A0A077ZCW4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZCW4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 134 aa.

						>A0A077ZCW4_TRITR|A0A077ZCW4
MALQCYYCSNSFAKSRTGTNMDCMAVNGGSHKTDNRMCMPSERWCKGTAHFSNGVLVEVQRDCSKNCKRRCEKKGYGVSKVKCKKCCNTTLCNNWRPDDLISYSYKPPESIWFNNPWLTSGTTTLHGHIKAKFC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.7	Low	88.9	Confident	252 Å²	252	60.5 Å²	60.5	100%	1.241	32%	0.322	S	S	*	.				0	133.1	0	-65.9	173.1	177.7	0	0	107.9
2	A	87.5	Confident	88	Confident	46 Å²	46	60.5 Å²	60.5	38%	0.38	32%	0.317	S	S	.	.			trans	-90.8	149.9	177.5	0	0	0	0	0	110.7	M37	A2-M37 HydrophobicContact CB-CE 3.23Å; A2-M37 HydrophobicContact CB-CG 4.19Å; A2-M37 HydrophobicContact CB-SD 3.65Å
3	L	95.8	Very high	86.6	Confident	26 Å²	26	61.9 Å²	61.9	14%	0.136	34%	0.343	C	S	.	.			trans	-69.1	137.3	-179.4	-178.6	67.1	0	0	0	109.5	M37 C38 T89	L3-M37 VanDerWaalsContact O-SD 3.42Å; L3-C38 HydrophobicContact CB-CB 4.09Å; L3-C38 HydrophobicContact CG-CB 4.47Å; L3-C38 WeakPolarHBondContact O-CB 3.2Å; L3-C38 PolarHBondContact O-N 3.44Å; L3-C38 PolarHBondContact O-SG 3.38Å; L3-T89 VanDerWaalsContact CD1-C 3.4Å; L3-T89 WeakPolarHBondContact CD1-O 3.01Å
4	Q	95.7	Very high	84.7	Confident	61 Å²	61	71 Å²	71	29%	0.285	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	137.6	172.1	176.1	-172.9	23.7	0	0	108.6	N35 R36 M37 T90 L91	Q4-N35 HydrophobicContact CG-CB 4.25Å; Q4-N35 PolarHBondContact NE2-OD1 3.33Å; Q4-R36 WeakPolarHBondContact CA-O 3.32Å; Q4-R36 WeakPolarHBondContact CG-O 3.29Å; Q4-M37 HydrophobicContact CB-SD 4.28Å; Q4-T90 HydrophobicContact CB-CG2 3.93Å; Q4-T90 CarbonylContact O-C 3.54Å; Q4-T90 VanDerWaalsContact O-CA 3.31Å; Q4-T90 WeakPolarHBondContact O-CA 2.98Å; Q4-L91 HydrophobicContact CG-CD2 3.98Å; Q4-L91 PolarHBondContact O-N 3.18Å
5	C	95.4	Very high	82.7	Confident	0 Å²	0	68.8 Å²	68.8	0%	0	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	156.9	-177.6	-57.6	0	0	0	0	110.5	N35 R36 C38 C45 C63	C5-N35 VanDerWaalsContact O-CA 3.25Å; C5-N35 WeakPolarHBondContact O-CA 3.27Å; C5-N35 WeakPolarHBondContact O-CB 3.4Å; C5-R36 PolarHBondContact N-O 3.26Å; C5-R36 PolarHBondContact O-N 2.66Å; C5-C38 PolarHBondContact SG-SG 3.22Å; C5-C45 HydrophobicContact CB-CB 3.71Å; C5-C45 WeakPolarHBondContact CB-SG 3.37Å; C5-C45 WeakPolarHBondContact SG-CA 3.45Å; C5-C45 WeakPolarHBondContact SG-CB 3.2Å; C5-C45 CovalentContact SG-SG 2.01Å; C5-C45 PolarHBondContact SG-SG 3.19Å; C5-C63 VanDerWaalsContact SG-SG 3.64Å
6	Y	93.5	Very high	80.6	Confident	33 Å²	33	80.4 Å²	80.4	13%	0.129	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.9	140.4	164	-68	-66.1	0	0	0	110	V26 T33 D34 N35 R61 D62 L91 N93 N94	Y6-V26 HydrophobicContact CD1-CG1 4.31Å; Y6-V26 HydrophobicContact CD1-CG2 4.04Å; Y6-V26 HydrophobicContact CD2-CG2 3.83Å; Y6-V26 HydrophobicContact CE1-CB 4.38Å; Y6-V26 HydrophobicContact CE1-CG1 3.51Å; Y6-V26 HydrophobicContact CE1-CG2 4.04Å; Y6-V26 HydrophobicContact CE2-CB 4.19Å; Y6-V26 HydrophobicContact CE2-CG1 3.96Å; Y6-V26 HydrophobicContact CE2-CG2 3.81Å; Y6-V26 HydrophobicContact CG-CG2 3.95Å; Y6-V26 VanDerWaalsContact OH-CG1 3.26Å; Y6-V26 WeakPolarHBondContact OH-CG1 3.36Å; Y6-T33 HydrophobicContact CD1-CG2 3.85Å; Y6-T33 HydrophobicContact CG-CG2 4.16Å; Y6-D34 CarbonylContact C-O 3.52Å; Y6-D34 WeakPolarHBondContact CA-O 3.43Å; Y6-N35 HydrophobicContact CD1-CB 4.39Å; Y6-R61 CarbonylContact O-C 3.45Å; Y6-R61 WeakPolarHBondContact O-CB 3.18Å; Y6-D62 PolarHBondContact O-N 3.42Å; Y6-L91 HydrophobicContact CD1-CD2 4.19Å; Y6-L91 HydrophobicContact CD2-CB 4.29Å; Y6-L91 HydrophobicContact CD2-CD2 4.36Å; Y6-L91 HydrophobicContact CE1-CD2 3.99Å; Y6-L91 HydrophobicContact CE2-CB 3.66Å; Y6-L91 HydrophobicContact CE2-CD2 4.18Å; Y6-L91 HydrophobicContact CE2-CG 4.4Å; Y6-L91 WeakPolarHBondContact CE2-O 3.42Å; Y6-L91 HydrophobicContact CG-CD2 4.36Å; Y6-N93 WeakPolarHBondContact CB-OD1 3.21Å; Y6-N93 PolarHBondContact N-OD1 2.82Å; Y6-N93 PolarHBondContact O-ND2 2.7Å; Y6-N94 HydrophobicContact CD2-CB 4.05Å; Y6-N94 HydrophobicContact CE2-CB 3.75Å
7	Y	91.6	Very high	78.7	Confident	109 Å²	109	80.9 Å²	80.9	43%	0.427	42%	0.415	S	S	.	.			trans	-129.2	119.5	-178.1	173.7	-103.3	0	0	0	109.2	D34 R36 R61 D62	Y7-D34 PolarHBondContact N-O 2.92Å; Y7-R36 HydrophobicContact CG-CG 4.44Å; Y7-R61 WeakPolarHBondContact CA-O 3.47Å; Y7-D62 WeakPolarHBondContact CD2-OD1 3.18Å
8	C	90.3	Very high	76.9	Confident	17 Å²	17	79.5 Å²	79.5	12%	0.115	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.6	155.3	171.7	58.3	0	0	0	0	109.7	C23 T33 Q60 R61	C8-C23 HydrophobicContact CB-CB 3.7Å; C8-C23 WeakPolarHBondContact CB-SG 3.45Å; C8-C23 WeakPolarHBondContact SG-CA 3.49Å; C8-C23 WeakPolarHBondContact SG-CB 3.43Å; C8-C23 CovalentContact SG-SG 2.04Å; C8-C23 PolarHBondContact SG-SG 3.49Å; C8-T33 HydrophobicContact CB-CG2 4.26Å; C8-Q60 CarbonylContact O-C 3.41Å; C8-Q60 WeakPolarHBondContact O-CA 3.32Å; C8-R61 PolarHBondContact N-O 2.78Å; C8-R61 PolarHBondContact O-N 3.28Å; C8-R61 PolarHBondContact SG-NH1 2.92Å
9	S	88.5	Confident	75.4	Confident	72 Å²	72	81.2 Å²	81.2	50%	0.503	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	117.7	169.8	-176.4	0	0	0	0	107.9
10	N	86.3	Confident	74.3	Confident	14 Å²	14	80.4 Å²	80.4	8%	0.075	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	134.2	174.7	-168.1	26.5	0	0	0	111.8	F12 N20 C23 E58 V59	N10-F12 WeakPolarHBondContact ND2-CE1 3.16Å; N10-N20 PolarHBondContact ND2-O 3.12Å; N10-C23 HydrophobicContact CB-CB 3.94Å; N10-E58 CarbonylContact O-C 3.55Å; N10-E58 VanDerWaalsContact O-CA 3.25Å; N10-E58 WeakPolarHBondContact O-CA 3.47Å; N10-E58 WeakPolarHBondContact O-CG 3.36Å; N10-V59 PolarHBondContact N-O 2.69Å; N10-V59 PolarHBondContact O-N 3.39Å
11	S	84.1	Confident	73.5	Confident	35 Å²	35	81.9 Å²	81.9	25%	0.245	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	112.7	176.6	-175.5	0	0	0	0	110.5	A13 K14 S15 V57	S11-A13 PolarHBondContact O-N 2.81Å; S11-K14 PolarHBondContact O-N 3.02Å; S11-S15 PolarHBondContact O-N 3.2Å; S11-V57 CarbonylContact C-O 3.54Å; S11-V57 WeakPolarHBondContact CA-O 3.09Å; S11-V57 PolarHBondContact OG-O 3.47Å
12	F	78.9	Confident	73.6	Confident	61 Å²	61	72.4 Å²	72.4	27%	0.268	39%	0.393	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.9	-17.2	178.4	-54.8	-73.6	0	0	0	112.7	N10 K14 M24 L56 V57 V59	N10-F12 WeakPolarHBondContact ND2-CE1 3.16Å; F12-K14 PolarHBondContact O-N 3.23Å; F12-M24 HydrophobicContact CE1-CG 4.31Å; F12-M24 HydrophobicContact CE1-SD 4.24Å; F12-M24 HydrophobicContact CE2-SD 3.69Å; F12-M24 HydrophobicContact CZ-CE 4.44Å; F12-M24 HydrophobicContact CZ-CG 3.73Å; F12-M24 HydrophobicContact CZ-SD 3.29Å; F12-M24 WeakPolarHBondContact CZ-SD 3.3Å; F12-L56 HydrophobicContact CD2-CD2 4.26Å; F12-L56 HydrophobicContact CD2-CG 4.14Å; F12-L56 HydrophobicContact CE2-CD2 3.82Å; F12-L56 HydrophobicContact CE2-CG 4.11Å; F12-V57 PolarHBondContact N-O 3.12Å; F12-V59 HydrophobicContact CE2-CG2 4.03Å
13	A	69.1	Low	73.3	Confident	79 Å²	79	70.2 Å²	70.2	65%	0.653	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64	-23.1	174.1	0	0	0	0	0	113	S11	S11-A13 PolarHBondContact O-N 2.81Å
14	K	60.4	Low	72.2	Confident	189 Å²	189	72 Å²	72	82%	0.822	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113	-18.5	-177.4	-63.1	-176.3	179.7	-177.5	0	113.5	S11 F12 R16	S11-K14 PolarHBondContact O-N 3.02Å; F12-K14 PolarHBondContact O-N 3.23Å; K14-R16 PolarHBondContact O-N 2.76Å
15	S	55	Low	70.6	Confident	38 Å²	38	70.4 Å²	70.4	27%	0.266	38%	0.381	S	S	.	.			trans	-87.2	90.2	-178.3	-147.4	0	0	0	0	111.2	S11 T17	S11-S15 PolarHBondContact O-N 3.2Å; S15-T17 PolarHBondContact OG-O 2.93Å
