; L32-R34 VanDerWaalsContact C-N 3.34Å; L32-R34 PolarHBondContact O-N 3.34Å; R34-K37 PolarHBondContact O-N 3.36Å; R34-H38 WeakPolarHBondContact O-CB 3.4Å; R34-H38 PolarHBondContact O-N 2.96Å
35	Q	97.8	Very high	97.6	Very high	101 Å²	101	130.3 Å²	130.3	47%	0.472	56%	0.559	S	S	.	*	H	α-helix	trans	-60.9	-48.9	176.7	-74	-173	-25.3	0	0	111.8	H31 L32 K37 H38 L39	H31-Q35 PolarHBondContact NE2-NE2 2.83Å; H31-Q35 PolarHBondContact O-N 3.29Å; L32-Q35 PolarHBondContact O-N 3.1Å; Q35-K37 PolarHBondContact O-N 3.2Å; Q35-H38 PolarHBondContact O-N 3.1Å; Q35-L39 WeakPolarHBondContact O-CB 3.36Å; Q35-L39 PolarHBondContact O-N 2.87Å
36	K	97.5	Very high	97.6	Very high	157 Å²	157	131.9 Å²	131.9	68%	0.683	56%	0.563	S	S	*	*	H	α-helix	trans	-56.4	-48.9	176.5	-174.7	175.6	-179.6	176.7	0	111.1	L32 H38 L39 T40	L32-K36 WeakPolarHBondContact O-CB 3.37Å; L32-K36 PolarHBondContact O-N 3.26Å; K36-H38 VanDerWaalsContact C-N 3.34Å; K36-H38 PolarHBondContact O-N 2.9Å; K36-L39 PolarHBondContact O-N 3.3Å; K36-T40 PolarHBondContact O-N 2.91Å; K36-T40 PolarHBondContact O-OG1 3.46Å
37	K	97.3	Very high	97.7	Very high	124 Å²	124	131.9 Å²	131.9	54%	0.539	57%	0.567	S	S	.	*	H	α-helix	trans	-58.6	-43.4	177.1	-175.9	176.7	-177.2	176.3	0	112.2	R33 R34 Q35 R41	R33-K37 WeakPolarHBondContact O-CB 3.45Å; R33-K37 PolarHBondContact O-N 3.1Å; R34-K37 PolarHBondContact O-N 3.36Å; Q35-K37 PolarHBondContact O-N 3.2Å; K37-R41 WeakPolarHBondContact O-CG 3.37Å; K37-R41 PolarHBondContact O-N 3.44Å; K37-R41 VanDerWaalsContact O-N 3.12Å
38	H	97.7	Very high	97.7	Very high	125 Å²	125	126.1 Å²	126.1	58%	0.579	55%	0.55	S	S	*	.	H	α-helix	trans	-65.4	-45	178.1	-177.2	78.4	0	0	0	111.8	R34 Q35 K36 R41 R42	R34-H38 WeakPolarHBondContact O-CB 3.4Å; R34-H38 PolarHBondContact O-N 2.96Å; Q35-H38 PolarHBondContact O-N 3.1Å; K36-H38 VanDerWaalsContact C-N 3.34Å; K36-H38 PolarHBondContact O-N 2.9Å; H38-R41 PolarHBondContact O-N 2.89Å; H38-R42 WeakPolarHBondContact O-CB 3.42Å; H38-R42 PolarHBondContact O-N 3.32Å
39	L	98.2	Very high	97.7	Very high	99 Å²	99	121.8 Å²	121.8	52%	0.518	54%	0.538	S	S	.	.	H	α-helix	trans	-59.9	-48.6	178	-178.3	60.4	0	0	0	111.3	Q35 K36 R41 R42 L43	Q35-L39 WeakPolarHBondContact O-CB 3.36Å; Q35-L39 PolarHBondContact O-N 2.87Å; K36-L39 PolarHBondContact O-N 3.3Å; L39-R41 VanDerWaalsContact C-N 3.34Å; L39-R41 PolarHBondContact O-N 3.11Å; L39-R42 PolarHBondContact O-N 3.1Å; L39-R42 VanDerWaalsContact O-N 3.15Å; L39-L43 HydrophobicContact CD1-CD1 4.31Å; L39-L43 HydrophobicContact CD1-CG 4.3Å; L39-L43 HydrophobicContact CG-CD1 4.18Å; L39-L43 WeakPolarHBondContact O-CG 3.33Å; L39-L43 PolarHBondContact O-N 3.2Å
40	T	97.3	Very high	97.6	Very high	68 Å²	68	125.8 Å²	125.8	42%	0.417	55%	0.547	S	S	.	.	H	α-helix	trans	-57.9	-45.1	176.9	-55	0	0	0	0	111.7	K36 R42 L43 N44	K36-T40 PolarHBondContact O-N 2.91Å; K36-T40 PolarHBondContact O-OG1 3.46Å; T40-R42 PolarHBondContact O-N 3.05Å; T40-L43 PolarHBondContact O-N 3.2Å; T40-N44 WeakPolarHBondContact O-CB 3.35Å; T40-N44 VanDerWaalsContact O-CG 3.27Å; T40-N44 PolarHBondContact O-N 3.26Å
41	R	97.9	Very high	97.6	Very high	162 Å²	162	122.4 Å²	122.4	61%	0.611	54%	0.539	S	S	*	.	H	α-helix	trans	-60.9	-43.3	175.9	-75.6	175.7	172.7	-172.5	-7.4	112.2	K37 H38 L39 N44 R45	K37-R41 WeakPolarHBondContact O-CG 3.37Å; K37-R41 PolarHBondContact O-N 3.44Å; K37-R41 VanDerWaalsContact O-N 3.12Å; H38-R41 PolarHBondContact O-N 2.89Å; L39-R41 VanDerWaalsContact C-N 3.34Å; L39-R41 PolarHBondContact O-N 3.11Å; R41-N44 PolarHBondContact O-N 3.08Å; R41-R45 WeakPolarHBondContact O-CB 3.39Å; R41-R45 PolarHBondContact O-N 3.44Å
