A0A077ZD00_TRITR Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A077ZD00, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 96 aa.

						>A0A077ZD00_TRITR|A0A077ZD00
MGSAVPLDPNNMQLVAELELEMMTDLYRRMTTSCQKKCIPGHYKEPDLSKGEAVCIDRCVAKYLDVHEKLGKKLTQMSSQDDQVMQKLQQQMQGQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.4	Very low	60.8	Low	236 Å²	236	106.3 Å²	106.3	100%	1.163	66%	0.664	S	S	*	*				0	92.3	0	-71.2	174.8	153.4	0	0	107	S3	M1-S3 PolarHBondContact O-N 3.01Å; M1-S3 VanDerWaalsContact O-N 3.17Å
2	G	43.8	Very low	62.9	Low	82 Å²	82	107.3 Å²	107.3	85%	0.845	66%	0.658	S	S	*	*			trans	-76.6	95.9	168.6	0	0	0	0	0	106.3	A4	G2-A4 PolarHBondContact O-N 3Å
3	S	49.4	Very low	64.9	Low	100 Å²	100	108.6 Å²	108.6	70%	0.699	65%	0.652	S	S	*	*			trans	-64.8	92.3	170.3	-45.7	0	0	0	0	106	M1 V5	M1-S3 PolarHBondContact O-N 3.01Å; M1-S3 VanDerWaalsContact O-N 3.17Å; S3-V5 PolarHBondContact O-N 2.74Å
4	A	56.6	Low	66.8	Low	90 Å²	90	107.4 Å²	107.4	74%	0.744	64%	0.639	S	S	*	*			trans	-60.4	91.4	154.5	0	0	0	0	0	104.2	G2 P6	G2-A4 PolarHBondContact O-N 3Å; A4-P6 WeakPolarHBondContact O-CD 3.47Å; A4-P6 VanDerWaalsContact O-N 3.08Å
5	V	58.9	Low	68.3	Low	102 Å²	102	103.6 Å²	103.6	62%	0.618	62%	0.617	S	S	*	*			trans	-54.8	118.4	167.4	177.4	0	0	0	0	103.7	S3 L7	S3-V5 PolarHBondContact O-N 2.74Å; V5-L7 HydrophobicContact CG1-CD2 4.13Å; V5-L7 PolarHBondContact O-N 3.18Å
6	P	53	Low	69.8	Low	125 Å²	125	99.8 Å²	99.8	81%	0.812	60%	0.601	S	S	*	*			trans	-65.2	92.6	172.6	-13	28.2	0	0	0	105.4	A4 D8	A4-P6 WeakPolarHBondContact O-CD 3.47Å; A4-P6 VanDerWaalsContact O-N 3.08Å; P6-D8 PolarHBondContact O-N 3.21Å
7	L	60.2	Low	71.1	Confident	67 Å²	67	100.6 Å²	100.6	35%	0.351	60%	0.596	S	S	.	*			trans	-68.6	115.8	171.1	-66.6	171.2	0	0	0	104.6	V5 N11 V15	V5-L7 HydrophobicContact CG1-CD2 4.13Å; V5-L7 PolarHBondContact O-N 3.18Å; L7-N11 HydrophobicContact CB-CB 3.92Å; L7-N11 HydrophobicContact CD2-CB 4.04Å; L7-V15 HydrophobicContact CD1-CB 4.31Å; L7-V15 HydrophobicContact CD1-CG1 4.43Å; L7-V15 HydrophobicContact CD1-CG2 3.9Å; L7-V15 HydrophobicContact CD2-CG2 4.45Å
8	D	74	Confident	72.4	Confident	83 Å²	83	99.6 Å²	99.6	44%	0.444	59%	0.587	S	S	.	*			trans	-40.7	142.1	164.7	-173.4	-66.5	0	0	0	108.9	P6 N10 N11 M12	P6-D8 PolarHBondContact O-N 3.21Å; D8-N10 CarbonylContact O-C 3.59Å; D8-N10 PolarHBondContact O-N 2.9Å; D8-N10 WeakPolarHBondContact OD1-CB 3.16Å; D8-N10 PolarHBondContact OD1-N 2.92Å; D8-N11 HydrophobicContact CB-CB 4.2Å; D8-N11 CarbonylContact O-C 3.51Å; D8-N11 VanDerWaalsContact O-CA 3.29Å; D8-N11 WeakPolarHBondContact O-CA 3.23Å; D8-N11 VanDerWaalsContact O-CB 3.29Å; D8-N11 WeakPolarHBondContact O-CB 3.42Å; D8-N11 PolarHBondContact O-N 2.73Å; D8-M12 PolarHBondContact O-N 3.42Å
9	P	73.5	Confident	73.5	Confident	96 Å²	96	100.6 Å²	100.6	62%	0.623	59%	0.585	S	S	*	*	H	α-helix	trans	-46.7	-36.5	178.9	-28.4	33.5	0	0	0	113.7	M12 Q13	P9-M12 PolarHBondContact O-N 3.28Å; P9-Q13 PolarHBondContact O-N 3.39Å
10	N	78.8	Confident	74.6	Confident	111 Å²	111	101.4 Å²	101.4	59%	0.594	59%	0.587	S	S	*	*	H	α-helix	trans	-66.6	-38.9	174.2	-68.1	-35.5	0	0	0	112.4	D8 M12 L14	D8-N10 CarbonylContact O-C 3.59Å; D8-N10 PolarHBondContact O-N 2.9Å; D8-N10 WeakPolarHBondContact OD1-CB 3.16Å; D8-N10 PolarHBondContact OD1-N 2.92Å; N10-M12 VanDerWaalsContact C-N 3.3Å; N10-L14 PolarHBondContact O-N 3.5Å; N10-L14 VanDerWaalsContact O-N 3.16Å
11	N	83.4	Confident	75.6	Confident	77 Å²	77	102.9 Å²	102.9	41%	0.412	59%	0.588	S	S	.	*	H	α-helix	trans	-67.9	-32.3	174.7	-63	-7.9	0	0	0	111.4	L7 D8 L14 V15	L7-N11 HydrophobicContact CB-CB 3.92Å; L7-N11 HydrophobicContact CD2-CB 4.04Å; D8-N11 HydrophobicContact CB-CB 4.2Å; D8-N11 CarbonylContact O-C 3.51Å; D8-N11 VanDerWaalsContact O-CA 3.29Å; D8-N11 WeakPolarHBondContact O-CA 3.23Å; D8-N11 VanDerWaalsContact O-CB 3.29Å; D8-N11 WeakPolarHBondContact O-CB 3.42Å; D8-N11 PolarHBondContact O-N 2.73Å; N11-L14 PolarHBondContact O-N 3.16Å; N11-V15 WeakPolarHBondContact O-CB 3.29Å; N11-V15 VanDerWaalsContact O-CG2 3.23Å; N11-V15 WeakPolarHBondContact O-CG2 3.29Å; N11-V15 PolarHBondContact O-N 2.92Å