16	R	49.4	Very low	68.8	Low	254 Å²	254	71.8 Å²	71.8	96%	0.958	39%	0.389	S	S	*	.			trans	-71.9	-19.4	166.2	-71.7	-172	177.3	176.1	-0.8	112.4	K14	K14-R16 PolarHBondContact O-N 2.76Å
17	T	48.2	Very low	66.9	Low	90 Å²	90	75.7 Å²	75.7	55%	0.552	41%	0.412	S	S	*	.	S	Bend	trans	-98.5	120.1	174.9	49	0	0	0	0	108.1	S15 T19	S15-T17 PolarHBondContact OG-O 2.93Å; T17-T19 PolarHBondContact O-N 3.08Å
18	G	46.7	Very low	64.7	Low	55 Å²	55	72.9 Å²	72.9	57%	0.567	42%	0.416	S	S	*	.			trans	-66.9	27.5	-176.7	0	0	0	0	0	115.3	M21	G18-M21 WeakPolarHBondContact O-CE 3.38Å
19	T	47.8	Very low	62.5	Low	112 Å²	112	76 Å²	76	69%	0.687	45%	0.451	S	S	*	.			trans	-92.3	1.9	-163.8	48.8	0	0	0	0	114.8	T17	T17-T19 PolarHBondContact O-N 3.08Å
20	N	52.7	Low	60.5	Low	64 Å²	64	77.8 Å²	77.8	34%	0.342	46%	0.463	S	S	.	.			trans	-127.4	47.1	179.6	-154.4	-19.5	0	0	0	112.4	N10 D22	N10-N20 PolarHBondContact ND2-O 3.12Å; N20-D22 PolarHBondContact O-N 3.25Å; N20-D22 VanDerWaalsContact O-N 3.12Å
21	M	58.9	Low	58.9	Low	113 Å²	113	81.5 Å²	81.5	56%	0.557	48%	0.48	S	S	*	.	G	3₁₀ helix	trans	-67.6	-0.9	172	-70.1	-175.5	-92.5	0	0	113	G18 C23 M24	G18-M21 WeakPolarHBondContact O-CE 3.38Å; M21-C23 PolarHBondContact O-N 2.64Å; M21-C23 VanDerWaalsContact O-N 3.08Å; M21-M24 WeakPolarHBondContact O-CB 3.25Å; M21-M24 PolarHBondContact O-N 3.41Å
22	D	69.5	Low	57.6	Low	52 Å²	52	88.6 Å²	88.6	28%	0.278	51%	0.507	S	S	.	.	G	3₁₀ helix	trans	-63.5	-20.6	-173.7	-58.5	-30	0	0	0	113.8	N20 H31 T33	N20-D22 PolarHBondContact O-N 3.25Å; N20-D22 VanDerWaalsContact O-N 3.12Å; D22-H31 IonicContact OD1-CE1 3.81Å; D22-H31 IonicContact OD1-CG 3.59Å; D22-H31 IonicContact OD1-ND1 2.76Å; D22-H31 PolarHBondContact OD1-ND1 3.37Å; D22-T33 PolarHBondContact O-OG1 2.87Å
23	C	81.6	Confident	57	Low	0 Å²	0	86.2 Å²	86.2	0%	0	50%	0.497	C	S	.	.	G	3₁₀ helix	trans	-93.9	11.2	175.3	-150.3	0	0	0	0	113.4	C8 N10 M21 V59 R61	C8-C23 HydrophobicContact CB-CB 3.7Å; C8-C23 WeakPolarHBondContact CB-SG 3.45Å; C8-C23 WeakPolarHBondContact SG-CA 3.49Å; C8-C23 WeakPolarHBondContact SG-CB 3.43Å; C8-C23 CovalentContact SG-SG 2.04Å; C8-C23 PolarHBondContact SG-SG 3.49Å; N10-C23 HydrophobicContact CB-CB 3.94Å; M21-C23 PolarHBondContact O-N 2.64Å; M21-C23 VanDerWaalsContact O-N 3.08Å; C23-V59 WeakPolarHBondContact O-CG1 3.07Å; C23-V59 PolarHBondContact SG-O 2.91Å; C23-R61 PolarHBondContact O-NH1 3.39Å; C23-R61 PolarHBondContact O-NH2 3.38Å; C23-R61 PolarHBondContact SG-NH1 2.03Å; C23-R61 VanDerWaalsContact SG-NH1 3.42Å
24	M	71.7	Confident	57.7	Low	64 Å²	64	87.6 Å²	87.6	32%	0.315	49%	0.493	S	S	.	.	S	Bend	trans	-95.2	-33.3	-176.1	-69.5	-66.2	-78.3	0	0	114.6	F12 M21 L56 V59 P97	F12-M24 HydrophobicContact CE1-CG 4.31Å; F12-M24 HydrophobicContact CE1-SD 4.24Å; F12-M24 HydrophobicContact CE2-SD 3.69Å; F12-M24 HydrophobicContact CZ-CE 4.44Å; F12-M24 HydrophobicContact CZ-CG 3.73Å; F12-M24 HydrophobicContact CZ-SD 3.29Å; F12-M24 WeakPolarHBondContact CZ-SD 3.3Å; M21-M24 WeakPolarHBondContact O-CB 3.25Å; M21-M24 PolarHBondContact O-N 3.41Å; M24-L56 HydrophobicContact CE-CD2 3.47Å; M24-L56 VanDerWaalsContact CE-CD2 3.47Å; M24-L56 HydrophobicContact SD-CD2 3.53Å; M24-L56 VanDerWaalsContact SD-CD2 3.53Å; M24-V59 HydrophobicContact SD-CG2 4.06Å; M24-P97 HydrophobicContact CE-CG 4.1Å; M24-P97 WeakPolarHBondContact O-CD 3.36Å; M24-P97 HydrophobicContact SD-CG 3.74Å
25	A	62.5	Low	59.1	Low	28 Å²	28	82.3 Å²	82.3	23%	0.231	47%	0.474	C	S	.	.			trans	-166.1	138.9	174.5	0	0	0	0	0	111.2	R96	A25-R96 HydrophobicContact CB-CG 4.29Å
26	V	59.2	Low	60.9	Low	28 Å²	28	83.3 Å²	83.3	17%	0.17	47%	0.472	C	S	.	.	S	Bend	trans	-89.4	-20.5	174	-164.5	0	0	0	0	112.1	Y6 G28 T33 N94	Y6-V26 HydrophobicContact CD1-CG1 4.31Å; Y6-V26 HydrophobicContact CD1-CG2 4.04Å; Y6-V26 HydrophobicContact CD2-CG2 3.83Å; Y6-V26 HydrophobicContact CE1-CB 4.38Å; Y6-V26 HydrophobicContact CE1-CG1 3.51Å; Y6-V26 HydrophobicContact CE1-CG2 4.04Å; Y6-V26 HydrophobicContact CE2-CB 4.19Å; Y6-V26 HydrophobicContact CE2-CG1 3.96Å; Y6-V26 HydrophobicContact CE2-CG2 3.81Å; Y6-V26 HydrophobicContact CG-CG2 3.95Å; Y6-V26 VanDerWaalsContact OH-CG1 3.26Å; Y6-V26 WeakPolarHBondContact OH-CG1 3.36Å; V26-G28 PolarHBondContact O-N 2.93Å; V26-T33 HydrophobicContact CG2-CG2 4.32Å; V26-N94 HydrophobicContact CB-CB 4.06Å; V26-N94 HydrophobicContact CG2-CB 3.91Å
27	N	52.1	Low	63.2	Low	115 Å²	115	76.8 Å²	76.8	62%	0.615	45%	0.454	S	S	*	.	S	Bend	trans	-95.4	77.7	178.8	-69.3	-15.7	0	0	0	109.8
28	G	46.2	Very low	65.5	Low	51 Å²	51	72.8 Å²	72.8	53%	0.526	43%	0.429	S	S	.	.	S	Bend	trans	-175.7	45.4	-176.8	0	0	0	0	0	113.4	V26 S30	V26-G28 PolarHBondContact O-N 2.93Å; G28-S30 VanDerWaalsContact C-N 3.29Å; G28-S30 PolarHBondContact O-N 3.23Å
29	G	42.8	Very low	67.8	Low	81 Å²	81	75.5 Å²	75.5	84%	0.835	43%	0.429	S	S	*	.	S	Bend	trans	65.6	-15.9	150.9	0	0	0	0	0	121.3
30	S	46.6	Very low	70	Confident	110 Å²	110	76.3 Å²	76.3	77%	0.769	44%	0.436	S	S	*	.	S	Bend	trans	-154.5	0.3	-173.3	-57.9	0	0	0	0	117.1	G28	G28-S30 VanDerWaalsContact C-N 3.29Å; G28-S30 PolarHBondContact O-N 3.23Å
31	H	53.9	Low	72.1	Confident	92 Å²	92	75.9 Å²	75.9	43%	0.426	44%	0.438	S	S	.	.			trans	-106.5	116.3	-177.2	-71.6	-83.1	0	0	0	111.4	D22 T33	D22-H31 IonicContact OD1-CE1 3.81Å; D22-H31 IonicContact OD1-CG 3.59Å; D22-H31 IonicContact OD1-ND1 2.76Å; D22-H31 PolarHBondContact OD1-ND1 3.37Å; H31-T33 VanDerWaalsContact C-N 3.29Å; H31-T33 PolarHBondContact O-N 3.24Å
32	K	57.1	Low	73.9	Confident	185 Å²	185	71.4 Å²	71.4	80%	0.804	42%	0.416	S	S	*	.			trans	-71.1	85.2	174.1	-72.9	-176.9	179.8	-179.5	0	108.6	D34	K32-D34 PolarHBondContact O-N 3.3Å
33	T	64.7	Low	75.2	Confident	11 Å²	11	77.9 Å²	77.9	7%	0.067	44%	0.436	C	S	.	.			trans	-68.4	114.3	159.6	-47.7	0	0	0	0	106.7	Y6 C8 D22 V26 H31	Y6-T33 HydrophobicContact CD1-CG2 3.85Å; Y6-T33 HydrophobicContact CG-CG2 4.16Å; C8-T33 HydrophobicContact CB-CG2 4.26Å; D22-T33 PolarHBondContact O-OG1 2.87Å; V26-T33 HydrophobicContact CG2-CG2 4.32Å; H31-T33 VanDerWaalsContact C-N 3.29Å; H31-T33 PolarHBondContact O-N 3.24Å
34	D	83.7	Confident	75.9	Confident	107 Å²	107	82 Å²	82	57%	0.572	45%	0.452	S	S	*	.			trans	-54	150.3	175.2	-72.3	-31.1	0	0	0	109.9	Y6 Y7 K32	Y6-D34 CarbonylContact C-O 3.52Å; Y6-D34 WeakPolarHBondContact CA-O 3.43Å; Y7-D34 PolarHBondContact N-O 2.92Å; K32-D34 PolarHBondContact O-N 3.3Å
35	N	90.5	Very high	77.1	Confident	78 Å²	78	79 Å²	79	42%	0.417	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	153.3	171.6	59.6	54.9	0	0	0	108.6	Q4 C5 Y6 L91	Q4-N35 HydrophobicContact CG-CB 4.25Å; Q4-N35 PolarHBondContact NE2-OD1 3.33Å; C5-N35 VanDerWaalsContact O-CA 3.25Å; C5-N35 WeakPolarHBondContact O-CA 3.27Å; C5-N35 WeakPolarHBondContact O-CB 3.4Å; Y6-N35 HydrophobicContact CD1-CB 4.39Å; N35-L91 HydrophobicContact CB-CD2 3.7Å
36	R	93.7	Very high	78.7	Confident	60 Å²	60	80.1 Å²	80.1	23%	0.226	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	151.2	175.6	75.5	177.1	-174.9	85.2	-12.6	111	Q4 C5 Y7 E42 D62 C63	Q4-R36 WeakPolarHBondContact CA-O 3.32Å; Q4-R36 WeakPolarHBondContact CG-O 3.29Å; C5-R36 PolarHBondContact N-O 3.26Å; C5-R36 PolarHBondContact O-N 2.66Å; Y7-R36 HydrophobicContact CG-CG 4.44Å; R36-E42 IonicContact CZ-OE1 3.74Å; R36-E42 IonicContact CZ-OE2 3.6Å; R36-E42 IonicContact NH1-OE1 3.42Å; R36-E42 IonicContact NH1-OE2 2.85Å; R36-E42 PolarHBondContact NH1-OE2 2.81Å; R36-E42 IonicContact NH2-OE1 3.77Å; R36-E42 PolarHBondContact NH2-OE1 2.87Å; R36-E42 IonicContact NH2-OE2 2.68Å; R36-E42 PolarHBondContact NH2-OE2 2.91Å; R36-D62 IonicContact CZ-OD1 2.84Å; R36-D62 IonicContact NE-OD1 3.63Å; R36-D62 PolarHBondContact NE-OD1 2.82Å; R36-D62 IonicContact NH2-OD1 3.9Å; R36-D62 PolarHBondContact NH2-OD1 2.84Å; R36-D62 IonicContact NH2-OD2 2.86Å; R36-C63 VanDerWaalsContact CZ-SG 3.53Å; R36-C63 PolarHBondContact NH1-SG 2.78Å; R36-C63 VanDerWaalsContact NH1-SG 3.44Å; R36-C63 VanDerWaalsContact NH2-CB 3.29Å