42	R	97.9	Very high	97.5	Very high	148 Å²	148	124.7 Å²	124.7	56%	0.558	54%	0.544	S	S	*	.	H	α-helix	trans	-63.3	-43.5	179.1	-171.2	176.4	-176.8	-174.8	-0.8	111.4	H38 L39 T40 K46	H38-R42 WeakPolarHBondContact O-CB 3.42Å; H38-R42 PolarHBondContact O-N 3.32Å; L39-R42 PolarHBondContact O-N 3.1Å; L39-R42 VanDerWaalsContact O-N 3.15Å; T40-R42 PolarHBondContact O-N 3.05Å; R42-K46 WeakPolarHBondContact O-CG 3.48Å; R42-K46 PolarHBondContact O-N 3.34Å
43	L	97.6	Very high	97.4	Very high	95 Å²	95	127.7 Å²	127.7	50%	0.497	55%	0.552	S	S	.	*	H	α-helix	trans	-65.5	-44.9	177	-67.3	176.3	0	0	0	111.7	L39 T40 R45 K46 K47	L39-L43 HydrophobicContact CD1-CD1 4.31Å; L39-L43 HydrophobicContact CD1-CG 4.3Å; L39-L43 HydrophobicContact CG-CD1 4.18Å; L39-L43 WeakPolarHBondContact O-CG 3.33Å; L39-L43 PolarHBondContact O-N 3.2Å; T40-L43 PolarHBondContact O-N 3.2Å; L43-R45 PolarHBondContact O-N 3.02Å; L43-K46 WeakPolarHBondContact O-CB 3.41Å; L43-K46 PolarHBondContact O-N 2.93Å; L43-K47 PolarHBondContact O-N 3.48Å
44	N	97.5	Very high	97.3	Very high	89 Å²	89	127.6 Å²	127.6	48%	0.476	55%	0.552	S	S	.	*	H	α-helix	trans	-61	-44.5	176.9	-73.1	-8.5	0	0	0	111.8	T40 R41 K46 K47 I48	T40-N44 WeakPolarHBondContact O-CB 3.35Å; T40-N44 VanDerWaalsContact O-CG 3.27Å; T40-N44 PolarHBondContact O-N 3.26Å; R41-N44 PolarHBondContact O-N 3.08Å; N44-K46 VanDerWaalsContact C-N 3.33Å; N44-K46 PolarHBondContact O-N 3.44Å; N44-K47 PolarHBondContact O-N 3.05Å; N44-I48 WeakPolarHBondContact O-CG1 3.41Å; N44-I48 PolarHBondContact O-N 3.16Å
45	R	98	Very high	97.2	Very high	179 Å²	179	124.1 Å²	124.1	68%	0.675	55%	0.547	S	S	*	.	H	α-helix	trans	-60.2	-43	174.9	-172.4	176.5	-179.2	-173.9	-0.8	111.6	R41 L43 I48 N49	R41-R45 WeakPolarHBondContact O-CB 3.39Å; R41-R45 PolarHBondContact O-N 3.44Å; L43-R45 PolarHBondContact O-N 3.02Å; R45-I48 PolarHBondContact O-N 3.01Å; R45-N49 WeakPolarHBondContact O-CB 3.49Å; R45-N49 PolarHBondContact O-N 2.94Å
46	K	97.1	Very high	97	Very high	100 Å²	100	125.2 Å²	125.2	44%	0.435	56%	0.556	S	S	.	*	H	α-helix	trans	-61.7	-43.1	175.1	-77	-177.7	176.7	-173.4	0	111.8	R42 L43 N44 N49 R50	R42-K46 WeakPolarHBondContact O-CG 3.48Å; R42-K46 PolarHBondContact O-N 3.34Å; L43-K46 WeakPolarHBondContact O-CB 3.41Å; L43-K46 PolarHBondContact O-N 2.93Å; N44-K46 VanDerWaalsContact C-N 3.33Å; N44-K46 PolarHBondContact O-N 3.44Å; K46-N49 PolarHBondContact O-N 3.44Å; K46-R50 WeakPolarHBondContact O-CG 3.37Å; K46-R50 PolarHBondContact O-N 2.87Å
47	K	97.5	Very high	96.9	Very high	134 Å²	134	123.8 Å²	123.8	58%	0.583	55%	0.549	S	S	*	.	H	α-helix	trans	-60.9	-50.4	176.7	-174	177.8	179.2	-179.8	0	111.2	L43 N44 N49 R50 M51	L43-K47 PolarHBondContact O-N 3.48Å; N44-K47 PolarHBondContact O-N 3.05Å; K47-N49 VanDerWaalsContact C-N 3.34Å; K47-N49 PolarHBondContact O-N 3.41Å; K47-R50 PolarHBondContact O-N 3.17Å; K47-M51 WeakPolarHBondContact O-CG 3.36Å; K47-M51 PolarHBondContact O-N 3.43Å
48	I	97.2	Very high	96.5	Very high	72 Å²	72	124.1 Å²	124.1	37%	0.369	55%	0.551	S	S	.	*	H	α-helix	trans	-58.7	-45.5	177.5	-67.3	166.8	0	0	0	111	N44 R45 R50 M51 R52	N44-I48 WeakPolarHBondContact O-CG1 3.41Å; N44-I48 PolarHBondContact O-N 3.16Å; R45-I48 PolarHBondContact O-N 3.01Å; I48-R50 VanDerWaalsContact C-N 3.34Å; I48-R50 PolarHBondContact O-N 3.02Å; I48-M51 HydrophobicContact CG1-CE 4.2Å; I48-M51 PolarHBondContact O-N 3.47Å; I48-R52 HydrophobicContact CG2-CG 4.35Å; I48-R52 WeakPolarHBondContact O-CG 3.46Å; I48-R52 PolarHBondContact O-N 2.93Å
49	N	97.2	Very high	96.1	Very high	67 Å²	67	123.7 Å²	123.7	36%	0.358	55%	0.549	S	S	.	.	H	α-helix	trans	-63.1	-39.5	178.4	-73.6	-6.3	0	0	0	112.4	R45 K46 K47 K53	R45-N49 WeakPolarHBondContact O-CB 3.49Å; R45-N49 PolarHBondContact O-N 2.94Å; K46-N49 PolarHBondContact O-N 3.44Å; K47-N49 VanDerWaalsContact C-N 3.34Å; K47-N49 PolarHBondContact O-N 3.41Å; N49-K53 WeakPolarHBondContact O-CG 3.38Å; N49-K53 PolarHBondContact O-N 2.95Å