12	M	85.5	Confident	78.4	Confident	119 Å²	119	98.1 Å²	98.1	59%	0.586	57%	0.565	S	S	*	*	H	α-helix	trans	-68.2	-41.8	177.6	-170.1	178.3	-65.4	0	0	111.8	D8 P9 N10 V15 A16	D8-M12 PolarHBondContact O-N 3.42Å; P9-M12 PolarHBondContact O-N 3.28Å; N10-M12 VanDerWaalsContact C-N 3.3Å; M12-V15 PolarHBondContact O-N 3.06Å; M12-A16 WeakPolarHBondContact O-CB 3.4Å; M12-A16 PolarHBondContact O-N 3.17Å
13	Q	89.6	Confident	80.8	Confident	124 Å²	124	100.6 Å²	100.6	58%	0.579	56%	0.556	S	S	*	*	H	α-helix	trans	-61.9	-46.6	173.9	-67.8	-175.7	-76	0	0	111.3	P9 V15 A16 E17	P9-Q13 PolarHBondContact O-N 3.39Å; Q13-V15 VanDerWaalsContact C-N 3.35Å; Q13-V15 PolarHBondContact O-N 3.47Å; Q13-A16 PolarHBondContact O-N 2.81Å; Q13-E17 WeakPolarHBondContact O-CG 3.42Å; Q13-E17 PolarHBondContact O-N 3.09Å
14	L	90.5	Very high	83.1	Confident	92 Å²	92	100.3 Å²	100.3	48%	0.482	55%	0.55	S	S	.	*	H	α-helix	trans	-60.1	-43.6	177.3	178.7	61.4	0	0	0	112.1	N10 N11 E17 L18	N10-L14 PolarHBondContact O-N 3.5Å; N10-L14 VanDerWaalsContact O-N 3.16Å; N11-L14 PolarHBondContact O-N 3.16Å; L14-E17 PolarHBondContact O-N 3.42Å; L14-L18 HydrophobicContact CD1-CD1 4.29Å; L14-L18 HydrophobicContact CD1-CG 4.38Å; L14-L18 HydrophobicContact CG-CD1 4.09Å; L14-L18 WeakPolarHBondContact O-CB 3.35Å; L14-L18 VanDerWaalsContact O-CG 3.27Å; L14-L18 WeakPolarHBondContact O-CG 3.23Å; L14-L18 PolarHBondContact O-N 3.46Å
15	V	90.3	Very high	85	Confident	50 Å²	50	98.5 Å²	98.5	30%	0.303	53%	0.528	S	S	.	.	H	α-helix	trans	-64	-41.7	177.3	169	0	0	0	0	111.1	L7 N11 M12 Q13 E17 L18 E19	L7-V15 HydrophobicContact CD1-CB 4.31Å; L7-V15 HydrophobicContact CD1-CG1 4.43Å; L7-V15 HydrophobicContact CD1-CG2 3.9Å; L7-V15 HydrophobicContact CD2-CG2 4.45Å; N11-V15 WeakPolarHBondContact O-CB 3.29Å; N11-V15 VanDerWaalsContact O-CG2 3.23Å; N11-V15 WeakPolarHBondContact O-CG2 3.29Å; N11-V15 PolarHBondContact O-N 2.92Å; M12-V15 PolarHBondContact O-N 3.06Å; Q13-V15 VanDerWaalsContact C-N 3.35Å; Q13-V15 PolarHBondContact O-N 3.47Å; V15-E17 PolarHBondContact O-N 3.32Å; V15-L18 PolarHBondContact O-N 3.5Å; V15-E19 HydrophobicContact CG1-CG 4.43Å; V15-E19 WeakPolarHBondContact O-CG 3.31Å; V15-E19 PolarHBondContact O-N 2.84Å
16	A	91.4	Very high	86.8	Confident	43 Å²	43	95.5 Å²	95.5	36%	0.355	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-41.1	176.7	0	0	0	0	0	112.4	M12 Q13 E19 L20	M12-A16 WeakPolarHBondContact O-CB 3.4Å; M12-A16 PolarHBondContact O-N 3.17Å; Q13-A16 PolarHBondContact O-N 2.81Å; A16-E19 PolarHBondContact O-N 2.96Å; A16-L20 WeakPolarHBondContact O-CG 3.42Å; A16-L20 PolarHBondContact O-N 3.22Å
17	E	92.6	Very high	89	Confident	113 Å²	113	97 Å²	97	53%	0.528	50%	0.499	S	S	.	.	H	α-helix	trans	-61.8	-46.1	174.5	-73.4	174.6	-178.9	0	0	111.3	Q13 L14 V15 E19 L20 E21	Q13-E17 WeakPolarHBondContact O-CG 3.42Å; Q13-E17 PolarHBondContact O-N 3.09Å; L14-E17 PolarHBondContact O-N 3.42Å; V15-E17 PolarHBondContact O-N 3.32Å; E17-E19 PolarHBondContact O-N 2.97Å; E17-L20 PolarHBondContact O-N 2.92Å; E17-E21 WeakPolarHBondContact O-CG 3.43Å; E17-E21 PolarHBondContact O-N 3.23Å
18	L	93.8	Very high	90.8	Very high	82 Å²	82	101 Å²	101	43%	0.429	51%	0.509	S	S	.	.	H	α-helix	trans	-61	-42.9	176.2	-72.5	168.6	0	0	0	112	L14 V15 L20 E21 M22	L14-L18 HydrophobicContact CD1-CD1 4.29Å; L14-L18 HydrophobicContact CD1-CG 4.38Å; L14-L18 HydrophobicContact CG-CD1 4.09Å; L14-L18 WeakPolarHBondContact O-CB 3.35Å; L14-L18 VanDerWaalsContact O-CG 3.27Å; L14-L18 WeakPolarHBondContact O-CG 3.23Å; L14-L18 PolarHBondContact O-N 3.46Å; V15-L18 PolarHBondContact O-N 3.5Å; L18-L20 VanDerWaalsContact C-N 3.34Å; L18-L20 PolarHBondContact O-N 2.88Å; L18-E21 PolarHBondContact O-N 3.04Å; L18-M22 WeakPolarHBondContact O-CB 3.27Å; L18-M22 WeakPolarHBondContact O-CG 3.47Å; L18-M22 PolarHBondContact O-N 3.38Å
19	E	93.7	Very high	91.9	Very high	119 Å²	119	103.7 Å²	103.7	56%	0.556	51%	0.513	S	S	*	.	H	α-helix	trans	-59.9	-43.9	175.7	-76.1	179.3	167.8	0	0	111.6	V15 A16 E17 M22 M23	V15-E19 HydrophobicContact CG1-CG 4.43Å; V15-E19 WeakPolarHBondContact O-CG 3.31Å; V15-E19 PolarHBondContact O-N 2.84Å; A16-E19 PolarHBondContact O-N 2.96Å; E17-E19 PolarHBondContact O-N 2.97Å; E19-M22 PolarHBondContact O-N 3.03Å; E19-M23 WeakPolarHBondContact O-CG 3.39Å; E19-M23 PolarHBondContact O-N 3.4Å