37	M	96.1	Very high	80.3	Confident	116 Å²	116	78.8 Å²	78.8	57%	0.571	43%	0.429	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.2	134	166.7	-163.9	61.7	135.1	0	0	109.1	A2 L3 Q4	A2-M37 HydrophobicContact CB-CE 3.23Å; A2-M37 HydrophobicContact CB-CG 4.19Å; A2-M37 HydrophobicContact CB-SD 3.65Å; L3-M37 VanDerWaalsContact O-SD 3.42Å; Q4-M37 HydrophobicContact CB-SD 4.28Å
38	C	96.9	Very high	82.3	Confident	6 Å²	6	73.4 Å²	73.4	4%	0.041	40%	0.4	C	S	.	.	P	Polyproline II helix	trans	-81.2	148.6	175.8	-55	0	0	0	0	110.3	L3 C5 E42 C63	L3-C38 HydrophobicContact CB-CB 4.09Å; L3-C38 HydrophobicContact CG-CB 4.47Å; L3-C38 WeakPolarHBondContact O-CB 3.2Å; L3-C38 PolarHBondContact O-N 3.44Å; L3-C38 PolarHBondContact O-SG 3.38Å; C5-C38 PolarHBondContact SG-SG 3.22Å; C38-E42 WeakPolarHBondContact CA-OE2 3.11Å; C38-E42 HydrophobicContact CB-CB 3.88Å; C38-C63 WeakPolarHBondContact CA-SG 3.33Å; C38-C63 HydrophobicContact CB-CB 3.62Å; C38-C63 WeakPolarHBondContact CB-SG 3.2Å; C38-C63 WeakPolarHBondContact SG-CB 3.32Å; C38-C63 CovalentContact SG-SG 2.04Å; C38-C63 PolarHBondContact SG-SG 2.81Å
39	M	95.9	Very high	84.4	Confident	112 Å²	112	71 Å²	71	55%	0.552	38%	0.375	S	S	*	.	P	Polyproline II helix	trans	-63.1	154.5	168.9	-61	-175.1	-171.5	0	0	109.9	S41 E42	M39-S41 PolarHBondContact O-N 2.84Å; M39-E42 HydrophobicContact CB-CB 4.49Å; M39-E42 HydrophobicContact CB-CG 4.08Å; M39-E42 PolarHBondContact N-OE2 3.36Å; M39-E42 WeakPolarHBondContact O-CA 3.1Å; M39-E42 WeakPolarHBondContact O-CB 3.41Å; M39-E42 PolarHBondContact O-N 3.29Å
40	P	94.1	Very high	86.7	Confident	129 Å²	129	68.8 Å²	68.8	84%	0.838	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.6	-25.1	176.1	-27.8	35.5	0	0	0	114.5
41	S	95.8	Very high	88.6	Confident	55 Å²	55	64 Å²	64	39%	0.385	31%	0.309	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.5	-15.6	175.4	59.2	0	0	0	0	114.2	M39 R43 K65	M39-S41 PolarHBondContact O-N 2.84Å; S41-R43 PolarHBondContact O-N 2.89Å; S41-K65 WeakPolarHBondContact O-CA 3.4Å; S41-K65 WeakPolarHBondContact OG-CE 3.24Å
42	E	97.1	Very high	90.2	Very high	20 Å²	20	61.3 Å²	61.3	9%	0.093	30%	0.3	C	S	.	.			trans	-93.1	89.4	-179.6	-67.6	179.8	128	0	0	110.5	R36 C38 M39 W44 C63 S64 K65	R36-E42 IonicContact CZ-OE1 3.74Å; R36-E42 IonicContact CZ-OE2 3.6Å; R36-E42 IonicContact NH1-OE1 3.42Å; R36-E42 IonicContact NH1-OE2 2.85Å; R36-E42 PolarHBondContact NH1-OE2 2.81Å; R36-E42 IonicContact NH2-OE1 3.77Å; R36-E42 PolarHBondContact NH2-OE1 2.87Å; R36-E42 IonicContact NH2-OE2 2.68Å; R36-E42 PolarHBondContact NH2-OE2 2.91Å; C38-E42 WeakPolarHBondContact CA-OE2 3.11Å; C38-E42 HydrophobicContact CB-CB 3.88Å; M39-E42 HydrophobicContact CB-CB 4.49Å; M39-E42 HydrophobicContact CB-CG 4.08Å; M39-E42 PolarHBondContact N-OE2 3.36Å; M39-E42 WeakPolarHBondContact O-CA 3.1Å; M39-E42 WeakPolarHBondContact O-CB 3.41Å; M39-E42 PolarHBondContact O-N 3.29Å; E42-W44 VanDerWaalsContact C-N 3.34Å; E42-W44 PolarHBondContact O-N 2.82Å; E42-C63 HydrophobicContact CB-CB 3.87Å; E42-C63 HydrophobicContact CG-CB 4.23Å; E42-C63 WeakPolarHBondContact OE2-CB 3.36Å; E42-S64 CarbonylContact C-O 3.54Å; E42-S64 WeakPolarHBondContact CA-O 2.94Å; E42-K65 HydrophobicContact CG-CG 3.84Å
43	R	96.1	Very high	91.5	Very high	187 Å²	187	57 Å²	57	71%	0.706	29%	0.286	S	S	*	.			trans	-87.9	3.3	-174.2	-60.6	-175.2	-178.8	173.7	-0.3	114.5	S41 S64	S41-R43 PolarHBondContact O-N 2.89Å; R43-S64 PolarHBondContact N-O 2.85Å
44	W	97.5	Very high	92.3	Very high	88 Å²	88	59.4 Å²	59.4	33%	0.333	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	137.1	-173.4	-55.8	90.8	0	0	0	112.1	E42 C63 S64 C67 C86 C87 N88	E42-W44 VanDerWaalsContact C-N 3.34Å; E42-W44 PolarHBondContact O-N 2.82Å; W44-C63 CarbonylContact O-C 3.6Å; W44-C63 WeakPolarHBondContact O-CA 3.26Å; W44-S64 PolarHBondContact N-O 3.28Å; W44-S64 PolarHBondContact O-N 3.09Å; W44-C67 HydrophobicContact CB-CB 3.69Å; W44-C67 HydrophobicContact CD2-CB 4.42Å; W44-C67 HydrophobicContact CG-CB 3.85Å; W44-C86 HydrophobicContact CE3-CB 4.19Å; W44-C87 CarbonylContact C-O 3.51Å; W44-C87 WeakPolarHBondContact CA-O 3.37Å; W44-N88 HydrophobicContact CE3-CB 3.92Å; W44-N88 HydrophobicContact CZ3-CB 3.99Å
45	C	96.4	Very high	92.3	Very high	0 Å²	0	58.9 Å²	58.9	0%	0	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.7	131.4	157	-55.1	0	0	0	0	109.3	C5 C86 C87 C92 N93	C5-C45 HydrophobicContact CB-CB 3.71Å; C5-C45 WeakPolarHBondContact CB-SG 3.37Å; C5-C45 WeakPolarHBondContact SG-CA 3.45Å; C5-C45 WeakPolarHBondContact SG-CB 3.2Å; C5-C45 CovalentContact SG-SG 2.01Å; C5-C45 PolarHBondContact SG-SG 3.19Å; C45-C86 WeakPolarHBondContact O-CA 3.41Å; C45-C87 PolarHBondContact N-O 2.86Å; C45-C87 PolarHBondContact O-N 2.82Å; C45-C92 VanDerWaalsContact SG-SG 3.69Å; C45-N93 HydrophobicContact CB-CB 3.69Å
46	K	95.8	Very high	92.1	Very high	51 Å²	51	56.7 Å²	56.7	22%	0.222	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	135.7	-178.2	-178.9	178.2	64.9	-172.9	0	109.5	R61 D62 K85 N93	K46-R61 WeakPolarHBondContact O-CA 3.48Å; K46-D62 PolarHBondContact N-O 3.3Å; K46-D62 PolarHBondContact O-N 2.91Å; K46-K85 WeakPolarHBondContact CA-O 3Å; K46-N93 PolarHBondContact O-ND2 3.45Å
47	G	93.7	Very high	91.8	Very high	1 Å²	1	55.5 Å²	55.5	1%	0.01	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	135.1	165	0	0	0	0	0	108.9	Q60 K84 K85	G47-Q60 CarbonylContact C-O 3.54Å; G47-Q60 WeakPolarHBondContact CA-O 3.21Å; G47-K84 CarbonylContact O-C 3.5Å; G47-K84 WeakPolarHBondContact O-CA 3.21Å; G47-K85 PolarHBondContact N-O 2.94Å; G47-K85 PolarHBondContact O-N 2.83Å
48	T	93.3	Very high	91.4	Very high	2 Å²	2	51.9 Å²	51.9	1%	0.012	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131	131.9	179.2	-53.6	0	0	0	0	109.5	H50 V59 Q60 K82 C83 K84	T48-H50 WeakPolarHBondContact CG2-NE2 3.36Å; T48-V59 CarbonylContact O-C 3.47Å; T48-V59 WeakPolarHBondContact O-CA 3.32Å; T48-Q60 PolarHBondContact N-O 3.15Å; T48-Q60 PolarHBondContact O-N 3.48Å; T48-K82 HydrophobicContact CG2-CD 4.5Å; T48-K82 HydrophobicContact CG2-CG 4.11Å; T48-C83 CarbonylContact C-O 3.58Å; T48-C83 WeakPolarHBondContact CA-O 3.31Å; T48-K84 HydrophobicContact CG2-CG 4.21Å
49	A	90.9	Very high	91.1	Very high	0 Å²	0	51.6 Å²	51.6	0%	0	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	135.2	171.1	0	0	0	0	0	109.9	F51 L56 E58 C83 P97 L100	A49-F51 HydrophobicContact CB-CD2 4.47Å; A49-F51 HydrophobicContact CB-CE2 3.46Å; A49-F51 VanDerWaalsContact CB-CE2 3.46Å; A49-F51 HydrophobicContact CB-CZ 3.83Å; A49-L56 HydrophobicContact CB-CD1 3.91Å; A49-E58 CarbonylContact C-O 3.53Å; A49-E58 WeakPolarHBondContact CA-O 3.41Å; A49-C83 PolarHBondContact N-O 3.43Å; A49-C83 PolarHBondContact O-N 3.17Å; A49-P97 HydrophobicContact CB-CB 4.29Å; A49-L100 HydrophobicContact CB-CB 4.1Å; A49-L100 HydrophobicContact CB-CD1 3.53Å; A49-L100 HydrophobicContact CB-CG 4.42Å
50	H	90.7	Very high	90.9	Very high	34 Å²	34	49 Å²	49	16%	0.157	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	134.8	175.6	-61.5	177.8	0	0	0	110.2	T48 V57 E58 V81 K82	T48-H50 WeakPolarHBondContact CG2-NE2 3.36Å; H50-V57 HydrophobicContact CB-CG2 3.9Å; H50-V57 WeakPolarHBondContact O-CG2 3.42Å; H50-V57 PolarHBondContact O-N 3.46Å; H50-E58 HydrophobicContact CB-CB 4.02Å; H50-E58 IonicContact CE1-OE2 3.08Å; H50-E58 PolarHBondContact CE1-OE2 3.09Å; H50-E58 IonicContact CG-OE2 3.61Å; H50-E58 PolarHBondContact N-O 2.85Å; H50-E58 IonicContact ND1-OE2 2.7Å; H50-E58 PolarHBondContact ND1-OE2 2.94Å; H50-E58 IonicContact NE2-OE2 2.67Å; H50-E58 PolarHBondContact O-N 3.12Å; H50-V81 CarbonylContact C-O 3.56Å; H50-V81 VanDerWaalsContact CA-O 3.31Å; H50-V81 WeakPolarHBondContact CA-O 3.4Å; H50-K82 VanDerWaalsContact CD2-CG 3.42Å; H50-K82 WeakPolarHBondContact CD2-CG 3.31Å; H50-K82 PolarHBondContact CE1-NZ 2.82Å; H50-K82 WeakPolarHBondContact NE2-CD 3.45Å; H50-K82 WeakPolarHBondContact NE2-CE 3.25Å; H50-K82 WeakPolarHBondContact NE2-CG 3.46Å; H50-K82 PolarHBondContact NE2-NZ 3.28Å