50	R	97	Very high	95.6	Very high	171 Å²	171	125.2 Å²	125.2	65%	0.645	55%	0.551	S	S	*	*	H	α-helix	trans	-63.4	-44	174.2	-74	174.7	179	-179.3	-1.9	111.4	K46 K47 I48 K53 R54	K46-R50 WeakPolarHBondContact O-CG 3.37Å; K46-R50 PolarHBondContact O-N 2.87Å; K47-R50 PolarHBondContact O-N 3.17Å; I48-R50 VanDerWaalsContact C-N 3.34Å; I48-R50 PolarHBondContact O-N 3.02Å; R50-K53 PolarHBondContact O-N 2.96Å; R50-R54 WeakPolarHBondContact O-CG 3.45Å; R50-R54 PolarHBondContact O-N 3.19Å
51	M	97	Very high	95.1	Very high	94 Å²	94	129.3 Å²	129.3	46%	0.463	56%	0.559	S	S	.	*	H	α-helix	trans	-62.6	-47.3	176.9	-67.5	-172.2	-52	0	0	111.5	K47 I48 K53 R54 L55	K47-M51 WeakPolarHBondContact O-CG 3.36Å; K47-M51 PolarHBondContact O-N 3.43Å; I48-M51 HydrophobicContact CG1-CE 4.2Å; I48-M51 PolarHBondContact O-N 3.47Å; M51-K53 PolarHBondContact O-N 3.43Å; M51-R54 PolarHBondContact O-N 3.42Å; M51-R54 VanDerWaalsContact O-N 3.16Å; M51-L55 WeakPolarHBondContact O-CG 3.47Å; M51-L55 PolarHBondContact O-N 3.23Å
52	R	96.1	Very high	94.5	Very high	156 Å²	156	126.8 Å²	126.8	59%	0.589	55%	0.554	S	S	*	*	H	α-helix	trans	-57.6	-46.1	176.5	-72.7	177	-179.9	179.2	-1.2	112.2	I48 R54 L55 L56	I48-R52 HydrophobicContact CG2-CG 4.35Å; I48-R52 WeakPolarHBondContact O-CG 3.46Å; I48-R52 PolarHBondContact O-N 2.93Å; R52-R54 VanDerWaalsContact C-N 3.34Å; R52-R54 PolarHBondContact O-N 3.41Å; R52-L55 PolarHBondContact O-N 2.94Å; R52-L56 WeakPolarHBondContact O-CB 3.43Å; R52-L56 VanDerWaalsContact O-CG 3.3Å; R52-L56 WeakPolarHBondContact O-CG 3.34Å; R52-L56 PolarHBondContact O-N 3.45Å
53	K	96.3	Very high	93.7	Very high	159 Å²	159	122.1 Å²	122.1	69%	0.691	54%	0.542	S	S	*	.	H	α-helix	trans	-60.7	-41.3	176.4	-75.6	-173.9	176.7	-165.5	0	112.4	N49 R50 M51 K57	N49-K53 WeakPolarHBondContact O-CG 3.38Å; N49-K53 PolarHBondContact O-N 2.95Å; R50-K53 PolarHBondContact O-N 2.96Å; M51-K53 PolarHBondContact O-N 3.43Å; K53-K57 PolarHBondContact O-N 2.88Å
54	R	95.5	Very high	92.8	Very high	189 Å²	189	120.8 Å²	120.8	71%	0.713	54%	0.535	S	S	*	.	H	α-helix	trans	-65.2	-44.2	177.1	-73.4	177	179.3	-175.1	-2.6	112	R50 M51 R52 K57 K58	R50-R54 WeakPolarHBondContact O-CG 3.45Å; R50-R54 PolarHBondContact O-N 3.19Å; M51-R54 PolarHBondContact O-N 3.42Å; M51-R54 VanDerWaalsContact O-N 3.16Å; R52-R54 VanDerWaalsContact C-N 3.34Å; R52-R54 PolarHBondContact O-N 3.41Å; R54-K57 PolarHBondContact O-N 3.38Å; R54-K58 PolarHBondContact O-N 2.92Å
55	L	95	Very high	91.7	Very high	117 Å²	117	120.1 Å²	120.1	61%	0.613	54%	0.535	S	S	*	.	H	α-helix	trans	-63.7	-43.7	177.7	-69.8	173	0	0	0	111.9	M51 R52 K57 K58 H59	M51-L55 WeakPolarHBondContact O-CG 3.47Å; M51-L55 PolarHBondContact O-N 3.23Å; R52-L55 PolarHBondContact O-N 2.94Å; L55-K57 VanDerWaalsContact C-N 3.33Å; L55-K57 PolarHBondContact O-N 2.93Å; L55-K58 PolarHBondContact O-N 2.92Å; L55-H59 PolarHBondContact O-N 3.46Å
56	L	95	Very high	90.4	Very high	125 Å²	125	113.8 Å²	113.8	65%	0.654	52%	0.521	S	S	*	.	H	α-helix	trans	-60.5	-41.8	175	-72	169.6	0	0	0	112	R52 H59 K60	R52-L56 WeakPolarHBondContact O-CB 3.43Å; R52-L56 VanDerWaalsContact O-CG 3.3Å; R52-L56 WeakPolarHBondContact O-CG 3.34Å; R52-L56 PolarHBondContact O-N 3.45Å; L56-H59 PolarHBondContact O-N 2.94Å; L56-K60 WeakPolarHBondContact O-CB 3.3Å; L56-K60 PolarHBondContact O-N 3.43Å
57	K	94.2	Very high	89	Confident	127 Å²	127	113.2 Å²	113.2	55%	0.552	52%	0.522	S	S	*	.	H	α-helix	trans	-65.2	-38.8	175.7	-172.1	177	-177.9	179.5	0	112.2	K53 R54 L55 R61	K53-K57 PolarHBondContact O-N 2.88Å; R54-K57 PolarHBondContact O-N 3.38Å; L55-K57 VanDerWaalsContact C-N 3.33Å; L55-K57 PolarHBondContact O-N 2.93Å; K57-R61 WeakPolarHBondContact O-CG 3.41Å; K57-R61 PolarHBondContact O-N 3.2Å; K57-R61 VanDerWaalsContact O-N 3.08Å