20	L	95.6	Very high	93.1	Very high	116 Å²	116	100.2 Å²	100.2	61%	0.607	49%	0.489	S	S	*	.	H	α-helix	trans	-64.6	-43.3	177	-72.3	174.7	0	0	0	112.4	A16 E17 L18 M22 M23 T24	A16-L20 WeakPolarHBondContact O-CG 3.42Å; A16-L20 PolarHBondContact O-N 3.22Å; E17-L20 PolarHBondContact O-N 2.92Å; L18-L20 VanDerWaalsContact C-N 3.34Å; L18-L20 PolarHBondContact O-N 2.88Å; L20-M22 VanDerWaalsContact C-N 3.35Å; L20-M23 PolarHBondContact O-N 3.47Å; L20-T24 WeakPolarHBondContact O-CB 3.42Å; L20-T24 PolarHBondContact O-N 3.3Å; L20-T24 PolarHBondContact O-OG1 2.91Å
21	E	96.6	Very high	94	Very high	133 Å²	133	97.7 Å²	97.7	62%	0.621	48%	0.477	S	S	*	.	H	α-helix	trans	-61.6	-44	176.1	-74.6	-176.6	178.8	0	0	111.4	E17 L18 T24 D25	E17-E21 WeakPolarHBondContact O-CG 3.43Å; E17-E21 PolarHBondContact O-N 3.23Å; L18-E21 PolarHBondContact O-N 3.04Å; E21-T24 PolarHBondContact O-N 3.38Å; E21-D25 PolarHBondContact O-N 3.03Å
22	M	94.3	Very high	94.7	Very high	136 Å²	136	96.7 Å²	96.7	67%	0.67	48%	0.475	S	S	*	.	H	α-helix	trans	-61.9	-46.5	176.5	-73.8	178.1	63.1	0	0	112	L18 E19 L20 T24 D25 L26	L18-M22 WeakPolarHBondContact O-CB 3.27Å; L18-M22 WeakPolarHBondContact O-CG 3.47Å; L18-M22 PolarHBondContact O-N 3.38Å; E19-M22 PolarHBondContact O-N 3.03Å; L20-M22 VanDerWaalsContact C-N 3.35Å; M22-T24 VanDerWaalsContact C-N 3.29Å; M22-T24 PolarHBondContact O-N 3.47Å; M22-D25 PolarHBondContact O-N 3.36Å; M22-L26 WeakPolarHBondContact O-CB 3.48Å; M22-L26 PolarHBondContact O-N 3.24Å
23	M	95.8	Very high	95.4	Very high	134 Å²	134	92.5 Å²	92.5	66%	0.66	46%	0.457	S	S	*	.	H	α-helix	trans	-62.8	-38	176.6	-73.2	-167.6	76.3	0	0	111.9	E19 L20 Y27	E19-M23 WeakPolarHBondContact O-CG 3.39Å; E19-M23 PolarHBondContact O-N 3.4Å; L20-M23 PolarHBondContact O-N 3.47Å; M23-Y27 WeakPolarHBondContact O-CB 3.34Å; M23-Y27 PolarHBondContact O-N 3.02Å
24	T	97.4	Very high	95.8	Very high	94 Å²	94	86.9 Å²	86.9	58%	0.577	43%	0.431	S	S	*	.	H	α-helix	trans	-66.9	-45.5	178.5	-59.8	0	0	0	0	111.6	L20 E21 M22 Y27 R28	L20-T24 WeakPolarHBondContact O-CB 3.42Å; L20-T24 PolarHBondContact O-N 3.3Å; L20-T24 PolarHBondContact O-OG1 2.91Å; E21-T24 PolarHBondContact O-N 3.38Å; M22-T24 VanDerWaalsContact C-N 3.29Å; M22-T24 PolarHBondContact O-N 3.47Å; T24-Y27 PolarHBondContact O-N 3.38Å; T24-R28 WeakPolarHBondContact O-CB 3.34Å; T24-R28 PolarHBondContact O-N 3.41Å
25	D	97.1	Very high	96.1	Very high	53 Å²	53	87 Å²	87	28%	0.283	43%	0.429	S	S	.	.	H	α-helix	trans	-65.2	-41.3	177.1	-173.3	61.6	0	0	0	111.5	E21 M22 Y27 R28 R29	E21-D25 PolarHBondContact O-N 3.03Å; M22-D25 PolarHBondContact O-N 3.36Å; D25-Y27 PolarHBondContact O-N 3.4Å; D25-R28 PolarHBondContact O-N 3.4Å; D25-R28 IonicContact OD1-CZ 3.7Å; D25-R28 IonicContact OD1-NE 3.7Å; D25-R28 IonicContact OD1-NH2 2.84Å; D25-R28 PolarHBondContact OD1-NH2 3.05Å; D25-R29 VanDerWaalsContact CG-NE 3.33Å; D25-R29 WeakPolarHBondContact O-CB 3.36Å; D25-R29 WeakPolarHBondContact O-CG 3.39Å; D25-R29 PolarHBondContact O-N 2.92Å; D25-R29 IonicContact OD1-CZ 2.61Å; D25-R29 IonicContact OD1-NE 3.87Å; D25-R29 PolarHBondContact OD1-NE 3.41Å; D25-R29 IonicContact OD1-NH2 2.71Å; D25-R29 WeakPolarHBondContact OD2-CD 3.21Å; D25-R29 IonicContact OD2-CZ 3.22Å; D25-R29 IonicContact OD2-NE 3.61Å; D25-R29 PolarHBondContact OD2-NE 2.77Å; D25-R29 IonicContact OD2-NH2 3.98Å
26	L	96.9	Very high	96.4	Very high	38 Å²	38	92.7 Å²	92.7	20%	0.199	45%	0.45	C	S	.	.	H	α-helix	trans	-55.6	-52.8	173.3	176.2	64.4	0	0	0	111	M22 R28 R29 M30 Y63	M22-L26 WeakPolarHBondContact O-CB 3.48Å; M22-L26 PolarHBondContact O-N 3.24Å; L26-R28 PolarHBondContact O-N 2.92Å; L26-R29 PolarHBondContact O-N 3.46Å; L26-M30 WeakPolarHBondContact O-CB 3.33Å; L26-M30 PolarHBondContact O-N 2.94Å; L26-Y63 HydrophobicContact CD1-CD1 4.39Å; L26-Y63 HydrophobicContact CD1-CE1 3.66Å
27	Y	98	Very high	96.7	Very high	158 Å²	158	97.5 Å²	97.5	62%	0.62	46%	0.463	S	S	*	.	H	α-helix	trans	-59.8	-45.6	-179.6	-178.8	-99.6	0	0	0	111.9	M23 T24 D25 M30 T31	M23-Y27 WeakPolarHBondContact O-CB 3.34Å; M23-Y27 PolarHBondContact O-N 3.02Å; T24-Y27 PolarHBondContact O-N 3.38Å; D25-Y27 PolarHBondContact O-N 3.4Å; Y27-M30 HydrophobicContact CD2-CE 4.26Å; Y27-M30 PolarHBondContact O-N 2.92Å; Y27-T31 VanDerWaalsContact O-CB 3.26Å; Y27-T31 WeakPolarHBondContact O-CB 3.4Å; Y27-T31 PolarHBondContact O-N 3.37Å; Y27-T31 PolarHBondContact O-OG1 3.22Å