51	F	87.5	Confident	90.9	Very high	11 Å²	11	43.1 Å²	43.1	5%	0.048	23%	0.228	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121	142.3	177.6	-57.3	-95.8	0	0	0	109.3	A49 V55 L56 K80 V81 I101	A49-F51 HydrophobicContact CB-CD2 4.47Å; A49-F51 HydrophobicContact CB-CE2 3.46Å; A49-F51 VanDerWaalsContact CB-CE2 3.46Å; A49-F51 HydrophobicContact CB-CZ 3.83Å; F51-V55 CarbonylContact C-O 3.56Å; F51-V55 WeakPolarHBondContact CA-O 3.33Å; F51-L56 HydrophobicContact CD1-CB 4.02Å; F51-L56 HydrophobicContact CD1-CD1 4.16Å; F51-L56 HydrophobicContact CE1-CB 3.75Å; F51-L56 HydrophobicContact CE1-CD1 3.56Å; F51-L56 HydrophobicContact CE1-CG 4.25Å; F51-L56 HydrophobicContact CE2-CD1 4.08Å; F51-L56 HydrophobicContact CZ-CD1 3.49Å; F51-L56 VanDerWaalsContact CZ-CD1 3.49Å; F51-K80 CarbonylContact O-C 3.47Å; F51-K80 VanDerWaalsContact O-CA 3.3Å; F51-K80 WeakPolarHBondContact O-CA 3.44Å; F51-V81 HydrophobicContact CB-CB 4.28Å; F51-V81 PolarHBondContact N-O 3.23Å; F51-V81 PolarHBondContact O-N 3.14Å; F51-I101 HydrophobicContact CD1-CD1 3.69Å; F51-I101 HydrophobicContact CD2-CD1 3.65Å; F51-I101 HydrophobicContact CD2-CG1 3.8Å; F51-I101 HydrophobicContact CE1-CD1 3.24Å; F51-I101 HydrophobicContact CE1-CG1 4.18Å; F51-I101 HydrophobicContact CE2-CD1 3.22Å; F51-I101 HydrophobicContact CE2-CG1 3.19Å; F51-I101 HydrophobicContact CG-CD1 3.89Å; F51-I101 HydrophobicContact CZ-CD1 3.01Å; F51-I101 HydrophobicContact CZ-CG1 3.44Å; F51-I101 VanDerWaalsContact CZ-CG1 3.44Å
52	S	86.2	Confident	90.9	Very high	35 Å²	35	42.7 Å²	42.7	25%	0.245	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128	117.3	172.6	-169.9	0	0	0	0	108.1	G54 V55 S79	S52-G54 PolarHBondContact O-N 2.94Å; S52-V55 PolarHBondContact N-O 3.16Å; S52-V55 WeakPolarHBondContact O-CB 3.1Å; S52-V55 PolarHBondContact O-N 3.33Å; S52-S79 CarbonylContact C-O 3.55Å; S52-S79 WeakPolarHBondContact CA-O 3.36Å
53	N	85	Confident	90.9	Very high	94 Å²	94	41.9 Å²	41.9	50%	0.503	22%	0.218	S	C	.	.	T	Hydrogen-bonded Turn	trans	51.8	42.2	-172.6	-69.8	-11	0	0	0	113	V55 V78 S79	N53-V55 PolarHBondContact O-N 3.01Å; N53-V78 WeakPolarHBondContact OD1-CA 3.49Å; N53-V78 WeakPolarHBondContact OD1-CG1 3.35Å; N53-S79 WeakPolarHBondContact CA-OG 3.48Å; N53-S79 PolarHBondContact N-O 2.93Å; N53-S79 PolarHBondContact OD1-N 3.13Å; N53-S79 PolarHBondContact OD1-OG 2.68Å
54	G	81.6	Confident	90.9	Very high	62 Å²	62	33.7 Å²	33.7	64%	0.639	19%	0.189	S	C	*	.	T	Hydrogen-bonded Turn	trans	77.3	-10.2	-178.3	0	0	0	0	0	115	S52	S52-G54 PolarHBondContact O-N 2.94Å
55	V	84	Confident	90.9	Very high	96 Å²	96	35 Å²	35	58%	0.582	20%	0.198	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-87.7	130.6	178.6	-178.1	0	0	0	0	110.1	F51 S52 N53 V57	F51-V55 CarbonylContact C-O 3.56Å; F51-V55 WeakPolarHBondContact CA-O 3.33Å; S52-V55 PolarHBondContact N-O 3.16Å; S52-V55 WeakPolarHBondContact O-CB 3.1Å; S52-V55 PolarHBondContact O-N 3.33Å; N53-V55 PolarHBondContact O-N 3.01Å; V55-V57 PolarHBondContact O-N 3.22Å
56	L	85.8	Confident	90.8	Very high	31 Å²	31	42 Å²	42	16%	0.162	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-65	119.9	173.2	-177.9	71.7	0	0	0	110.2	F12 M24 A49 F51 V59 P97	F12-L56 HydrophobicContact CD2-CD2 4.26Å; F12-L56 HydrophobicContact CD2-CG 4.14Å; F12-L56 HydrophobicContact CE2-CD2 3.82Å; F12-L56 HydrophobicContact CE2-CG 4.11Å; M24-L56 HydrophobicContact CE-CD2 3.47Å; M24-L56 VanDerWaalsContact CE-CD2 3.47Å; M24-L56 HydrophobicContact SD-CD2 3.53Å; M24-L56 VanDerWaalsContact SD-CD2 3.53Å; A49-L56 HydrophobicContact CB-CD1 3.91Å; F51-L56 HydrophobicContact CD1-CB 4.02Å; F51-L56 HydrophobicContact CD1-CD1 4.16Å; F51-L56 HydrophobicContact CE1-CB 3.75Å; F51-L56 HydrophobicContact CE1-CD1 3.56Å; F51-L56 HydrophobicContact CE1-CG 4.25Å; F51-L56 HydrophobicContact CE2-CD1 4.08Å; F51-L56 HydrophobicContact CZ-CD1 3.49Å; F51-L56 VanDerWaalsContact CZ-CD1 3.49Å; L56-V59 HydrophobicContact CD1-CG2 3.77Å; L56-V59 HydrophobicContact CD2-CG2 3.71Å; L56-V59 HydrophobicContact CG-CG2 4.1Å; L56-P97 HydrophobicContact CD1-CB 3.84Å; L56-P97 HydrophobicContact CD2-CB 3.63Å; L56-P97 HydrophobicContact CD2-CG 3.76Å; L56-P97 HydrophobicContact CG-CB 4.39Å
57	V	87.1	Confident	90.8	Very high	36 Å²	36	40.5 Å²	40.5	22%	0.218	23%	0.23	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	-17.4	-179.2	-65.1	0	0	0	0	113.3	S11 F12 H50 V55	S11-V57 CarbonylContact C-O 3.54Å; S11-V57 WeakPolarHBondContact CA-O 3.09Å; S11-V57 PolarHBondContact OG-O 3.47Å; F12-V57 PolarHBondContact N-O 3.12Å; H50-V57 HydrophobicContact CB-CG2 3.9Å; H50-V57 WeakPolarHBondContact O-CG2 3.42Å; H50-V57 PolarHBondContact O-N 3.46Å; V55-V57 PolarHBondContact O-N 3.22Å
58	E	88.9	Confident	90.7	Very high	39 Å²	39	49.2 Å²	49.2	18%	0.182	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.9	142.9	179.8	-178	175.5	-141.1	0	0	112	N10 A49 H50 Q60	N10-E58 CarbonylContact O-C 3.55Å; N10-E58 VanDerWaalsContact O-CA 3.25Å; N10-E58 WeakPolarHBondContact O-CA 3.47Å; N10-E58 WeakPolarHBondContact O-CG 3.36Å; A49-E58 CarbonylContact C-O 3.53Å; A49-E58 WeakPolarHBondContact CA-O 3.41Å; H50-E58 HydrophobicContact CB-CB 4.02Å; H50-E58 IonicContact CE1-OE2 3.08Å; H50-E58 PolarHBondContact CE1-OE2 3.09Å; H50-E58 IonicContact CG-OE2 3.61Å; H50-E58 PolarHBondContact N-O 2.85Å; H50-E58 IonicContact ND1-OE2 2.7Å; H50-E58 PolarHBondContact ND1-OE2 2.94Å; H50-E58 IonicContact NE2-OE2 2.67Å; H50-E58 PolarHBondContact O-N 3.12Å; E58-Q60 HydrophobicContact CG-CG 4.03Å; E58-Q60 PolarHBondContact OE1-NE2 2.75Å
59	V	90.1	Very high	90.6	Very high	1 Å²	1	56.4 Å²	56.4	1%	0.006	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	134.6	169	-177.2	0	0	0	0	109	N10 F12 C23 M24 T48 L56 P97	N10-V59 PolarHBondContact N-O 2.69Å; N10-V59 PolarHBondContact O-N 3.39Å; F12-V59 HydrophobicContact CE2-CG2 4.03Å; C23-V59 WeakPolarHBondContact O-CG1 3.07Å; C23-V59 PolarHBondContact SG-O 2.91Å; M24-V59 HydrophobicContact SD-CG2 4.06Å; T48-V59 CarbonylContact O-C 3.47Å; T48-V59 WeakPolarHBondContact O-CA 3.32Å; L56-V59 HydrophobicContact CD1-CG2 3.77Å; L56-V59 HydrophobicContact CD2-CG2 3.71Å; L56-V59 HydrophobicContact CG-CG2 4.1Å; V59-P97 HydrophobicContact CG1-CG 4.42Å; V59-P97 HydrophobicContact CG2-CB 3.95Å; V59-P97 HydrophobicContact CG2-CG 3.52Å
60	Q	92.2	Very high	90.6	Very high	58 Å²	58	64 Å²	64	27%	0.271	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	136.2	176	-55.8	-179.6	-7.5	0	0	110.5	C8 G47 T48 E58	C8-Q60 CarbonylContact O-C 3.41Å; C8-Q60 WeakPolarHBondContact O-CA 3.32Å; G47-Q60 CarbonylContact C-O 3.54Å; G47-Q60 WeakPolarHBondContact CA-O 3.21Å; T48-Q60 PolarHBondContact N-O 3.15Å; T48-Q60 PolarHBondContact O-N 3.48Å; E58-Q60 HydrophobicContact CG-CG 4.03Å; E58-Q60 PolarHBondContact OE1-NE2 2.75Å
61	R	93.1	Very high	90.6	Very high	4 Å²	4	63.5 Å²	63.5	2%	0.015	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	134	171.1	-67	-170.3	-176.7	77.4	5.5	108.9	Y6 Y7 C8 C23 K46 N93 W95	Y6-R61 CarbonylContact O-C 3.45Å; Y6-R61 WeakPolarHBondContact O-CB 3.18Å; Y7-R61 WeakPolarHBondContact CA-O 3.47Å; C8-R61 PolarHBondContact N-O 2.78Å; C8-R61 PolarHBondContact O-N 3.28Å; C8-R61 PolarHBondContact SG-NH1 2.92Å; C23-R61 PolarHBondContact O-NH1 3.39Å; C23-R61 PolarHBondContact O-NH2 3.38Å; C23-R61 PolarHBondContact SG-NH1 2.03Å; C23-R61 VanDerWaalsContact SG-NH1 3.42Å; K46-R61 WeakPolarHBondContact O-CA 3.48Å; R61-N93 WeakPolarHBondContact CD-O 3.18Å; R61-N93 PolarHBondContact NE-O 2.67Å; R61-W95 PolarHBondContact NH2-O 3.36Å