58	K	90	Very high	87.3	Confident	131 Å²	131	113.2 Å²	113.2	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-64.5	-47.2	175.7	-174.2	-179.4	178.8	-176.7	0	111	R54 L55 K60 R61 Q62	R54-K58 PolarHBondContact O-N 2.92Å; L55-K58 PolarHBondContact O-N 2.92Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-K60 PolarHBondContact O-N 3.29Å; K58-R61 PolarHBondContact O-N 2.93Å; K58-Q62 WeakPolarHBondContact O-CG 3.35Å; K58-Q62 PolarHBondContact O-N 3.39Å
59	H	89.2	Confident	85.6	Confident	115 Å²	115	117.2 Å²	117.2	53%	0.532	54%	0.542	S	S	.	.	H	α-helix	trans	-61	-42.5	176.9	-174.9	-67.6	0	0	0	111.5	L55 L56 R61 Q62 T63	L55-H59 PolarHBondContact O-N 3.46Å; L56-H59 PolarHBondContact O-N 2.94Å; H59-R61 PolarHBondContact O-N 3.15Å; H59-Q62 PolarHBondContact O-N 3.18Å; H59-T63 VanDerWaalsContact CE1-CG2 3.48Å; H59-T63 WeakPolarHBondContact CE1-CG2 3.39Å; H59-T63 PolarHBondContact O-N 3.42Å; H59-T63 PolarHBondContact O-OG1 3.33Å
60	K	87.3	Confident	83.7	Confident	132 Å²	132	121.1 Å²	121.1	57%	0.574	56%	0.559	S	S	*	*	H	α-helix	trans	-58.7	-47.9	175.9	-172	-178.1	175.2	-176.6	0	111.4	L56 K58 Q62 T63 D64	L56-K60 WeakPolarHBondContact O-CB 3.3Å; L56-K60 PolarHBondContact O-N 3.43Å; K58-K60 VanDerWaalsContact C-N 3.33Å; K58-K60 PolarHBondContact O-N 3.29Å; K60-Q62 VanDerWaalsContact C-N 3.26Å; K60-Q62 PolarHBondContact O-N 3.12Å; K60-T63 WeakPolarHBondContact CA-OG1 3.35Å; K60-T63 PolarHBondContact O-N 3.4Å; K60-T63 PolarHBondContact O-OG1 2.89Å; K60-D64 WeakPolarHBondContact O-CB 3.36Å; K60-D64 PolarHBondContact O-N 3.04Å
61	R	86.3	Confident	81.9	Confident	154 Å²	154	119.4 Å²	119.4	58%	0.581	56%	0.563	S	S	*	*	H	α-helix	trans	-59.1	-37.9	176.4	-72	172.3	173.2	-168.3	-8.7	112.9	K57 K58 H59 T65	K57-R61 WeakPolarHBondContact O-CG 3.41Å; K57-R61 PolarHBondContact O-N 3.2Å; K57-R61 VanDerWaalsContact O-N 3.08Å; K58-R61 PolarHBondContact O-N 2.93Å; H59-R61 PolarHBondContact O-N 3.15Å; R61-T65 WeakPolarHBondContact O-CG2 3.23Å; R61-T65 PolarHBondContact O-N 3.28Å; R61-T65 VanDerWaalsContact O-N 3.1Å; R61-T65 PolarHBondContact O-OG1 2.9Å; R61-T65 VanDerWaalsContact O-OG1 3.11Å
62	Q	85.3	Confident	80.1	Confident	108 Å²	108	119.6 Å²	119.6	51%	0.505	57%	0.57	S	S	.	*	H	α-helix	trans	-69.8	-37.2	178.4	-73.5	176.4	-37.1	0	0	112.5	K58 H59 K60 T65 A66	K58-Q62 WeakPolarHBondContact O-CG 3.35Å; K58-Q62 PolarHBondContact O-N 3.39Å; H59-Q62 PolarHBondContact O-N 3.18Å; K60-Q62 VanDerWaalsContact C-N 3.26Å; K60-Q62 PolarHBondContact O-N 3.12Å; Q62-T65 WeakPolarHBondContact CA-OG1 3.35Å; Q62-T65 PolarHBondContact O-OG1 2.95Å; Q62-A66 WeakPolarHBondContact O-CB 3.42Å; Q62-A66 PolarHBondContact O-N 3.39Å; Q62-A66 VanDerWaalsContact O-N 3.1Å
63	T	81.4	Confident	78.3	Confident	50 Å²	50	118.5 Å²	118.5	31%	0.307	58%	0.575	S	S	.	*	H	α-helix	trans	-70.9	-42	174.4	50.6	0	0	0	0	111.4	H59 K60 T65 A66 D67	H59-T63 VanDerWaalsContact CE1-CG2 3.48Å; H59-T63 WeakPolarHBondContact CE1-CG2 3.39Å; H59-T63 PolarHBondContact O-N 3.42Å; H59-T63 PolarHBondContact O-OG1 3.33Å; K60-T63 WeakPolarHBondContact CA-OG1 3.35Å; K60-T63 PolarHBondContact O-N 3.4Å; K60-T63 PolarHBondContact O-OG1 2.89Å; T63-T65 VanDerWaalsContact C-N 3.29Å; T63-T65 PolarHBondContact O-N 3.02Å; T63-A66 PolarHBondContact O-N 2.87Å; T63-A66 VanDerWaalsContact O-N 3.1Å; T63-D67 PolarHBondContact O-N 3.09Å
64	D	79.1	Confident	76.4	Confident	67 Å²	67	117.7 Å²	117.7	36%	0.358	58%	0.578	S	S	.	*	H	α-helix	trans	-58.5	-43.3	177.6	-60.1	-13	0	0	0	110.1	K60 E68	K60-D64 WeakPolarHBondContact O-CB 3.36Å; K60-D64 PolarHBondContact O-N 3.04Å; D64-E68 WeakPolarHBondContact O-CG 3.45Å; D64-E68 PolarHBondContact O-N 2.97Å; D64-E68 VanDerWaalsContact O-N 3.1Å