28	R	98.2	Very high	97	Very high	150 Å²	150	92.7 Å²	92.7	57%	0.566	44%	0.442	S	S	*	.	H	α-helix	trans	-61.1	-48.2	179	-175.9	-177.4	66.6	146	-3.3	111.9	T24 D25 L26 T32	T24-R28 WeakPolarHBondContact O-CB 3.34Å; T24-R28 PolarHBondContact O-N 3.41Å; D25-R28 PolarHBondContact O-N 3.4Å; D25-R28 IonicContact OD1-CZ 3.7Å; D25-R28 IonicContact OD1-NE 3.7Å; D25-R28 IonicContact OD1-NH2 2.84Å; D25-R28 PolarHBondContact OD1-NH2 3.05Å; L26-R28 PolarHBondContact O-N 2.92Å; R28-T32 WeakPolarHBondContact O-CB 3.49Å; R28-T32 PolarHBondContact O-N 3.44Å; R28-T32 PolarHBondContact O-OG1 3.48Å
29	R	98	Very high	97.1	Very high	139 Å²	139	90 Å²	90	53%	0.525	43%	0.427	S	S	.	.	H	α-helix	trans	-68.3	-42.1	-179.3	-70.6	179	-176	-106	2.7	111.9	D25 L26 S33 Y63	D25-R29 VanDerWaalsContact CG-NE 3.33Å; D25-R29 WeakPolarHBondContact O-CB 3.36Å; D25-R29 WeakPolarHBondContact O-CG 3.39Å; D25-R29 PolarHBondContact O-N 2.92Å; D25-R29 IonicContact OD1-CZ 2.61Å; D25-R29 IonicContact OD1-NE 3.87Å; D25-R29 PolarHBondContact OD1-NE 3.41Å; D25-R29 IonicContact OD1-NH2 2.71Å; D25-R29 WeakPolarHBondContact OD2-CD 3.21Å; D25-R29 IonicContact OD2-CZ 3.22Å; D25-R29 IonicContact OD2-NE 3.61Å; D25-R29 PolarHBondContact OD2-NE 2.77Å; D25-R29 IonicContact OD2-NH2 3.98Å; L26-R29 PolarHBondContact O-N 3.46Å; R29-S33 WeakPolarHBondContact O-CB 3.38Å; R29-S33 PolarHBondContact O-N 3.43Å; R29-Y63 VanDerWaalsContact CB-OH 3.27Å; R29-Y63 WeakPolarHBondContact CB-OH 3.48Å
30	M	98.4	Very high	97.1	Very high	24 Å²	24	88 Å²	88	12%	0.118	43%	0.425	C	S	.	.	H	α-helix	trans	-60.4	-52.3	176.7	-179	175.2	65.6	0	0	110.7	L26 Y27 T32 S33 C34 V60 Y63 L64	L26-M30 WeakPolarHBondContact O-CB 3.33Å; L26-M30 PolarHBondContact O-N 2.94Å; Y27-M30 HydrophobicContact CD2-CE 4.26Å; Y27-M30 PolarHBondContact O-N 2.92Å; M30-T32 PolarHBondContact O-N 2.88Å; M30-S33 PolarHBondContact O-N 3.25Å; M30-S33 VanDerWaalsContact O-N 3.14Å; M30-C34 PolarHBondContact O-N 3.35Å; M30-V60 HydrophobicContact SD-CB 4.47Å; M30-V60 HydrophobicContact SD-CG1 3.89Å; M30-V60 HydrophobicContact SD-CG2 4.34Å; M30-Y63 HydrophobicContact CB-CD1 3.72Å; M30-Y63 HydrophobicContact CB-CD2 4.38Å; M30-Y63 HydrophobicContact CB-CE1 3.65Å; M30-Y63 HydrophobicContact CB-CE2 4.3Å; M30-Y63 HydrophobicContact CB-CG 4.11Å; M30-Y63 HydrophobicContact CG-CD1 3.64Å; M30-Y63 HydrophobicContact CG-CD2 4.27Å; M30-Y63 HydrophobicContact CG-CE1 4.12Å; M30-Y63 HydrophobicContact CG-CG 3.74Å; M30-Y63 HydrophobicContact SD-CD1 4Å; M30-Y63 HydrophobicContact SD-CG 4.43Å; M30-L64 HydrophobicContact SD-CD2 4.13Å; M30-L64 HydrophobicContact SD-CG 4.26Å
31	T	98	Very high	96.8	Very high	57 Å²	57	86.2 Å²	86.2	35%	0.35	43%	0.434	S	S	.	.	H	α-helix	trans	-58.5	-47.6	179.5	-57.8	0	0	0	0	111	Y27 S33 C34 Q35	Y27-T31 VanDerWaalsContact O-CB 3.26Å; Y27-T31 WeakPolarHBondContact O-CB 3.4Å; Y27-T31 PolarHBondContact O-N 3.37Å; Y27-T31 PolarHBondContact O-OG1 3.22Å; T31-S33 VanDerWaalsContact C-N 3.33Å; T31-S33 PolarHBondContact O-N 3.28Å; T31-C34 PolarHBondContact O-N 3.12Å; T31-Q35 VanDerWaalsContact O-CB 3.25Å; T31-Q35 WeakPolarHBondContact O-CB 3.44Å; T31-Q35 PolarHBondContact O-N 2.97Å
32	T	98.1	Very high	96.6	Very high	57 Å²	57	86.7 Å²	86.7	35%	0.35	44%	0.436	S	S	.	.	H	α-helix	trans	-60.9	-41.1	176.9	-57.4	0	0	0	0	112.1	R28 M30 K36	R28-T32 WeakPolarHBondContact O-CB 3.49Å; R28-T32 PolarHBondContact O-N 3.44Å; R28-T32 PolarHBondContact O-OG1 3.48Å; M30-T32 PolarHBondContact O-N 2.88Å; T32-K36 HydrophobicContact CG2-CD 4.23Å; T32-K36 WeakPolarHBondContact O-CB 3.37Å; T32-K36 VanDerWaalsContact O-CG 3.28Å; T32-K36 WeakPolarHBondContact O-CG 3.25Å; T32-K36 PolarHBondContact O-N 2.97Å; T32-K36 VanDerWaalsContact O-N 3.17Å
33	S	98.3	Very high	96.5	Very high	31 Å²	31	87.2 Å²	87.2	22%	0.217	43%	0.432	C	S	.	.	H	α-helix	trans	-66	-46.7	179	-167.6	0	0	0	0	111.5	R29 M30 T31 K36 K37	R29-S33 WeakPolarHBondContact O-CB 3.38Å; R29-S33 PolarHBondContact O-N 3.43Å; M30-S33 PolarHBondContact O-N 3.25Å; M30-S33 VanDerWaalsContact O-N 3.14Å; T31-S33 VanDerWaalsContact C-N 3.33Å; T31-S33 PolarHBondContact O-N 3.28Å; S33-K36 PolarHBondContact O-N 3.23Å; S33-K37 WeakPolarHBondContact O-CB 3.34Å; S33-K37 VanDerWaalsContact O-CG 3.29Å; S33-K37 WeakPolarHBondContact O-CG 3.44Å; S33-K37 PolarHBondContact O-N 3.33Å; S33-K37 VanDerWaalsContact O-N 3.11Å; S33-K37 PolarHBondContact OG-NZ 3.15Å