62	D	95	Very high	90.7	Very high	47 Å²	47	65.4 Å²	65.4	25%	0.251	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.3	165.5	-178.8	-156.3	5.6	0	0	0	112.3	Y6 Y7 R36 K46	Y6-D62 PolarHBondContact O-N 3.42Å; Y7-D62 WeakPolarHBondContact CD2-OD1 3.18Å; R36-D62 IonicContact CZ-OD1 2.84Å; R36-D62 IonicContact NE-OD1 3.63Å; R36-D62 PolarHBondContact NE-OD1 2.82Å; R36-D62 IonicContact NH2-OD1 3.9Å; R36-D62 PolarHBondContact NH2-OD1 2.84Å; R36-D62 IonicContact NH2-OD2 2.86Å; K46-D62 PolarHBondContact N-O 3.3Å; K46-D62 PolarHBondContact O-N 2.91Å
63	C	97.2	Very high	90.7	Very high	2 Å²	2	70 Å²	70	1%	0.014	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	159.2	161.3	-48.6	0	0	0	0	110.5	C5 R36 C38 E42 W44	C5-C63 VanDerWaalsContact SG-SG 3.64Å; R36-C63 VanDerWaalsContact CZ-SG 3.53Å; R36-C63 PolarHBondContact NH1-SG 2.78Å; R36-C63 VanDerWaalsContact NH1-SG 3.44Å; R36-C63 VanDerWaalsContact NH2-CB 3.29Å; C38-C63 WeakPolarHBondContact CA-SG 3.33Å; C38-C63 HydrophobicContact CB-CB 3.62Å; C38-C63 WeakPolarHBondContact CB-SG 3.2Å; C38-C63 WeakPolarHBondContact SG-CB 3.32Å; C38-C63 CovalentContact SG-SG 2.04Å; C38-C63 PolarHBondContact SG-SG 2.81Å; E42-C63 HydrophobicContact CB-CB 3.87Å; E42-C63 HydrophobicContact CG-CB 4.23Å; E42-C63 WeakPolarHBondContact OE2-CB 3.36Å; W44-C63 CarbonylContact O-C 3.6Å; W44-C63 WeakPolarHBondContact O-CA 3.26Å
64	S	97.1	Very high	90.7	Very high	15 Å²	15	72.4 Å²	72.4	11%	0.105	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.1	138.1	179.9	-155.5	0	0	0	0	112.4	E42 R43 W44 N66	E42-S64 CarbonylContact C-O 3.54Å; E42-S64 WeakPolarHBondContact CA-O 2.94Å; R43-S64 PolarHBondContact N-O 2.85Å; W44-S64 PolarHBondContact N-O 3.28Å; W44-S64 PolarHBondContact O-N 3.09Å; S64-N66 PolarHBondContact OG-O 2.78Å
65	K	97.1	Very high	90.5	Very high	117 Å²	117	72 Å²	72	51%	0.509	35%	0.35	S	S	.	.	S	Bend	trans	-66.4	-46.2	170.7	-55.1	-172.3	-173.8	-173.9	0	111.3	S41 E42	S41-K65 WeakPolarHBondContact O-CA 3.4Å; S41-K65 WeakPolarHBondContact OG-CE 3.24Å; E42-K65 HydrophobicContact CG-CG 3.84Å
66	N	94.5	Very high	89.6	Confident	146 Å²	146	78.7 Å²	78.7	78%	0.781	37%	0.367	S	S	*	.	S	Bend	trans	-126	116	-177.1	-68.5	-37.2	0	0	0	110	S64	S64-N66 PolarHBondContact OG-O 2.78Å
67	C	94.8	Very high	88.8	Confident	19 Å²	19	81.5 Å²	81.5	13%	0.128	40%	0.403	C	S	.	.			trans	-130.1	116.4	178.6	-163.1	0	0	0	0	110.3	W44 C86	W44-C67 HydrophobicContact CB-CB 3.69Å; W44-C67 HydrophobicContact CD2-CB 4.42Å; W44-C67 HydrophobicContact CG-CB 3.85Å; C67-C86 VanDerWaalsContact CA-SG 3.58Å; C67-C86 HydrophobicContact CB-CB 3.65Å; C67-C86 WeakPolarHBondContact CB-SG 3.33Å; C67-C86 WeakPolarHBondContact SG-CB 3.42Å; C67-C86 CovalentContact SG-SG 2.01Å; C67-C86 PolarHBondContact SG-SG 2.85Å
68	K	92.1	Very high	88	Confident	184 Å²	184	82.6 Å²	82.6	80%	0.8	41%	0.409	S	S	*	.			trans	-113.6	125.7	172.1	-69.3	-175.3	179.4	-177.3	0	108.7	R70	K68-R70 PolarHBondContact O-N 3.46Å
69	R	90.8	Very high	87.7	Confident	153 Å²	153	83.6 Å²	83.6	58%	0.577	42%	0.421	S	S	*	.			trans	-65.5	118.7	174.6	-62.3	-175.2	-177.2	151.8	-1.1	108.4	K84 C86	R69-K84 WeakPolarHBondContact CA-O 3.35Å; R69-C86 HydrophobicContact CG-CB 4.07Å; R69-C86 PolarHBondContact NE-O 2.8Å; R69-C86 PolarHBondContact NH2-O 2.04Å
70	R	91	Very high	87.6	Confident	160 Å²	160	89.4 Å²	89.4	60%	0.604	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-164.1	143.8	-177.7	-172.1	174.4	-177.3	162.1	2.8	110.1	K68 E72 K84	K68-R70 PolarHBondContact O-N 3.46Å; R70-E72 HydrophobicContact CG-CG 4.21Å; R70-K84 PolarHBondContact N-O 2.88Å; R70-K84 PolarHBondContact O-N 3.39Å
71	C	90.8	Very high	87.5	Confident	23 Å²	23	87.4 Å²	87.4	16%	0.155	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	131.6	156.8	-63.6	0	0	0	0	110.4	V81 K82 C83 S104	C71-V81 HydrophobicContact CB-CG1 4.31Å; C71-K82 CarbonylContact C-O 3.59Å; C71-K82 VanDerWaalsContact CA-O 3.24Å; C71-K82 WeakPolarHBondContact CA-O 3.35Å; C71-C83 HydrophobicContact CB-CB 4.18Å; C71-C83 WeakPolarHBondContact CB-SG 2.93Å; C71-C83 WeakPolarHBondContact SG-CA 3.36Å; C71-C83 WeakPolarHBondContact SG-CB 3.32Å; C71-C83 CovalentContact SG-SG 2.03Å; C71-C83 PolarHBondContact SG-SG 3.43Å; C71-S104 VanDerWaalsContact CB-CB 3.48Å; C71-S104 WeakPolarHBondContact CB-OG 3.49Å; C71-S104 WeakPolarHBondContact SG-CB 3.44Å; C71-S104 PolarHBondContact SG-OG 2.79Å
72	E	89.3	Confident	87.4	Confident	52 Å²	52	90.2 Å²	90.2	24%	0.243	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	120.1	175.8	-68.4	163.4	-154.5	0	0	107.6	R70 V81 K82 K84	R70-E72 HydrophobicContact CG-CG 4.21Å; E72-V81 CarbonylContact O-C 3.57Å; E72-V81 WeakPolarHBondContact O-CA 3.1Å; E72-K82 PolarHBondContact N-O 2.98Å; E72-K82 PolarHBondContact O-N 3.02Å; E72-K84 IonicContact OE1-NZ 2.93Å; E72-K84 PolarHBondContact OE1-NZ 3.22Å; E72-K84 IonicContact OE2-NZ 3.94Å
73	K	86.8	Confident	87.3	Confident	130 Å²	130	88 Å²	88	57%	0.565	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.4	131.7	172.1	-60.3	-172.4	176.6	177.5	0	108.5	K80 V81 Y105	K73-K80 CarbonylContact C-O 3.5Å; K73-K80 WeakPolarHBondContact CA-O 3.37Å; K73-V81 HydrophobicContact CG-CG1 4.3Å; K73-V81 HydrophobicContact CG-CG2 4.14Å; K73-Y105 PolarHBondContact NZ-OH 2.04Å
74	K	86.3	Confident	87.1	Confident	146 Å²	146	90.5 Å²	90.5	64%	0.635	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-140.9	159.2	177.5	-65.4	-170.2	179.1	-174.4	0	110.3	K80	K74-K80 PolarHBondContact N-O 2.91Å; K74-K80 WeakPolarHBondContact O-CA 3.07Å; K74-K80 WeakPolarHBondContact O-CB 3.39Å; K74-K80 PolarHBondContact O-N 2.86Å
75	G	75.5	Confident	87	Confident	53 Å²	53	90.9 Å²	90.9	55%	0.546	45%	0.448	S	S	.	.			trans	108.5	141.8	170.5	0	0	0	0	0	113.3	V78	G75-V78 CarbonylContact C-O 3.6Å; G75-V78 WeakPolarHBondContact CA-O 3.44Å
76	Y	66	Low	86.9	Confident	237 Å²	237	85.5 Å²	85.5	93%	0.929	43%	0.425	S	S	*	.	S	Bend	trans	-103.6	120	171.8	-63.3	-87.5	0	0	0	106.8	V78	Y76-V78 PolarHBondContact O-N 2.74Å; Y76-V78 VanDerWaalsContact O-N 3.09Å
77	G	69.4	Low	86.9	Confident	89 Å²	89	79.2 Å²	79.2	92%	0.918	39%	0.393	S	S	*	.	S	Bend	trans	76.1	-18.7	-177.2	0	0	0	0	0	116.3
78	V	69.6	Low	87	Confident	59 Å²	59	83.1 Å²	83.1	36%	0.358	41%	0.412	S	S	.	.	S	Bend	trans	-125.3	120.5	170.3	179.6	0	0	0	0	108.9	N53 G75 Y76 K80	N53-V78 WeakPolarHBondContact OD1-CA 3.49Å; N53-V78 WeakPolarHBondContact OD1-CG1 3.35Å; G75-V78 CarbonylContact C-O 3.6Å; G75-V78 WeakPolarHBondContact CA-O 3.44Å; Y76-V78 PolarHBondContact O-N 2.74Å; Y76-V78 VanDerWaalsContact O-N 3.09Å; V78-K80 HydrophobicContact CG1-CG 4.31Å; V78-K80 PolarHBondContact O-N 3.24Å
79	S	82.6	Confident	87.1	Confident	61 Å²	61	78.4 Å²	78.4	43%	0.427	40%	0.399	S	S	.	.			trans	-82.6	104.7	-179.3	57.9	0	0	0	0	110.5	S52 N53	S52-S79 CarbonylContact C-O 3.55Å; S52-S79 WeakPolarHBondContact CA-O 3.36Å; N53-S79 WeakPolarHBondContact CA-OG 3.48Å; N53-S79 PolarHBondContact N-O 2.93Å; N53-S79 PolarHBondContact OD1-N 3.13Å; N53-S79 PolarHBondContact OD1-OG 2.68Å