65	T	73.4	Confident	74.4	Confident	75 Å²	75	114.2 Å²	114.2	46%	0.46	58%	0.577	S	S	.	*	H	α-helix	trans	-70.9	-28.8	175.9	52.8	0	0	0	0	114.6	R61 Q62 T63 Q69	R61-T65 WeakPolarHBondContact O-CG2 3.23Å; R61-T65 PolarHBondContact O-N 3.28Å; R61-T65 VanDerWaalsContact O-N 3.1Å; R61-T65 PolarHBondContact O-OG1 2.9Å; R61-T65 VanDerWaalsContact O-OG1 3.11Å; Q62-T65 WeakPolarHBondContact CA-OG1 3.35Å; Q62-T65 PolarHBondContact O-OG1 2.95Å; T63-T65 VanDerWaalsContact C-N 3.29Å; T63-T65 PolarHBondContact O-N 3.02Å; T65-Q69 WeakPolarHBondContact O-CG 3.48Å; T65-Q69 PolarHBondContact O-N 3.38Å
66	A	72.4	Confident	72.6	Confident	46 Å²	46	114 Å²	114	38%	0.38	58%	0.576	S	S	.	*	H	α-helix	trans	-77.9	-38	179.2	0	0	0	0	0	111.1	Q62 T63 Q69 M70	Q62-A66 WeakPolarHBondContact O-CB 3.42Å; Q62-A66 PolarHBondContact O-N 3.39Å; Q62-A66 VanDerWaalsContact O-N 3.1Å; T63-A66 PolarHBondContact O-N 2.87Å; T63-A66 VanDerWaalsContact O-N 3.1Å; A66-Q69 PolarHBondContact O-N 3.32Å; A66-M70 WeakPolarHBondContact O-CG 3.33Å; A66-M70 PolarHBondContact O-N 2.99Å
67	D	66.7	Low	70.3	Confident	88 Å²	88	112.3 Å²	112.3	47%	0.471	57%	0.572	S	S	.	*	H	α-helix	trans	-65.1	-42.2	173.7	-68.7	-16.8	0	0	0	109.7	T63 Q69 M70 D71	T63-D67 PolarHBondContact O-N 3.09Å; D67-Q69 VanDerWaalsContact C-N 3.3Å; D67-Q69 PolarHBondContact O-N 3.09Å; D67-M70 PolarHBondContact O-N 3.44Å; D67-D71 PolarHBondContact O-N 3.46Å; D67-D71 VanDerWaalsContact O-N 3.13Å
68	E	62.7	Low	68.3	Low	135 Å²	135	112.2 Å²	112.2	63%	0.631	58%	0.582	S	S	*	*	H	α-helix	trans	-60.8	-31.1	174.2	-76.9	173.2	-171.4	0	0	114.1	D64	D64-E68 WeakPolarHBondContact O-CG 3.45Å; D64-E68 PolarHBondContact O-N 2.97Å; D64-E68 VanDerWaalsContact O-N 3.1Å
69	Q	60.7	Low	66.3	Low	155 Å²	155	112 Å²	112	72%	0.724	59%	0.588	S	S	*	*	H	α-helix	trans	-77.1	-26.2	177.4	-79.7	-179.2	-13	0	0	113.6	T65 A66 D67	T65-Q69 WeakPolarHBondContact O-CG 3.48Å; T65-Q69 PolarHBondContact O-N 3.38Å; A66-Q69 PolarHBondContact O-N 3.32Å; D67-Q69 VanDerWaalsContact C-N 3.3Å; D67-Q69 PolarHBondContact O-N 3.09Å
70	M	57.4	Low	64.3	Low	149 Å²	149	113.8 Å²	113.8	73%	0.734	60%	0.601	S	S	*	*	H	α-helix	trans	-83.2	-29.1	177.3	-62.8	-63.1	-60.3	0	0	111.8	A66 D67 V72	A66-M70 WeakPolarHBondContact O-CG 3.33Å; A66-M70 PolarHBondContact O-N 2.99Å; D67-M70 PolarHBondContact O-N 3.44Å; M70-V72 VanDerWaalsContact C-N 3.29Å
71	D	58.2	Low	62.4	Low	135 Å²	135	113.5 Å²	113.5	72%	0.722	61%	0.61	S	S	*	*	S	Bend	trans	-82.2	-3.8	178.9	-71.6	-11.6	0	0	0	113.4	D67 D73	D67-D71 PolarHBondContact O-N 3.46Å; D67-D71 VanDerWaalsContact O-N 3.13Å; D71-D73 PolarHBondContact O-N 2.93Å
72	V	60.3	Low	60.6	Low	99 Å²	99	114.6 Å²	114.6	60%	0.6	62%	0.621	S	S	*	*			trans	-75.4	78.5	157.5	-172.8	0	0	0	0	106.1	M70 L74	M70-V72 VanDerWaalsContact C-N 3.29Å; V72-L74 PolarHBondContact O-N 2.84Å
73	D	58.2	Low	58.5	Low	133 Å²	133	118 Å²	118	71%	0.711	64%	0.638	S	S	*	*			trans	-49	102.2	148.7	-79	-28	0	0	0	104.6	D71 V75	D71-D73 PolarHBondContact O-N 2.93Å; D73-V75 HydrophobicContact CB-CG2 4.29Å; D73-V75 PolarHBondContact O-N 3.09Å
74	L	56.7	Low	56.7	Low	141 Å²	141	121.1 Å²	121.1	74%	0.738	66%	0.658	S	S	*	*			trans	-54.9	84.2	148.5	-92.6	123.3	0	0	0	104.3	V72 I76	V72-L74 PolarHBondContact O-N 2.84Å; L74-I76 HydrophobicContact CB-CG1 4.17Å; L74-I76 HydrophobicContact CD2-CG1 4.07Å; L74-I76 PolarHBondContact O-N 3.5Å
75	V	54.1	Low	55.1	Low	116 Å²	116	122 Å²	122	70%	0.703	68%	0.676	S	S	*	*			trans	-62.3	77.6	145.6	-173.8	0	0	0	0	103.1	D73 P77	D73-V75 HydrophobicContact CB-CG2 4.29Å; D73-V75 PolarHBondContact O-N 3.09Å; V75-P77 VanDerWaalsContact C-N 3.35Å; V75-P77 WeakPolarHBondContact O-CD 3.44Å; V75-P77 VanDerWaalsContact O-N 3.15Å