34	C	98.6	Very high	96.2	Very high	5 Å²	5	89.8 Å²	89.8	3%	0.034	44%	0.439	C	S	.	.	H	α-helix	trans	-73.3	-36.9	-177.4	-67	0	0	0	0	112.5	M30 T31 K36 K37 C38 C59	M30-C34 PolarHBondContact O-N 3.35Å; T31-C34 PolarHBondContact O-N 3.12Å; C34-K36 PolarHBondContact O-N 3.09Å; C34-K37 PolarHBondContact O-N 3.36Å; C34-C38 VanDerWaalsContact O-CB 3.27Å; C34-C38 WeakPolarHBondContact O-CB 3.39Å; C34-C38 PolarHBondContact O-N 2.93Å; C34-C59 WeakPolarHBondContact CA-SG 3.35Å; C34-C59 HydrophobicContact CB-CB 3.81Å; C34-C59 WeakPolarHBondContact CB-SG 3.36Å; C34-C59 VanDerWaalsContact SG-C 3.53Å; C34-C59 WeakPolarHBondContact SG-CB 3.33Å; C34-C59 CovalentContact SG-SG 2.05Å; C34-C59 PolarHBondContact SG-SG 3.35Å
35	Q	97.1	Very high	95.9	Very high	95 Å²	95	91.8 Å²	91.8	44%	0.444	44%	0.442	S	S	.	.	H	α-helix	trans	-57.6	-50.4	171.2	-174.1	-177.4	3.8	0	0	110.9	T31 K37 C38 I39	T31-Q35 VanDerWaalsContact O-CB 3.25Å; T31-Q35 WeakPolarHBondContact O-CB 3.44Å; T31-Q35 PolarHBondContact O-N 2.97Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.37Å; Q35-C38 PolarHBondContact O-N 3.14Å; Q35-I39 HydrophobicContact CG-CB 4.35Å; Q35-I39 HydrophobicContact CG-CG1 4.38Å; Q35-I39 WeakPolarHBondContact O-CB 3.45Å; Q35-I39 PolarHBondContact O-N 3Å
36	K	97.1	Very high	95.7	Very high	169 Å²	169	95.4 Å²	95.4	74%	0.735	47%	0.468	S	S	*	.	H	α-helix	trans	-62.3	-30.9	179	-74	178.3	-179.8	-177.5	0	114	T32 S33 C34	T32-K36 HydrophobicContact CG2-CD 4.23Å; T32-K36 WeakPolarHBondContact O-CB 3.37Å; T32-K36 VanDerWaalsContact O-CG 3.28Å; T32-K36 WeakPolarHBondContact O-CG 3.25Å; T32-K36 PolarHBondContact O-N 2.97Å; T32-K36 VanDerWaalsContact O-N 3.17Å; S33-K36 PolarHBondContact O-N 3.23Å; C34-K36 PolarHBondContact O-N 3.09Å
37	K	98.1	Very high	95.6	Very high	145 Å²	145	99.6 Å²	99.6	63%	0.63	49%	0.491	S	S	*	.	H	α-helix	trans	-83.6	-35.8	-178.7	-75.9	170.8	179.3	166.3	0	113	S33 C34 Q35	S33-K37 WeakPolarHBondContact O-CB 3.34Å; S33-K37 VanDerWaalsContact O-CG 3.29Å; S33-K37 WeakPolarHBondContact O-CG 3.44Å; S33-K37 PolarHBondContact O-N 3.33Å; S33-K37 VanDerWaalsContact O-N 3.11Å; S33-K37 PolarHBondContact OG-NZ 3.15Å; C34-K37 PolarHBondContact O-N 3.36Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 3.37Å
38	C	98.1	Very high	95.5	Very high	12 Å²	12	96.9 Å²	96.9	8%	0.081	49%	0.487	C	S	.	.	H	α-helix	trans	-107.8	-27.3	-167.6	-65	0	0	0	0	113.5	C34 Q35 E52 C55 I56	C34-C38 VanDerWaalsContact O-CB 3.27Å; C34-C38 WeakPolarHBondContact O-CB 3.39Å; C34-C38 PolarHBondContact O-N 2.93Å; Q35-C38 PolarHBondContact O-N 3.14Å; C38-E52 WeakPolarHBondContact O-CG 3.26Å; C38-C55 WeakPolarHBondContact CA-SG 3.13Å; C38-C55 HydrophobicContact CB-CB 3.63Å; C38-C55 WeakPolarHBondContact CB-SG 3.46Å; C38-C55 WeakPolarHBondContact SG-CB 3.33Å; C38-C55 PolarHBondContact SG-O 3.23Å; C38-C55 VanDerWaalsContact SG-O 3.33Å; C38-C55 CovalentContact SG-SG 2.05Å; C38-C55 PolarHBondContact SG-SG 3.42Å; C38-I56 HydrophobicContact CB-CG1 3.89Å; C38-I56 PolarHBondContact SG-N 3.35Å
39	I	96.2	Very high	95.3	Very high	24 Å²	24	92 Å²	92	12%	0.123	48%	0.475	C	S	.	.	S	Bend	trans	-107.5	112.2	-176.6	-51.1	-54.7	0	0	0	109.5	Q35 Y43 L48 E52 I56	Q35-I39 HydrophobicContact CG-CB 4.35Å; Q35-I39 HydrophobicContact CG-CG1 4.38Å; Q35-I39 WeakPolarHBondContact O-CB 3.45Å; Q35-I39 PolarHBondContact O-N 3Å; I39-Y43 HydrophobicContact CG2-CD1 4.3Å; I39-Y43 HydrophobicContact CG2-CE1 3.5Å; I39-L48 HydrophobicContact CD1-CD2 3.45Å; I39-L48 VanDerWaalsContact CD1-CD2 3.45Å; I39-E52 HydrophobicContact CD1-CB 3.73Å; I39-E52 HydrophobicContact CD1-CG 3.83Å; I39-I56 HydrophobicContact CD1-CD1 4.02Å
40	P	92.3	Very high	95.3	Very high	78 Å²	78	94.1 Å²	94.1	51%	0.506	49%	0.488	S	S	.	.			trans	-59.8	144.7	174.2	-20.7	32.9	0	0	0	111.1	H42 E52	P40-H42 PolarHBondContact O-N 3.37Å; P40-H42 VanDerWaalsContact O-N 3.11Å; P40-E52 WeakPolarHBondContact CD-OE1 3.32Å