80	K	88.4	Confident	87.3	Confident	123 Å²	123	74.9 Å²	74.9	54%	0.535	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	120.6	172.5	-63.4	-177	-178.4	178.7	0	109.3	F51 K73 K74 V78	F51-K80 CarbonylContact O-C 3.47Å; F51-K80 VanDerWaalsContact O-CA 3.3Å; F51-K80 WeakPolarHBondContact O-CA 3.44Å; K73-K80 CarbonylContact C-O 3.5Å; K73-K80 WeakPolarHBondContact CA-O 3.37Å; K74-K80 PolarHBondContact N-O 2.91Å; K74-K80 WeakPolarHBondContact O-CA 3.07Å; K74-K80 WeakPolarHBondContact O-CB 3.39Å; K74-K80 PolarHBondContact O-N 2.86Å; V78-K80 HydrophobicContact CG1-CG 4.31Å; V78-K80 PolarHBondContact O-N 3.24Å
81	V	89.4	Confident	87.4	Confident	15 Å²	15	69.5 Å²	69.5	9%	0.091	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	122.2	179.8	-172.1	0	0	0	0	109.1	H50 F51 C71 E72 K73	H50-V81 CarbonylContact C-O 3.56Å; H50-V81 VanDerWaalsContact CA-O 3.31Å; H50-V81 WeakPolarHBondContact CA-O 3.4Å; F51-V81 HydrophobicContact CB-CB 4.28Å; F51-V81 PolarHBondContact N-O 3.23Å; F51-V81 PolarHBondContact O-N 3.14Å; C71-V81 HydrophobicContact CB-CG1 4.31Å; E72-V81 CarbonylContact O-C 3.57Å; E72-V81 WeakPolarHBondContact O-CA 3.1Å; K73-V81 HydrophobicContact CG-CG1 4.3Å; K73-V81 HydrophobicContact CG-CG2 4.14Å
82	K	91.6	Very high	87.5	Confident	63 Å²	63	69.2 Å²	69.2	27%	0.274	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	111	175.2	169.2	167.3	-171.1	137.9	0	109.3	T48 H50 C71 E72 K84	T48-K82 HydrophobicContact CG2-CD 4.5Å; T48-K82 HydrophobicContact CG2-CG 4.11Å; H50-K82 VanDerWaalsContact CD2-CG 3.42Å; H50-K82 WeakPolarHBondContact CD2-CG 3.31Å; H50-K82 PolarHBondContact CE1-NZ 2.82Å; H50-K82 WeakPolarHBondContact NE2-CD 3.45Å; H50-K82 WeakPolarHBondContact NE2-CE 3.25Å; H50-K82 WeakPolarHBondContact NE2-CG 3.46Å; H50-K82 PolarHBondContact NE2-NZ 3.28Å; C71-K82 CarbonylContact C-O 3.59Å; C71-K82 VanDerWaalsContact CA-O 3.24Å; C71-K82 WeakPolarHBondContact CA-O 3.35Å; E72-K82 PolarHBondContact N-O 2.98Å; E72-K82 PolarHBondContact O-N 3.02Å; K82-K84 VanDerWaalsContact CE-CE 3.47Å
83	C	93.2	Very high	87.7	Confident	0 Å²	0	66.8 Å²	66.8	0%	0	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	135.6	-178.8	-72.7	0	0	0	0	111.4	T48 A49 C71 L100	T48-C83 CarbonylContact C-O 3.58Å; T48-C83 WeakPolarHBondContact CA-O 3.31Å; A49-C83 PolarHBondContact N-O 3.43Å; A49-C83 PolarHBondContact O-N 3.17Å; C71-C83 HydrophobicContact CB-CB 4.18Å; C71-C83 WeakPolarHBondContact CB-SG 2.93Å; C71-C83 WeakPolarHBondContact SG-CA 3.36Å; C71-C83 WeakPolarHBondContact SG-CB 3.32Å; C71-C83 CovalentContact SG-SG 2.03Å; C71-C83 PolarHBondContact SG-SG 3.43Å; C83-L100 HydrophobicContact CB-CB 4.25Å; C83-L100 WeakPolarHBondContact CB-O 3.48Å
84	K	93.7	Very high	87.8	Confident	55 Å²	55	63 Å²	63	24%	0.239	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.2	133.1	178.7	-61.2	165.6	-171.7	156.7	0	109.6	G47 T48 R69 R70 E72 K82	G47-K84 CarbonylContact O-C 3.5Å; G47-K84 WeakPolarHBondContact O-CA 3.21Å; T48-K84 HydrophobicContact CG2-CG 4.21Å; R69-K84 WeakPolarHBondContact CA-O 3.35Å; R70-K84 PolarHBondContact N-O 2.88Å; R70-K84 PolarHBondContact O-N 3.39Å; E72-K84 IonicContact OE1-NZ 2.93Å; E72-K84 PolarHBondContact OE1-NZ 3.22Å; E72-K84 IonicContact OE2-NZ 3.94Å; K82-K84 VanDerWaalsContact CE-CE 3.47Å
85	K	93.9	Very high	87.9	Confident	24 Å²	24	57.7 Å²	57.7	10%	0.104	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	148.8	170.4	-164.7	172.3	176.3	-174.6	0	110.1	K46 G47 W95 L100 Y103	K46-K85 WeakPolarHBondContact CA-O 3Å; G47-K85 PolarHBondContact N-O 2.94Å; G47-K85 PolarHBondContact O-N 2.83Å; K85-W95 HydrophobicContact CB-CD2 4.42Å; K85-W95 HydrophobicContact CB-CE3 3.93Å; K85-W95 HydrophobicContact CB-CH2 4.09Å; K85-W95 HydrophobicContact CB-CZ3 3.74Å; K85-W95 HydrophobicContact CD-CD2 3.62Å; K85-W95 HydrophobicContact CD-CE3 4Å; K85-W95 HydrophobicContact CD-CG 4.01Å; K85-W95 HydrophobicContact CD-CH2 4.23Å; K85-W95 HydrophobicContact CD-CZ2 3.91Å; K85-W95 HydrophobicContact CD-CZ3 4.29Å; K85-W95 HydrophobicContact CG-CD2 4.15Å; K85-W95 HydrophobicContact CG-CE3 4.09Å; K85-W95 HydrophobicContact CG-CH2 3.74Å; K85-W95 HydrophobicContact CG-CZ2 3.85Å; K85-W95 HydrophobicContact CG-CZ3 3.89Å; K85-W95 VanDerWaalsContact NZ-CD1 3.33Å; K85-L100 HydrophobicContact CB-CD2 3.29Å; K85-L100 HydrophobicContact CD-CD2 4.15Å; K85-L100 HydrophobicContact CG-CD2 4.36Å; K85-Y103 HydrophobicContact CD-CD2 4.32Å
86	C	94.9	Very high	88.4	Confident	3 Å²	3	61.7 Å²	61.7	2%	0.02	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135	141.5	-169.5	-48.1	0	0	0	0	110.3	W44 C45 C67 R69	W44-C86 HydrophobicContact CE3-CB 4.19Å; C45-C86 WeakPolarHBondContact O-CA 3.41Å; C67-C86 VanDerWaalsContact CA-SG 3.58Å; C67-C86 HydrophobicContact CB-CB 3.65Å; C67-C86 WeakPolarHBondContact CB-SG 3.33Å; C67-C86 WeakPolarHBondContact SG-CB 3.42Å; C67-C86 CovalentContact SG-SG 2.01Å; C67-C86 PolarHBondContact SG-SG 2.85Å; R69-C86 HydrophobicContact CG-CB 4.07Å; R69-C86 PolarHBondContact NE-O 2.8Å; R69-C86 PolarHBondContact NH2-O 2.04Å
87	C	95.4	Very high	89.2	Confident	14 Å²	14	50.6 Å²	50.6	10%	0.095	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.2	166.5	171.5	56.7	0	0	0	0	108.9	W44 C45 C92 W95	W44-C87 CarbonylContact C-O 3.51Å; W44-C87 WeakPolarHBondContact CA-O 3.37Å; C45-C87 PolarHBondContact N-O 2.86Å; C45-C87 PolarHBondContact O-N 2.82Å; C87-C92 VanDerWaalsContact C-SG 3.52Å; C87-C92 HydrophobicContact CB-CB 3.77Å; C87-C92 WeakPolarHBondContact CB-SG 3.39Å; C87-C92 WeakPolarHBondContact SG-CB 3.37Å; C87-C92 PolarHBondContact SG-O 3.01Å; C87-C92 CovalentContact SG-SG 1.99Å; C87-C92 PolarHBondContact SG-SG 2.75Å; C87-W95 HydrophobicContact CB-CH2 3.75Å; C87-W95 HydrophobicContact CB-CZ2 3.76Å; C87-W95 WeakPolarHBondContact SG-CH2 3.38Å; C87-W95 WeakPolarHBondContact SG-CZ2 3.08Å
88	N	95.7	Very high	89.8	Confident	102 Å²	102	51.4 Å²	51.4	55%	0.545	27%	0.265	S	S	.	.			trans	-131.1	20.2	-168.6	62.8	-14.4	0	0	0	113.2	W44	W44-N88 HydrophobicContact CE3-CB 3.92Å; W44-N88 HydrophobicContact CZ3-CB 3.99Å
89	T	95.5	Very high	90.5	Very high	85 Å²	85	51.9 Å²	51.9	52%	0.521	27%	0.266	S	S	.	.	S	Bend	trans	-114.6	158.9	175.9	54.1	0	0	0	0	110.6	L3 L91 C92	L3-T89 VanDerWaalsContact CD1-C 3.4Å; L3-T89 WeakPolarHBondContact CD1-O 3.01Å; T89-L91 PolarHBondContact O-N 2.76Å; T89-C92 WeakPolarHBondContact O-CB 3.07Å; T89-C92 PolarHBondContact O-N 2.93Å; T89-C92 PolarHBondContact O-SG 2.78Å; T89-C92 WeakPolarHBondContact OG1-CB 2.97Å
90	T	94.7	Very high	90.5	Very high	78 Å²	78	49.2 Å²	49.2	48%	0.479	25%	0.247	S	C	.	.	T	Hydrogen-bonded Turn	trans	-60.2	132.4	-177.1	-68.4	0	0	0	0	111.6	Q4 C92	Q4-T90 HydrophobicContact CB-CG2 3.93Å; Q4-T90 CarbonylContact O-C 3.54Å; Q4-T90 VanDerWaalsContact O-CA 3.31Å; Q4-T90 WeakPolarHBondContact O-CA 2.98Å; T90-C92 PolarHBondContact O-N 2.93Å; T90-C92 VanDerWaalsContact O-N 3.17Å
91	L	92.4	Very high	89.9	Confident	47 Å²	47	45.1 Å²	45.1	25%	0.246	23%	0.23	C	C	.	.	T	Hydrogen-bonded Turn	trans	57.2	25.4	177.3	-58.7	177	0	0	0	114.6	Q4 Y6 N35 T89 N93	Q4-L91 HydrophobicContact CG-CD2 3.98Å; Q4-L91 PolarHBondContact O-N 3.18Å; Y6-L91 HydrophobicContact CD1-CD2 4.19Å; Y6-L91 HydrophobicContact CD2-CB 4.29Å; Y6-L91 HydrophobicContact CD2-CD2 4.36Å; Y6-L91 HydrophobicContact CE1-CD2 3.99Å; Y6-L91 HydrophobicContact CE2-CB 3.66Å; Y6-L91 HydrophobicContact CE2-CD2 4.18Å; Y6-L91 HydrophobicContact CE2-CG 4.4Å; Y6-L91 WeakPolarHBondContact CE2-O 3.42Å; Y6-L91 HydrophobicContact CG-CD2 4.36Å; N35-L91 HydrophobicContact CB-CD2 3.7Å; T89-L91 PolarHBondContact O-N 2.76Å; L91-N93 PolarHBondContact O-N 2.96Å