76	I	55.9	Low	53.6	Low	114 Å²	114	125.9 Å²	125.9	59%	0.585	69%	0.693	S	S	*	*			trans	-54.1	115.1	147.9	-60.5	176.9	0	0	0	101.3	L74 T78	L74-I76 HydrophobicContact CB-CG1 4.17Å; L74-I76 HydrophobicContact CD2-CG1 4.07Å; L74-I76 PolarHBondContact O-N 3.5Å; I76-T78 PolarHBondContact O-N 2.85Å
77	P	47.5	Very low	51.9	Low	89 Å²	89	131.7 Å²	131.7	58%	0.578	72%	0.718	S	S	*	*			trans	-57.8	101.1	168.2	-14.5	29.1	0	0	0	104.3	V75 D79	V75-P77 VanDerWaalsContact C-N 3.35Å; V75-P77 WeakPolarHBondContact O-CD 3.44Å; V75-P77 VanDerWaalsContact O-N 3.15Å; P77-D79 PolarHBondContact O-N 2.97Å
78	T	51.3	Low	50.7	Low	125 Å²	125	131.7 Å²	131.7	77%	0.767	73%	0.73	S	S	*	*			trans	-74.2	65.4	156.1	55	0	0	0	0	104.2	I76 N80	I76-T78 PolarHBondContact O-N 2.85Å; T78-N80 PolarHBondContact O-N 3.01Å
79	D	48.1	Very low	49.6	Very low	127 Å²	127	133 Å²	133	68%	0.679	74%	0.741	S	S	*	*			trans	-55.3	115.6	162.3	-79.1	-25.3	0	0	0	104.2	P77 V81	P77-D79 PolarHBondContact O-N 2.97Å; D79-V81 VanDerWaalsContact C-N 3.29Å; D79-V81 WeakPolarHBondContact O-CG2 3.37Å; D79-V81 PolarHBondContact O-N 3.38Å
80	N	47.5	Very low	48.7	Very low	152 Å²	152	133.6 Å²	133.6	81%	0.813	75%	0.746	S	S	*	*			trans	-15.6	87.5	165.1	-60.3	-41.1	0	0	0	111.5	T78 E82	T78-N80 PolarHBondContact O-N 3.01Å; N80-E82 PolarHBondContact O-N 3.32Å
81	V	47.3	Very low	47.9	Very low	125 Å²	125	134 Å²	134	76%	0.758	74%	0.744	S	S	*	*			trans	-77.8	79.4	161.2	-176.4	0	0	0	0	103.4	D79 Q83	D79-V81 VanDerWaalsContact C-N 3.29Å; D79-V81 WeakPolarHBondContact O-CG2 3.37Å; D79-V81 PolarHBondContact O-N 3.38Å; V81-Q83 PolarHBondContact O-N 2.93Å
82	E	48.1	Very low	47	Very low	177 Å²	177	134.6 Å²	134.6	83%	0.827	74%	0.742	S	S	*	*			trans	-48.1	116.1	154.2	-73.6	-175.9	166.4	0	0	105.8	N80	N80-E82 PolarHBondContact O-N 3.32Å
83	Q	41.9	Very low	46	Very low	181 Å²	181	135.6 Å²	135.6	85%	0.846	75%	0.749	S	S	*	*			trans	-44.4	123.7	-178.4	-66.2	164.6	-63.8	0	0	109.4	V81 A85	V81-Q83 PolarHBondContact O-N 2.93Å; Q83-A85 PolarHBondContact O-N 3.43Å
84	P	43.6	Very low	45.1	Very low	114 Å²	114	135.5 Å²	135.5	74%	0.74	75%	0.753	S	S	*	*			trans	-66.4	99.1	158	26.5	-28.3	0	0	0	106.2	N86	P84-N86 VanDerWaalsContact C-N 3.33Å; P84-N86 PolarHBondContact O-N 3.23Å
85	A	45.5	Very low	44.2	Very low	87 Å²	87	136.3 Å²	136.3	72%	0.719	76%	0.758	S	S	*	*			trans	-51.7	104.1	157.5	0	0	0	0	0	106.9	Q83	Q83-A85 PolarHBondContact O-N 3.43Å
86	N	41.6	Very low	43.7	Very low	155 Å²	155	136 Å²	136	83%	0.829	76%	0.761	S	S	*	*			trans	-161.6	97.7	151.7	-91.6	-28	0	0	0	108.3	P84 A88	P84-N86 VanDerWaalsContact C-N 3.33Å; P84-N86 PolarHBondContact O-N 3.23Å; N86-A88 PolarHBondContact O-N 3.48Å
87	D	37.5	Very low	43	Very low	169 Å²	169	139.9 Å²	139.9	90%	0.904	78%	0.777	S	S	*	*			trans	-43.7	117.5	151.6	-64.3	-54.2	0	0	0	110.4
88	A	40.3	Very low	43	Very low	88 Å²	88	141.7 Å²	141.7	73%	0.727	79%	0.788	S	S	*	*			trans	-172.2	79.7	152.9	0	0	0	0	0	110.2	N86 M90	N86-A88 PolarHBondContact O-N 3.48Å; A88-M90 PolarHBondContact O-N 2.85Å
89	D	41.1	Very low	42.7	Very low	162 Å²	162	138.8 Å²	138.8	87%	0.866	78%	0.783	S	S	*	*			trans	20.6	87.6	132.7	-152.1	14.2	0	0	0	117.2
90	M	41.5	Very low	42.4	Very low	167 Å²	167	139.2 Å²	139.2	82%	0.823	79%	0.79	S	S	*	*			trans	-151.1	100.8	154.7	-83	-56.1	177.5	0	0	111.4	A88	A88-M90 PolarHBondContact O-N 2.85Å
91	K	39.1	Very low	42.7	Very low	158 Å²	158	140.3 Å²	140.3	69%	0.687	79%	0.79	S	S	*	*				66.2	111	127.6	-69.6	-81.4	-175.3	177.7	0	120.8
92	E	40.3	Very low	42.7	Very low	147 Å²	147	140.2 Å²	140.2	69%	0.687	79%	0.794	S	S	*	*				63.8	106.6	127.1	-84.2	176.7	125.6	0	0	120.5