41	G	91	Very high	95.2	Very high	78 Å²	78	95.5 Å²	95.5	80%	0.804	51%	0.509	S	S	*	.	S	Bend	trans	-63.6	-18.3	178.2	0	0	0	0	0	114.4
42	H	92.2	Very high	95.2	Very high	143 Å²	143	94.6 Å²	94.6	66%	0.662	50%	0.5	S	S	*	.	S	Bend	trans	-99	99	173.8	-177.5	-70.4	0	0	0	110.4	P40 K44	P40-H42 PolarHBondContact O-N 3.37Å; P40-H42 VanDerWaalsContact O-N 3.11Å; H42-K44 PolarHBondContact O-N 3.33Å
43	Y	91.7	Very high	95.2	Very high	148 Å²	148	93.6 Å²	93.6	58%	0.58	50%	0.498	S	S	*	.			trans	-70	121.9	175.5	-62.2	-91.2	0	0	0	110.2	I39	I39-Y43 HydrophobicContact CG2-CD1 4.3Å; I39-Y43 HydrophobicContact CG2-CE1 3.5Å
44	K	88.9	Confident	95.2	Very high	187 Å²	187	94.9 Å²	94.9	81%	0.813	50%	0.504	S	S	*	.			trans	-97.9	-28.9	176.9	-65.6	-177.3	-179.8	-179.8	0	112.4	H42	H42-K44 PolarHBondContact O-N 3.33Å
45	E	91.2	Very high	95.2	Very high	136 Å²	136	96.7 Å²	96.7	64%	0.636	52%	0.517	S	S	*	.	S	Bend	trans	-138.7	153.8	-175.3	-64.2	-179.1	171.1	0	0	108.5	D47	E45-D47 VanDerWaalsContact C-N 3.32Å
46	P	92.8	Very high	95.2	Very high	130 Å²	130	94.4 Å²	94.4	84%	0.844	51%	0.507	S	S	*	.	S	Bend	trans	-73.4	-25.8	-179.6	29.1	-34.8	0	0	0	113
47	D	95.3	Very high	95.3	Very high	126 Å²	126	91.6 Å²	91.6	67%	0.674	50%	0.5	S	S	*	.	S	Bend	trans	-100.4	157.2	-176.8	-65.4	-64.8	0	0	0	111.7	E45 S49	E45-D47 VanDerWaalsContact C-N 3.32Å; D47-S49 PolarHBondContact O-N 3.03Å
48	L	95	Very high	95.3	Very high	101 Å²	101	92.8 Å²	92.8	53%	0.529	50%	0.501	S	S	.	.	P	Polyproline II helix	trans	-67.9	125.2	171.2	-64.2	179.5	0	0	0	110.1	I39 E52 I56	I39-L48 HydrophobicContact CD1-CD2 3.45Å; I39-L48 VanDerWaalsContact CD1-CD2 3.45Å; L48-E52 HydrophobicContact CB-CB 4.44Å; L48-E52 HydrophobicContact CD2-CB 4.17Å; L48-I56 HydrophobicContact CD1-CD1 3.85Å; L48-I56 HydrophobicContact CD2-CD1 4.34Å
49	S	95.7	Very high	95.4	Very high	46 Å²	46	92.9 Å²	92.9	32%	0.322	50%	0.501	S	S	.	.	P	Polyproline II helix	trans	-63.5	157.7	166	69	0	0	0	0	110.7	D47 G51 E52 A53	D47-S49 PolarHBondContact O-N 3.03Å; S49-G51 PolarHBondContact O-N 3.37Å; S49-G51 VanDerWaalsContact O-N 3.13Å; S49-E52 VanDerWaalsContact CB-OE2 3.31Å; S49-E52 WeakPolarHBondContact CB-OE2 3.43Å; S49-E52 PolarHBondContact N-OE2 2.96Å; S49-E52 PolarHBondContact O-N 3.42Å; S49-E52 VanDerWaalsContact O-N 3.08Å; S49-E52 VanDerWaalsContact OG-CD 3.27Å; S49-E52 VanDerWaalsContact OG-CG 3.27Å; S49-E52 WeakPolarHBondContact OG-CG 3.17Å; S49-E52 PolarHBondContact OG-N 2.94Å; S49-E52 PolarHBondContact OG-OE2 3.2Å; S49-A53 PolarHBondContact O-N 3.22Å
50	K	96.6	Very high	95.5	Very high	184 Å²	184	94 Å²	94	80%	0.8	51%	0.509	S	S	*	.	H	α-helix	trans	-53.8	-35.2	174.8	-175.8	178.6	179.7	179.4	0	112.5	V54	K50-V54 VanDerWaalsContact O-CG2 3.29Å; K50-V54 WeakPolarHBondContact O-CG2 3.41Å; K50-V54 PolarHBondContact O-N 2.84Å; K50-V54 VanDerWaalsContact O-N 3.15Å
51	G	96.6	Very high	95.8	Very high	53 Å²	53	93.2 Å²	93.2	55%	0.546	51%	0.509	S	S	.	.	H	α-helix	trans	-68	-42.7	178.5	0	0	0	0	0	112.6	S49 C55	S49-G51 PolarHBondContact O-N 3.37Å; S49-G51 VanDerWaalsContact O-N 3.13Å; G51-C55 VanDerWaalsContact O-CB 3.3Å; G51-C55 WeakPolarHBondContact O-CB 3.35Å; G51-C55 PolarHBondContact O-N 3.22Å
52	E	97.6	Very high	96.2	Very high	38 Å²	38	96.5 Å²	96.5	18%	0.178	50%	0.501	C	S	.	.	H	α-helix	trans	-66	-45	177.7	-71.5	163.4	143.5	0	0	111.4	C38 I39 P40 L48 S49 C55 I56	C38-E52 WeakPolarHBondContact O-CG 3.26Å; I39-E52 HydrophobicContact CD1-CB 3.73Å; I39-E52 HydrophobicContact CD1-CG 3.83Å; P40-E52 WeakPolarHBondContact CD-OE1 3.32Å; L48-E52 HydrophobicContact CB-CB 4.44Å; L48-E52 HydrophobicContact CD2-CB 4.17Å; S49-E52 VanDerWaalsContact CB-OE2 3.31Å; S49-E52 WeakPolarHBondContact CB-OE2 3.43Å; S49-E52 PolarHBondContact N-OE2 2.96Å; S49-E52 PolarHBondContact O-N 3.42Å; S49-E52 VanDerWaalsContact O-N 3.08Å; S49-E52 VanDerWaalsContact OG-CD 3.27Å; S49-E52 VanDerWaalsContact OG-CG 3.27Å; S49-E52 WeakPolarHBondContact OG-CG 3.17Å; S49-E52 PolarHBondContact OG-N 2.94Å; S49-E52 PolarHBondContact OG-OE2 3.2Å; E52-C55 WeakPolarHBondContact O-CB 3.5Å; E52-C55 PolarHBondContact O-N 2.9Å; E52-I56 WeakPolarHBondContact O-CG1 3.27Å; E52-I56 PolarHBondContact O-N 2.91Å