92	C	93.3	Very high	88.7	Confident	18 Å²	18	48.4 Å²	48.4	12%	0.122	25%	0.254	C	S	.	.			trans	-80.2	-12.6	-172.8	64.7	0	0	0	0	115.1	C45 C87 T89 T90 N94 W95	C45-C92 VanDerWaalsContact SG-SG 3.69Å; C87-C92 VanDerWaalsContact C-SG 3.52Å; C87-C92 HydrophobicContact CB-CB 3.77Å; C87-C92 WeakPolarHBondContact CB-SG 3.39Å; C87-C92 WeakPolarHBondContact SG-CB 3.37Å; C87-C92 PolarHBondContact SG-O 3.01Å; C87-C92 CovalentContact SG-SG 1.99Å; C87-C92 PolarHBondContact SG-SG 2.75Å; T89-C92 WeakPolarHBondContact O-CB 3.07Å; T89-C92 PolarHBondContact O-N 2.93Å; T89-C92 PolarHBondContact O-SG 2.78Å; T89-C92 WeakPolarHBondContact OG1-CB 2.97Å; T90-C92 PolarHBondContact O-N 2.93Å; T90-C92 VanDerWaalsContact O-N 3.17Å; C92-N94 PolarHBondContact O-N 3.05Å; C92-N94 VanDerWaalsContact O-N 3.15Å; C92-N94 PolarHBondContact O-OD1 2.9Å; C92-W95 WeakPolarHBondContact O-CZ2 3.26Å
93	N	93.3	Very high	87	Confident	0 Å²	0	52.7 Å²	52.7	0%	0	27%	0.269	C	S	.	.			trans	-84.9	33	-178.2	61.8	-24.6	0	0	0	113.5	Y6 C45 K46 R61 L91 W95	Y6-N93 WeakPolarHBondContact CB-OD1 3.21Å; Y6-N93 PolarHBondContact N-OD1 2.82Å; Y6-N93 PolarHBondContact O-ND2 2.7Å; C45-N93 HydrophobicContact CB-CB 3.69Å; K46-N93 PolarHBondContact O-ND2 3.45Å; R61-N93 WeakPolarHBondContact CD-O 3.18Å; R61-N93 PolarHBondContact NE-O 2.67Å; L91-N93 PolarHBondContact O-N 2.96Å; N93-W95 HydrophobicContact CB-CE3 4.07Å; N93-W95 HydrophobicContact CB-CH2 4.24Å; N93-W95 HydrophobicContact CB-CZ3 3.66Å; N93-W95 PolarHBondContact O-N 1.99Å
94	N	90	Very high	85	Confident	50 Å²	50	55.1 Å²	55.1	27%	0.267	29%	0.286	S	S	.	.			trans	-81.5	10.9	-177.8	65.8	-7.7	0	0	0	115	Y6 V26 C92	Y6-N94 HydrophobicContact CD2-CB 4.05Å; Y6-N94 HydrophobicContact CE2-CB 3.75Å; V26-N94 HydrophobicContact CB-CB 4.06Å; V26-N94 HydrophobicContact CG2-CB 3.91Å; C92-N94 PolarHBondContact O-N 3.05Å; C92-N94 VanDerWaalsContact O-N 3.15Å; C92-N94 PolarHBondContact O-OD1 2.9Å
95	W	88.3	Confident	82.7	Confident	35 Å²	35	58.7 Å²	58.7	13%	0.133	30%	0.299	C	S	.	.			trans	-59	146.4	-177.7	-51.9	-60.8	0	0	0	112.5	R61 K85 C87 C92 N93 D99 L100	R61-W95 PolarHBondContact NH2-O 3.36Å; K85-W95 HydrophobicContact CB-CD2 4.42Å; K85-W95 HydrophobicContact CB-CE3 3.93Å; K85-W95 HydrophobicContact CB-CH2 4.09Å; K85-W95 HydrophobicContact CB-CZ3 3.74Å; K85-W95 HydrophobicContact CD-CD2 3.62Å; K85-W95 HydrophobicContact CD-CE3 4Å; K85-W95 HydrophobicContact CD-CG 4.01Å; K85-W95 HydrophobicContact CD-CH2 4.23Å; K85-W95 HydrophobicContact CD-CZ2 3.91Å; K85-W95 HydrophobicContact CD-CZ3 4.29Å; K85-W95 HydrophobicContact CG-CD2 4.15Å; K85-W95 HydrophobicContact CG-CE3 4.09Å; K85-W95 HydrophobicContact CG-CH2 3.74Å; K85-W95 HydrophobicContact CG-CZ2 3.85Å; K85-W95 HydrophobicContact CG-CZ3 3.89Å; K85-W95 VanDerWaalsContact NZ-CD1 3.33Å; C87-W95 HydrophobicContact CB-CH2 3.75Å; C87-W95 HydrophobicContact CB-CZ2 3.76Å; C87-W95 WeakPolarHBondContact SG-CH2 3.38Å; C87-W95 WeakPolarHBondContact SG-CZ2 3.08Å; C92-W95 WeakPolarHBondContact O-CZ2 3.26Å; N93-W95 HydrophobicContact CB-CE3 4.07Å; N93-W95 HydrophobicContact CB-CH2 4.24Å; N93-W95 HydrophobicContact CB-CZ3 3.66Å; N93-W95 PolarHBondContact O-N 1.99Å; W95-D99 HydrophobicContact CB-CB 4.09Å; W95-L100 HydrophobicContact CB-CD2 4.38Å; W95-L100 HydrophobicContact CD2-CD2 4.48Å; W95-L100 HydrophobicContact CE3-CD2 3.92Å
96	R	84.9	Confident	80.5	Confident	138 Å²	138	66.8 Å²	66.8	52%	0.521	33%	0.334	S	S	.	.			trans	-69.3	155.5	166.8	-65.8	-176.8	173.1	179	-1.1	109.7	A25 D98 D99 L100	A25-R96 HydrophobicContact CB-CG 4.29Å; R96-D98 PolarHBondContact O-N 2.77Å; R96-D99 WeakPolarHBondContact CB-OD2 3Å; R96-D99 PolarHBondContact N-OD2 2.92Å; R96-D99 WeakPolarHBondContact O-CB 3.49Å; R96-D99 PolarHBondContact O-N 3.04Å; R96-D99 VanDerWaalsContact O-N 3.12Å; R96-L100 PolarHBondContact O-N 3.25Å
97	P	83.8	Confident	78.1	Confident	3 Å²	3	69 Å²	69	2%	0.019	35%	0.348	C	S	.	.	H	α-helix	trans	-55.4	-35.6	176	-27.6	35.9	0	0	0	113.3	M24 A49 L56 V59 D99 L100	M24-P97 HydrophobicContact CE-CG 4.1Å; M24-P97 WeakPolarHBondContact O-CD 3.36Å; M24-P97 HydrophobicContact SD-CG 3.74Å; A49-P97 HydrophobicContact CB-CB 4.29Å; L56-P97 HydrophobicContact CD1-CB 3.84Å; L56-P97 HydrophobicContact CD2-CB 3.63Å; L56-P97 HydrophobicContact CD2-CG 3.76Å; L56-P97 HydrophobicContact CG-CB 4.39Å; V59-P97 HydrophobicContact CG1-CG 4.42Å; V59-P97 HydrophobicContact CG2-CB 3.95Å; V59-P97 HydrophobicContact CG2-CG 3.52Å; P97-D99 VanDerWaalsContact C-N 3.34Å; P97-D99 PolarHBondContact O-N 2.01Å; P97-L100 VanDerWaalsContact O-CB 3.32Å; P97-L100 WeakPolarHBondContact O-CB 3.41Å; P97-L100 PolarHBondContact O-N 2.01Å; P97-L100 VanDerWaalsContact O-N 3.16Å
98	D	81.9	Confident	75.4	Confident	107 Å²	107	72 Å²	72	57%	0.572	37%	0.368	S	S	*	.	H	α-helix	trans	-66.4	-36.2	178.7	-52.9	-55.2	0	0	0	112.3	R96 L100 I101 S102	R96-D98 PolarHBondContact O-N 2.77Å; D98-L100 PolarHBondContact O-N 3.23Å; D98-I101 PolarHBondContact O-N 3.06Å; D98-I101 VanDerWaalsContact O-N 3.09Å; D98-S102 PolarHBondContact O-N 2.84Å; D98-S102 VanDerWaalsContact O-N 3.12Å
99	D	84	Confident	73.1	Confident	69 Å²	69	74.5 Å²	74.5	37%	0.369	38%	0.376	S	S	.	.	H	α-helix	trans	-66.5	-20.1	176.2	-57.8	-35	0	0	0	112.6	W95 R96 P97	W95-D99 HydrophobicContact CB-CB 4.09Å; R96-D99 WeakPolarHBondContact CB-OD2 3Å; R96-D99 PolarHBondContact N-OD2 2.92Å; R96-D99 WeakPolarHBondContact O-CB 3.49Å; R96-D99 PolarHBondContact O-N 3.04Å; R96-D99 VanDerWaalsContact O-N 3.12Å; P97-D99 VanDerWaalsContact C-N 3.34Å; P97-D99 PolarHBondContact O-N 2.01Å
100	L	81.6	Confident	70.5	Confident	5 Å²	5	74.1 Å²	74.1	3%	0.026	38%	0.377	C	S	.	.	H	α-helix	trans	-75.5	-30.4	175.2	-64	172.4	0	0	0	111.5	A49 C83 K85 W95 R96 P97 D98	A49-L100 HydrophobicContact CB-CB 4.1Å; A49-L100 HydrophobicContact CB-CD1 3.53Å; A49-L100 HydrophobicContact CB-CG 4.42Å; C83-L100 HydrophobicContact CB-CB 4.25Å; C83-L100 WeakPolarHBondContact CB-O 3.48Å; K85-L100 HydrophobicContact CB-CD2 3.29Å; K85-L100 HydrophobicContact CD-CD2 4.15Å; K85-L100 HydrophobicContact CG-CD2 4.36Å; W95-L100 HydrophobicContact CB-CD2 4.38Å; W95-L100 HydrophobicContact CD2-CD2 4.48Å; W95-L100 HydrophobicContact CE3-CD2 3.92Å; R96-L100 PolarHBondContact O-N 3.25Å; P97-L100 VanDerWaalsContact O-CB 3.32Å; P97-L100 WeakPolarHBondContact O-CB 3.41Å; P97-L100 PolarHBondContact O-N 2.01Å; P97-L100 VanDerWaalsContact O-N 3.16Å; D98-L100 PolarHBondContact O-N 3.23Å
101	I	77.4	Confident	68.3	Low	37 Å²	37	75.1 Å²	75.1	19%	0.19	38%	0.378	C	S	.	.	H	α-helix	trans	-81.9	-38.7	175.7	-59.3	166.1	0	0	0	111.9	F51 D98 Y103 S104 Y105	F51-I101 HydrophobicContact CD1-CD1 3.69Å; F51-I101 HydrophobicContact CD2-CD1 3.65Å; F51-I101 HydrophobicContact CD2-CG1 3.8Å; F51-I101 HydrophobicContact CE1-CD1 3.24Å; F51-I101 HydrophobicContact CE1-CG1 4.18Å; F51-I101 HydrophobicContact CE2-CD1 3.22Å; F51-I101 HydrophobicContact CE2-CG1 3.19Å; F51-I101 HydrophobicContact CG-CD1 3.89Å; F51-I101 HydrophobicContact CZ-CD1 3.01Å; F51-I101 HydrophobicContact CZ-CG1 3.44Å; F51-I101 VanDerWaalsContact CZ-CG1 3.44Å; D98-I101 PolarHBondContact O-N 3.06Å; D98-I101 VanDerWaalsContact O-N 3.09Å; I101-Y103 PolarHBondContact O-N 2.78Å; I101-S104 PolarHBondContact O-N 2.75Å; I101-Y105 HydrophobicContact CG2-CD2 3.43Å; I101-Y105 VanDerWaalsContact CG2-CD2 3.43Å; I101-Y105 HydrophobicContact CG2-CE2 3.62Å
102	S	64.4	Low	65.9	Low	84 Å²	84	79.4 Å²	79.4	59%	0.587	39%	0.391	S	S	*	.	H	α-helix	trans	-46.5	-35	-175.7	162.2	0	0	0	0	113	D98 S104	D98-S102 PolarHBondContact O-N 2.84Å; D98-S102 VanDerWaalsContact O-N 3.12Å; S102-S104 VanDerWaalsContact C-N 3.34Å; S102-S104 PolarHBondContact O-N 3.23Å
103	Y	54.6	Low	63.5	Low	153 Å²	153	85.8 Å²	85.8	60%	0.6	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.4	-16.5	179.2	-96.9	-87	0	0	0	116.4	K85 I101	K85-Y103 HydrophobicContact CD-CD2 4.32Å; I101-Y103 PolarHBondContact O-N 2.78Å