93	T	38.1	Very low	42.5	Very low	121 Å²	121	139.3 Å²	139.3	74%	0.742	79%	0.794	S	S	*	*			trans	54.4	117.9	130.9	60.4	0	0	0	0	119.2
94	V	39.2	Very low	42.7	Very low	131 Å²	131	135 Å²	135	79%	0.794	79%	0.79	S	S	*	*				-157.9	131.8	109.7	-174.2	0	0	0	0	108.9
95	N	39.7	Very low	42.9	Very low	158 Å²	158	135.2 Å²	135.2	85%	0.845	79%	0.788	S	S	*	*			trans	-42.8	132.1	174	-49.7	-60.1	0	0	0	114.4
96	S	43.6	Very low	43.3	Very low	109 Å²	109	134.7 Å²	134.7	76%	0.762	78%	0.779	S	S	*	*			trans	-146.7	108.6	149.5	40.7	0	0	0	0	108.8	P98	S96-P98 VanDerWaalsContact O-CD 3.29Å; S96-P98 WeakPolarHBondContact O-CD 3.08Å
97	E	41.3	Very low	44.1	Very low	196 Å²	196	135.5 Å²	135.5	92%	0.916	78%	0.775	S	S	*	*			trans	-77.2	117.7	158.1	-67.5	-178.3	164	0	0	107.2
98	P	45.6	Very low	44.8	Very low	127 Å²	127	133.5 Å²	133.5	83%	0.825	77%	0.765	S	S	*	*			trans	-95	109.5	155	28.3	-14.4	0	0	0	105.8	S96	S96-P98 VanDerWaalsContact O-CD 3.29Å; S96-P98 WeakPolarHBondContact O-CD 3.08Å
99	G	45.8	Very low	45.5	Very low	64 Å²	64	132 Å²	132	66%	0.66	75%	0.752	S	S	*	*				115.6	96.6	65	0	0	0	0	0	106	E101	G99-E101 PolarHBondContact O-N 3.5Å; G99-E101 VanDerWaalsContact O-N 3.08Å
100	V	41.9	Very low	46.2	Very low	136 Å²	136	131.8 Å²	131.8	82%	0.824	74%	0.744	S	S	*	*			trans	-43.5	112.4	-177.8	179.5	0	0	0	0	111.1	C102	V100-C102 PolarHBondContact O-N 3.47Å
101	E	52.9	Low	46.8	Very low	175 Å²	175	130.5 Å²	130.5	82%	0.818	74%	0.735	S	S	*	*			trans	-57.8	107.9	172.3	-71.9	-175.1	164.1	0	0	109.2	G99 L103	G99-E101 PolarHBondContact O-N 3.5Å; G99-E101 VanDerWaalsContact O-N 3.08Å; E101-L103 VanDerWaalsContact C-N 3.33Å; E101-L103 PolarHBondContact O-N 3.38Å
102	C	48	Very low	47.6	Very low	123 Å²	123	132.7 Å²	132.7	83%	0.831	74%	0.739	S	S	*	*			trans	-68.8	94.4	169.9	-68	0	0	0	0	108.1	V100 A104	V100-C102 PolarHBondContact O-N 3.47Å; C102-A104 PolarHBondContact O-N 2.9Å
103	L	43.7	Very low	48.3	Very low	157 Å²	157	134 Å²	134	82%	0.822	74%	0.743	S	S	*	*			trans	-47.4	112.7	172.9	-78.7	165.5	0	0	0	110	E101 V105	E101-L103 VanDerWaalsContact C-N 3.33Å; E101-L103 PolarHBondContact O-N 3.38Å; L103-V105 PolarHBondContact O-N 3.32Å
104	A	47.3	Very low	49.2	Very low	92 Å²	92	137 Å²	137	76%	0.76	74%	0.74	S	S	*	*			trans	-57.5	108	177.9	0	0	0	0	0	109.6	C102 S106	C102-A104 PolarHBondContact O-N 2.9Å; A104-S106 PolarHBondContact O-N 3Å
105	V	47.1	Very low	50.1	Low	118 Å²	118	138.4 Å²	138.4	72%	0.715	74%	0.736	S	S	*	*			trans	-68.6	89.7	169.7	-178.9	0	0	0	0	107.4	L103 K107	L103-V105 PolarHBondContact O-N 3.32Å; V105-K107 PolarHBondContact O-N 3.44Å
106	S	53.6	Low	50.9	Low	75 Å²	75	138 Å²	138	52%	0.524	73%	0.726	S	S	.	*			trans	-53.1	132.3	179.3	55.2	0	0	0	0	110.7	A104 D108 A109	A104-S106 PolarHBondContact O-N 3Å; S106-D108 PolarHBondContact O-N 2.96Å; S106-A109 PolarHBondContact O-N 3.33Å
107	K	58.2	Low	51.5	Low	173 Å²	173	138.5 Å²	138.5	75%	0.752	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	-16.7	-174.2	-68.8	172.5	-179.6	167.2	0	112.9	V105	V105-K107 PolarHBondContact O-N 3.44Å
108	D	52.9	Low	52.2	Low	126 Å²	126	139.1 Å²	139.1	67%	0.674	71%	0.711	S	S	*	*	H	α-helix	trans	-71.9	-27.9	-178.6	-70.6	-23.8	0	0	0	114.6	S106 K110 H111 R112	S106-D108 PolarHBondContact O-N 2.96Å; D108-K110 VanDerWaalsContact C-N 3.27Å; D108-K110 PolarHBondContact O-N 3.15Å; D108-H111 PolarHBondContact O-N 3.45Å; D108-R112 PolarHBondContact O-N 3.02Å
109	A	55.6	Low	52.7	Low	56 Å²	56	139.1 Å²	139.1	46%	0.463	70%	0.7	S	S	.	*	H	α-helix	trans	-65.3	-32	179	0	0	0	0	0	112.3	S106	S106-A109 PolarHBondContact O-N 3.33Å
110	K	55.1	Low	53.1	Low	159 Å²	159	143.1 Å²	143.1	69%	0.691	70%	0.701	S	S	*	*	H	α-helix	trans	-72.9	-27.8	179.5	-69.7	-177.7	-178.4	172.9	0	112.5	D108	D108-K110 VanDerWaalsContact C-N 3.27Å; D108-K110 PolarHBondContact O-N 3.15Å