53	A	97.7	Very high	96.5	Very high	37 Å²	37	92 Å²	92	31%	0.306	48%	0.479	S	S	.	.	H	α-helix	trans	-58.2	-52	176.5	0	0	0	0	0	111.9	S49 C55 I56 D57	S49-A53 PolarHBondContact O-N 3.22Å; A53-C55 VanDerWaalsContact C-N 3.28Å; A53-C55 PolarHBondContact O-N 3.01Å; A53-I56 PolarHBondContact O-N 3.07Å; A53-I56 VanDerWaalsContact O-N 3.12Å; A53-D57 PolarHBondContact O-N 3.09Å
54	V	98.6	Very high	96.8	Very high	57 Å²	57	88.7 Å²	88.7	35%	0.345	47%	0.471	S	S	.	.	H	α-helix	trans	-63.2	-34.6	178	172.3	0	0	0	0	111.9	K50 R58	K50-V54 VanDerWaalsContact O-CG2 3.29Å; K50-V54 WeakPolarHBondContact O-CG2 3.41Å; K50-V54 PolarHBondContact O-N 2.84Å; K50-V54 VanDerWaalsContact O-N 3.15Å; V54-R58 VanDerWaalsContact O-CG 3.3Å; V54-R58 WeakPolarHBondContact O-CG 3.46Å; V54-R58 PolarHBondContact O-N 2.7Å
55	C	98.7	Very high	97.2	Very high	44 Å²	44	82.9 Å²	82.9	30%	0.297	45%	0.449	S	S	.	.	H	α-helix	trans	-63.9	-46.2	173.8	-178.6	0	0	0	0	111.3	C38 G51 E52 A53 R58 C59	C38-C55 WeakPolarHBondContact CA-SG 3.13Å; C38-C55 HydrophobicContact CB-CB 3.63Å; C38-C55 WeakPolarHBondContact CB-SG 3.46Å; C38-C55 WeakPolarHBondContact SG-CB 3.33Å; C38-C55 PolarHBondContact SG-O 3.23Å; C38-C55 VanDerWaalsContact SG-O 3.33Å; C38-C55 CovalentContact SG-SG 2.05Å; C38-C55 PolarHBondContact SG-SG 3.42Å; G51-C55 VanDerWaalsContact O-CB 3.3Å; G51-C55 WeakPolarHBondContact O-CB 3.35Å; G51-C55 PolarHBondContact O-N 3.22Å; E52-C55 WeakPolarHBondContact O-CB 3.5Å; E52-C55 PolarHBondContact O-N 2.9Å; A53-C55 VanDerWaalsContact C-N 3.28Å; A53-C55 PolarHBondContact O-N 3.01Å; C55-R58 PolarHBondContact O-N 2.92Å; C55-C59 VanDerWaalsContact O-CB 3.25Å; C55-C59 WeakPolarHBondContact O-CB 3.43Å; C55-C59 PolarHBondContact O-N 3.23Å
56	I	98.6	Very high	97.6	Very high	46 Å²	46	80 Å²	80	24%	0.236	44%	0.44	C	S	.	.	H	α-helix	trans	-58.7	-49.5	179	-72.8	165.6	0	0	0	110.3	C38 I39 L48 E52 A53 R58 C59 V60	C38-I56 HydrophobicContact CB-CG1 3.89Å; C38-I56 PolarHBondContact SG-N 3.35Å; I39-I56 HydrophobicContact CD1-CD1 4.02Å; L48-I56 HydrophobicContact CD1-CD1 3.85Å; L48-I56 HydrophobicContact CD2-CD1 4.34Å; E52-I56 WeakPolarHBondContact O-CG1 3.27Å; E52-I56 PolarHBondContact O-N 2.91Å; A53-I56 PolarHBondContact O-N 3.07Å; A53-I56 VanDerWaalsContact O-N 3.12Å; I56-R58 VanDerWaalsContact C-N 3.33Å; I56-R58 PolarHBondContact O-N 2.99Å; I56-C59 WeakPolarHBondContact O-CB 3.48Å; I56-C59 PolarHBondContact O-N 3.22Å; I56-C59 VanDerWaalsContact O-N 3.07Å; I56-V60 HydrophobicContact CG2-CG2 4.35Å; I56-V60 WeakPolarHBondContact O-CG2 3.38Å; I56-V60 PolarHBondContact O-N 2.99Å
57	D	98.7	Very high	97.7	Very high	111 Å²	111	78.2 Å²	78.2	59%	0.594	42%	0.421	S	S	*	.	H	α-helix	trans	-55.8	-47.9	179.2	-67	-26.4	0	0	0	111.8	A53 C59 A61	A53-D57 PolarHBondContact O-N 3.09Å; D57-C59 VanDerWaalsContact C-N 3.35Å; D57-C59 PolarHBondContact O-N 3.5Å; D57-A61 WeakPolarHBondContact O-CB 3.28Å; D57-A61 PolarHBondContact O-N 2.77Å; D57-A61 VanDerWaalsContact O-N 3.1Å
58	R	98.8	Very high	97.8	Very high	170 Å²	170	77.1 Å²	77.1	64%	0.642	41%	0.411	S	S	*	.	H	α-helix	trans	-66.5	-36.7	177.5	-69.9	174.2	-179.6	-174.3	0.9	112.2	V54 C55 I56 K62	V54-R58 VanDerWaalsContact O-CG 3.3Å; V54-R58 WeakPolarHBondContact O-CG 3.46Å; V54-R58 PolarHBondContact O-N 2.7Å; C55-R58 PolarHBondContact O-N 2.92Å; I56-R58 VanDerWaalsContact C-N 3.33Å; I56-R58 PolarHBondContact O-N 2.99Å; R58-K62 WeakPolarHBondContact O-CB 3.45Å; R58-K62 VanDerWaalsContact O-CG 3.31Å; R58-K62 WeakPolarHBondContact O-CG 3.49Å; R58-K62 PolarHBondContact O-N 2.9Å; R58-K62 VanDerWaalsContact O-N 3.07Å
59	C	98.8	Very high	98	Very high	14 Å²	14	78 Å²	78	10%	0.095	41%	0.411	C	S	.	.	H	α-helix	trans	-65.6	-48	179.3	178.6	0	0	0	0	110.8	C34 C55 I56 D57 K62 Y63	C34-C59 WeakPolarHBondContact CA-SG 3.35Å; C34-C59 HydrophobicContact CB-CB 3.81Å; C34-C59 WeakPolarHBondContact CB-SG 3.36Å; C34-C59 VanDerWaalsContact SG-C 3.53Å; C34-C59 WeakPolarHBondContact SG-CB 3.33Å; C34-C59 CovalentContact SG-SG 2.05Å; C34-C59 PolarHBondContact SG-SG 3.35Å; C55-C59 VanDerWaalsContact O-CB 3.25Å; C55-C59 WeakPolarHBondContact O-CB 3.43Å; C55-C59 PolarHBondContact O-N 3.23Å; I56-C59 WeakPolarHBondContact O-CB 3.48Å; I56-C59 PolarHBondContact O-N 3.22Å; I56-C59 VanDerWaalsContact O-N 3.07Å; D57-C59 VanDerWaalsContact C-N 3.35Å; D57-C59 PolarHBondContact O-N 3.5Å; C59-K62 PolarHBondContact O-N 2.88Å; C59-Y63 VanDerWaalsContact O-CB 3.27Å; C59-Y63 WeakPolarHBondContact O-CB 3.27Å; C59-Y63 PolarHBondContact O-N 3.34Å