104	S	51.7	Low	61.2	Low	50 Å²	50	92.4 Å²	92.4	35%	0.35	45%	0.453	S	S	.	.	T	Hydrogen-bonded Turn	trans	-114.2	-0.7	-174.9	-70.6	0	0	0	0	115.1	C71 I101 S102	C71-S104 VanDerWaalsContact CB-CB 3.48Å; C71-S104 WeakPolarHBondContact CB-OG 3.49Å; C71-S104 WeakPolarHBondContact SG-CB 3.44Å; C71-S104 PolarHBondContact SG-OG 2.79Å; I101-S104 PolarHBondContact O-N 2.75Å; S102-S104 VanDerWaalsContact C-N 3.34Å; S102-S104 PolarHBondContact O-N 3.23Å
105	Y	45.9	Very low	58.9	Low	131 Å²	131	93 Å²	93	51%	0.514	46%	0.456	S	S	.	.			trans	-100.8	73.7	167.8	-83.8	-99	0	0	0	109.4	K73 I101 P107	K73-Y105 PolarHBondContact NZ-OH 2.04Å; I101-Y105 HydrophobicContact CG2-CD2 3.43Å; I101-Y105 VanDerWaalsContact CG2-CD2 3.43Å; I101-Y105 HydrophobicContact CG2-CE2 3.62Å; Y105-P107 VanDerWaalsContact O-CD 3.27Å; Y105-P107 WeakPolarHBondContact O-CD 3.45Å
106	K	47.1	Very low	56.9	Low	194 Å²	194	96.2 Å²	96.2	84%	0.843	48%	0.481	S	S	*	.			trans	-85.3	103	143.1	-75.5	-166	177.4	-169.7	0	105.4
107	P	43.8	Very low	54.9	Low	49 Å²	49	100.5 Å²	100.5	32%	0.318	50%	0.498	S	S	.	.			trans	-51.1	140.2	163.6	23.5	-33.6	0	0	0	107.8	Y105 E109 I111 W112	Y105-P107 VanDerWaalsContact O-CD 3.27Å; Y105-P107 WeakPolarHBondContact O-CD 3.45Å; P107-E109 PolarHBondContact O-N 3.44Å; P107-I111 HydrophobicContact CB-CD1 4.27Å; P107-W112 HydrophobicContact CG-CZ2 3.99Å
108	P	40.4	Very low	53.2	Low	78 Å²	78	104.6 Å²	104.6	51%	0.506	52%	0.519	S	S	.	.			trans	-53	131.8	172.2	19.8	-28.2	0	0	0	108	S110 I111	P108-S110 PolarHBondContact O-N 2.86Å; P108-I111 HydrophobicContact CG-CD1 3.75Å; P108-I111 HydrophobicContact CG-CG1 4.05Å; P108-I111 PolarHBondContact O-N 3.42Å
109	E	45.9	Very low	50.9	Low	154 Å²	154	103.7 Å²	103.7	72%	0.72	52%	0.517	S	S	*	.	G	3₁₀ helix	trans	-51.6	-24.8	-175.9	-83.1	173.7	154.7	0	0	112.1	P107 I111 W112 F113	P107-E109 PolarHBondContact O-N 3.44Å; E109-I111 PolarHBondContact O-N 3.48Å; E109-I111 VanDerWaalsContact O-N 3.13Å; E109-W112 PolarHBondContact O-N 3.17Å; E109-W112 VanDerWaalsContact O-N 3.14Å; E109-F113 HydrophobicContact CB-CE2 4.24Å; E109-F113 WeakPolarHBondContact O-CD2 3.19Å
110	S	42.4	Very low	48.6	Very low	76 Å²	76	106.1 Å²	106.1	53%	0.531	54%	0.54	S	S	.	.	G	3₁₀ helix	trans	-62.4	-12.5	174.5	58.1	0	0	0	0	116.4	P108	P108-S110 PolarHBondContact O-N 2.86Å
111	I	48	Very low	46.4	Very low	99 Å²	99	109.4 Å²	109.4	51%	0.508	58%	0.575	S	S	.	*	G	3₁₀ helix	trans	-81.2	-22.9	175	-61.9	175.5	0	0	0	111.6	P107 P108 E109	P107-I111 HydrophobicContact CB-CD1 4.27Å; P108-I111 HydrophobicContact CG-CD1 3.75Å; P108-I111 HydrophobicContact CG-CG1 4.05Å; P108-I111 PolarHBondContact O-N 3.42Å; E109-I111 PolarHBondContact O-N 3.48Å; E109-I111 VanDerWaalsContact O-N 3.13Å
112	W	41	Very low	44.3	Very low	137 Å²	137	113.8 Å²	113.8	52%	0.519	60%	0.604	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.2	-15.7	-179.4	-58	98.3	0	0	0	113.6	P107 E109 L118	P107-W112 HydrophobicContact CG-CZ2 3.99Å; E109-W112 PolarHBondContact O-N 3.17Å; E109-W112 VanDerWaalsContact O-N 3.14Å; W112-L118 HydrophobicContact CE3-CD1 3.98Å; W112-L118 HydrophobicContact CZ3-CD1 4.24Å; W112-L118 HydrophobicContact CZ3-CD2 4.32Å
113	F	44.4	Very low	43.1	Very low	153 Å²	153	115.6 Å²	115.6	67%	0.671	61%	0.611	S	S	*	*	S	Bend	trans	-101.2	-4.8	-174.4	-67.3	-68.5	0	0	0	115.4	E109	E109-F113 HydrophobicContact CB-CE2 4.24Å; E109-F113 WeakPolarHBondContact O-CD2 3.19Å
114	N	44.4	Very low	41.9	Very low	138 Å²	138	113.9 Å²	113.9	74%	0.738	62%	0.617	S	S	*	*	S	Bend	trans	-120.7	15.7	-176.6	-74	-34.2	0	0	0	114.3
115	N	40.6	Very low	41.1	Very low	63 Å²	63	118.7 Å²	118.7	34%	0.337	64%	0.638	S	S	.	*			trans	-112.2	108.7	176.4	-154.1	-2.2	0	0	0	109.5	W117 L118	N115-W117 PolarHBondContact O-N 3.31Å; N115-W117 VanDerWaalsContact OD1-CD1 3.3Å; N115-L118 HydrophobicContact CB-CB 4.15Å; N115-L118 HydrophobicContact CB-CD1 3.83Å; N115-L118 HydrophobicContact CB-CG 4.07Å; N115-L118 PolarHBondContact O-N 3.41Å
116	P	46.6	Very low	40.4	Very low	103 Å²	103	121.7 Å²	121.7	67%	0.669	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.2	-13	174.9	-22	32.7	0	0	0	113.4
117	W	44.1	Very low	39.8	Very low	228 Å²	228	115.6 Å²	115.6	86%	0.864	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	-3	177.8	-56.1	91.9	0	0	0	114.2	N115	N115-W117 PolarHBondContact O-N 3.31Å; N115-W117 VanDerWaalsContact OD1-CD1 3.3Å
118	L	46.7	Very low	39.3	Very low	88 Å²	88	122 Å²	122	46%	0.461	67%	0.674	S	S	.	*	T	Hydrogen-bonded Turn	trans	-116.1	-1.7	178	-69.8	170.2	0	0	0	113.1	W112 N115 S120	W112-L118 HydrophobicContact CE3-CD1 3.98Å; W112-L118 HydrophobicContact CZ3-CD1 4.24Å; W112-L118 HydrophobicContact CZ3-CD2 4.32Å; N115-L118 HydrophobicContact CB-CB 4.15Å; N115-L118 HydrophobicContact CB-CD1 3.83Å; N115-L118 HydrophobicContact CB-CG 4.07Å; N115-L118 PolarHBondContact O-N 3.41Å; L118-S120 PolarHBondContact O-N 3.16Å
119	T	34.5	Very low	39.7	Very low	88 Å²	88	126 Å²	126	54%	0.54	69%	0.689	S	S	.	*	S	Bend	trans	-100.9	68.9	179.6	56.4	0	0	0	0	111.4
120	S	35.8	Very low	39.4	Very low	120 Å²	120	127.5 Å²	127.5	84%	0.839	69%	0.694	S	S	*	*			trans	169.6	93.4	157.5	35.6	0	0	0	0	108.8	L118	L118-S120 PolarHBondContact O-N 3.16Å
121	G	33.9	Very low	39.5	Very low	75 Å²	75	127.6 Å²	127.6	77%	0.773	70%	0.699	S	S	*	*			trans	-169.5	41.2	-179.8	0	0	0	0	0	112.6
122	T	33.7	Very low	39.2	Very low	129 Å²	129	132.3 Å²	132.3	79%	0.791	72%	0.716	S	S	*	*			trans	-64.1	141.4	152.5	31.6	0	0	0	0	107.1
123	T	39.1	Very low	39.2	Very low	121 Å²	121	134.5 Å²	134.5	74%	0.742	73%	0.729	S	S	*	*	S	Bend	trans	92.1	109.4	165	-34.4	0	0	0	0	115.5
124	T	30.6	Very low	39.6	Very low	118 Å²	118	136.7 Å²	136.7	72%	0.724	76%	0.761	S	S	*	*			trans	37.6	145.3	132.4	-16.9	0	0	0	0	121.5
125	L	34.9	Very low	39.4	Very low	151 Å²	151	136.7 Å²	136.7	79%	0.791	76%	0.762	S	S	*	*			trans	98.6	121.8	159.8	-90.4	83.8	0	0	0	118.8
126	H	30.9	Very low	39.3	Very low	193 Å²	193	140.5 Å²	140.5	89%	0.894	79%	0.785	S	S	*	*			trans	14.3	114.6	147.4	-74.8	176.4	0	0	0	118.1
127	G	34.2	Very low	38.9	Very low	66 Å²	66	142.6 Å²	142.6	68%	0.68	79%	0.791	S	S	*	*			trans	-171	106.1	167.1	0	0	0	0	0	112.6	I129	G127-I129 PolarHBondContact O-N 2.81Å
128	H	33.7	Very low	38.6	Very low	184 Å²	184	137.6 Å²	137.6	85%	0.852	79%	0.787	S	S	*	*			trans	-50.3	114.9	167.7	-83.6	-103.3	0	0	0	111.6	K130	H128-K130 PolarHBondContact O-N 2.99Å
129	I	48.4	Very low	38.1	Very low	163 Å²	163	140.7 Å²	140.7	84%	0.836	81%	0.807	S	S	*	*			trans	-92.6	95.9	161	-61.6	175.2	0	0	0	107.5	G127 A131	G127-I129 PolarHBondContact O-N 2.81Å; I129-A131 PolarHBondContact O-N 2.85Å
130	K	39.5	Very low	38.3	Very low	185 Å²	185	144.2 Å²	144.2	80%	0.804	83%	0.825	S	S	*	*			trans	-71.9	107.7	157.9	-77.3	-177.1	176.2	179.5	0	107.4	H128 K132	H128-K130 PolarHBondContact O-N 2.99Å; K130-K132 PolarHBondContact O-N 2.83Å
131	A	43.8	Very low	38.5	Very low	78 Å²	78	145.9 Å²	145.9	65%	0.645	82%	0.824	S	S	*	*			trans	-75.1	103.4	159.4	0	0	0	0	0	107.6	I129 F133	I129-A131 PolarHBondContact O-N 2.85Å; A131-F133 HydrophobicContact CB-CD2 4.43Å; A131-F133 HydrophobicContact CB-CE2 4.32Å
132	K	41.7	Very low	38.8	Very low	197 Å²	197	151.4 Å²	151.4	86%	0.857	83%	0.828	S	S	*	*			trans	-84.4	110.1	162	-123.3	-176.1	178.9	-168.3	0	106.5	K130	K130-K132 PolarHBondContact O-N 2.83Å
133	F	41.4	Very low	39.3	Very low	184 Å²	184	153.3 Å²	153.3	81%	0.807	83%	0.831	S	S	*	*			trans	-87.9	148.5	155.2	-78.2	-94	0	0	0	107	A131	A131-F133 HydrophobicContact CB-CD2 4.43Å; A131-F133 HydrophobicContact CB-CE2 4.32Å
134	C	53	Low	39.3	Very low	199 Å²	199	156.2 Å²	156.2	100%	1.345	84%	0.839	S	S	*	*			trans	87.4	0	-162.5	-57.7	0	0	0	0	113.9

Retrieved 134 of 134 residues in 77.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).