111	H	53.5	Low	53.7	Low	139 Å²	139	146 Å²	146	64%	0.644	70%	0.697	S	S	*	*	H	α-helix	trans	-77.2	-32.4	178.5	-106.2	-78.7	0	0	0	113.1	D108 K113 R114	D108-H111 PolarHBondContact O-N 3.45Å; H111-K113 PolarHBondContact O-N 3.29Å; H111-R114 PolarHBondContact O-N 2.98Å
112	R	55.6	Low	54	Low	205 Å²	205	142 Å²	142	77%	0.774	69%	0.688	S	S	*	*	H	α-helix	trans	-66.7	-34.4	178.8	-81.5	-176	160.2	-169.3	-4.3	113.6	D108 R114 K115	D108-R112 PolarHBondContact O-N 3.02Å; R112-R114 PolarHBondContact O-N 3.17Å; R112-K115 PolarHBondContact O-N 3.21Å
113	K	55.6	Low	54.3	Low	175 Å²	175	143.3 Å²	143.3	76%	0.761	69%	0.686	S	S	*	*	H	α-helix	trans	-65.5	-39.6	177.9	-70.9	-164.1	177.2	-174.8	0	112.8	H111 K115 K116 E117	H111-K113 PolarHBondContact O-N 3.29Å; K113-K115 VanDerWaalsContact C-N 3.33Å; K113-K115 PolarHBondContact O-N 2.92Å; K113-K116 PolarHBondContact O-N 3.18Å; K113-E117 PolarHBondContact O-N 2.87Å
114	R	57.7	Low	54.5	Low	183 Å²	183	147.9 Å²	147.9	69%	0.691	70%	0.699	S	S	*	*	H	α-helix	trans	-69.2	-27.5	-178.3	-69	-176.7	173.5	-179.2	-0.2	113.8	H111 R112	H111-R114 PolarHBondContact O-N 2.98Å; R112-R114 PolarHBondContact O-N 3.17Å
115	K	56.8	Low	54.9	Low	161 Å²	161	150.7 Å²	150.7	70%	0.7	70%	0.696	S	S	*	*	H	α-helix	trans	-76.6	-38.9	179.8	-144.1	179.2	-175.6	-176.3	0	111.8	R112 K113 R118	R112-K115 PolarHBondContact O-N 3.21Å; K113-K115 VanDerWaalsContact C-N 3.33Å; K113-K115 PolarHBondContact O-N 2.92Å; K115-R118 PolarHBondContact O-N 2.58Å
116	K	57.2	Low	55.3	Low	149 Å²	149	152.4 Å²	152.4	65%	0.648	70%	0.695	S	S	*	*	H	α-helix	trans	-66.7	-37.9	175.3	-70	-168	175.9	-171.6	0	112.5	K113 R118 Q119 H120	K113-K116 PolarHBondContact O-N 3.18Å; K116-R118 VanDerWaalsContact C-N 3.3Å; K116-R118 PolarHBondContact O-N 2.76Å; K116-Q119 PolarHBondContact O-N 3.48Å; K116-H120 PolarHBondContact O-CD2 2.77Å; K116-H120 PolarHBondContact O-N 3.06Å
117	E	55.7	Low	55.4	Low	119 Å²	119	156.7 Å²	156.7	56%	0.556	71%	0.705	S	S	*	*	H	α-helix	trans	-66.2	-31.1	-179.8	-136.7	-175.7	171.6	0	0	113.2	K113	K113-E117 PolarHBondContact O-N 2.87Å
118	R	56.4	Low	55.2	Low	209 Å²	209	155.8 Å²	155.8	79%	0.789	70%	0.702	S	S	*	*	H	α-helix	trans	-72.7	-32	175.7	-76.7	-174.1	170	-166.2	-3	113.1	K115 K116	K115-R118 PolarHBondContact O-N 2.58Å; K116-R118 VanDerWaalsContact C-N 3.3Å; K116-R118 PolarHBondContact O-N 2.76Å
119	Q	57.2	Low	55.4	Low	128 Å²	128	157.6 Å²	157.6	60%	0.598	70%	0.704	S	S	*	*	H	α-helix	trans	-74	-33	178.6	-71.1	-175	-23.6	0	0	112.4	K116 R121 S122	K116-Q119 PolarHBondContact O-N 3.48Å; Q119-R121 VanDerWaalsContact C-N 3.35Å; Q119-S122 PolarHBondContact O-OG 3.36Å
120	H	52.7	Low	55.4	Low	147 Å²	147	164.4 Å²	164.4	68%	0.681	72%	0.72	S	S	*	*	H	α-helix	trans	-75.5	-19.5	176.3	-76.6	-69.1	0	0	0	114.3	K116	K116-H120 PolarHBondContact O-CD2 2.77Å; K116-H120 PolarHBondContact O-N 3.06Å
121	R	56	Low	55.4	Low	198 Å²	198	164.8 Å²	164.8	75%	0.747	72%	0.722	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-13.8	176.1	-75.3	-171.6	-177.4	-162.7	1.8	114.2	Q119	Q119-R121 VanDerWaalsContact C-N 3.35Å
122	S	58.3	Low	55.5	Low	90 Å²	90	166.8 Å²	166.8	63%	0.629	73%	0.728	S	S	*	*	S	Bend	trans	-97.4	-0.2	178.4	58	0	0	0	0	114.1	Q119	Q119-S122 PolarHBondContact O-OG 3.36Å
123	L	53.8	Low	55.5	Low	151 Å²	151	163.6 Å²	163.6	79%	0.791	72%	0.724	S	S	*	*			trans	-114.2	19	179.9	-72.1	171.2	0	0	0	113.1
124	K	48.8	Very low	55.5	Low	253 Å²	253	162.5 Å²	162.5	100%	1.1	72%	0.721	S	S	*	*			trans	-129.3	0	165.4	-81.6	-172.1	177.1	-176	0	108.4

Retrieved 124 of 124 residues in 43.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).