60	V	98.7	Very high	98	Very high	46 Å²	46	81.1 Å²	81.1	28%	0.279	42%	0.423	S	S	.	.	H	α-helix	trans	-60.3	-48.4	177.7	170.7	0	0	0	0	110.6	M30 I56 K62 Y63 L64	M30-V60 HydrophobicContact SD-CB 4.47Å; M30-V60 HydrophobicContact SD-CG1 3.89Å; M30-V60 HydrophobicContact SD-CG2 4.34Å; I56-V60 HydrophobicContact CG2-CG2 4.35Å; I56-V60 WeakPolarHBondContact O-CG2 3.38Å; I56-V60 PolarHBondContact O-N 2.99Å; V60-K62 PolarHBondContact O-N 3.44Å; V60-Y63 WeakPolarHBondContact O-CB 3.26Å; V60-Y63 PolarHBondContact O-N 3.37Å; V60-Y63 VanDerWaalsContact O-N 3.12Å; V60-L64 HydrophobicContact CG1-CD1 4.09Å; V60-L64 WeakPolarHBondContact O-CG 3.43Å; V60-L64 PolarHBondContact O-N 2.88Å
61	A	98.7	Very high	97.9	Very high	62 Å²	62	74 Å²	74	51%	0.512	40%	0.402	S	S	.	.	H	α-helix	trans	-57	-46.4	177.7	0	0	0	0	0	112.4	D57 D65	D57-A61 WeakPolarHBondContact O-CB 3.28Å; D57-A61 PolarHBondContact O-N 2.77Å; D57-A61 VanDerWaalsContact O-N 3.1Å; A61-D65 PolarHBondContact O-N 2.89Å; A61-D65 VanDerWaalsContact O-N 3.13Å
62	K	98.8	Very high	97.9	Very high	147 Å²	147	77.6 Å²	77.6	64%	0.639	40%	0.403	S	S	*	.	H	α-helix	trans	-66.8	-37.7	176.1	-73.4	178.7	-179.6	-175.6	0	112.7	R58 C59 V60 L64 D65 V66	R58-K62 WeakPolarHBondContact O-CB 3.45Å; R58-K62 VanDerWaalsContact O-CG 3.31Å; R58-K62 WeakPolarHBondContact O-CG 3.49Å; R58-K62 PolarHBondContact O-N 2.9Å; R58-K62 VanDerWaalsContact O-N 3.07Å; C59-K62 PolarHBondContact O-N 2.88Å; V60-K62 PolarHBondContact O-N 3.44Å; K62-L64 VanDerWaalsContact C-N 3.34Å; K62-D65 PolarHBondContact O-N 3.04Å; K62-V66 WeakPolarHBondContact O-CB 3.25Å; K62-V66 VanDerWaalsContact O-CG2 3.29Å; K62-V66 WeakPolarHBondContact O-CG2 3.32Å; K62-V66 PolarHBondContact O-N 3.49Å
63	Y	98.7	Very high	97.9	Very high	50 Å²	50	80.9 Å²	80.9	20%	0.196	42%	0.416	C	S	.	.	H	α-helix	trans	-62.5	-45.7	-179.6	-169.7	-78.8	0	0	0	110.4	L26 R29 M30 C59 V60 V66 H67	L26-Y63 HydrophobicContact CD1-CD1 4.39Å; L26-Y63 HydrophobicContact CD1-CE1 3.66Å; R29-Y63 VanDerWaalsContact CB-OH 3.27Å; R29-Y63 WeakPolarHBondContact CB-OH 3.48Å; M30-Y63 HydrophobicContact CB-CD1 3.72Å; M30-Y63 HydrophobicContact CB-CD2 4.38Å; M30-Y63 HydrophobicContact CB-CE1 3.65Å; M30-Y63 HydrophobicContact CB-CE2 4.3Å; M30-Y63 HydrophobicContact CB-CG 4.11Å; M30-Y63 HydrophobicContact CG-CD1 3.64Å; M30-Y63 HydrophobicContact CG-CD2 4.27Å; M30-Y63 HydrophobicContact CG-CE1 4.12Å; M30-Y63 HydrophobicContact CG-CG 3.74Å; M30-Y63 HydrophobicContact SD-CD1 4Å; M30-Y63 HydrophobicContact SD-CG 4.43Å; C59-Y63 VanDerWaalsContact O-CB 3.27Å; C59-Y63 WeakPolarHBondContact O-CB 3.27Å; C59-Y63 PolarHBondContact O-N 3.34Å; V60-Y63 WeakPolarHBondContact O-CB 3.26Å; V60-Y63 PolarHBondContact O-N 3.37Å; V60-Y63 VanDerWaalsContact O-N 3.12Å; Y63-V66 PolarHBondContact O-N 3.49Å; Y63-H67 VanDerWaalsContact O-CB 3.27Å; Y63-H67 WeakPolarHBondContact O-CB 3.49Å; Y63-H67 PolarHBondContact O-N 2.78Å
64	L	98.2	Very high	97.7	Very high	77 Å²	77	84.6 Å²	84.6	40%	0.403	43%	0.43	S	S	.	.	H	α-helix	trans	-66.9	-42	178.1	-66.1	174.3	0	0	0	112.3	M30 V60 K62 V66 H67 E68	M30-L64 HydrophobicContact SD-CD2 4.13Å; M30-L64 HydrophobicContact SD-CG 4.26Å; V60-L64 HydrophobicContact CG1-CD1 4.09Å; V60-L64 WeakPolarHBondContact O-CG 3.43Å; V60-L64 PolarHBondContact O-N 2.88Å; K62-L64 VanDerWaalsContact C-N 3.34Å; L64-V66 PolarHBondContact O-N 3.39Å; L64-H67 WeakPolarHBondContact O-CB 3.27Å; L64-H67 PolarHBondContact O-N 3.01Å; L64-E68 PolarHBondContact O-N 2.94Å
65	D	98.4	Very high	97.5	Very high	66 Å²	66	86.2 Å²	86.2	35%	0.353	44%	0.441	S	S	.	.	H	α-helix	trans	-59.8	-44.7	174.1	173.9	41.3	0	0	0	111.9	A61 K62 E68 K69	A61-D65 PolarHBondContact O-N 2.89Å; A61-D65 VanDerWaalsContact O-N 3.13Å; K62-D65 PolarHBondContact O-N 3.04Å; D65-E68 PolarHBondContact O-N 3.22Å; D65-K69 WeakPolarHBondContact O-CB 3.44Å; D65-K69 WeakPolarHBondContact O-CG 3.45Å; D65-K69 PolarHBondContact O-N 2.88Å; D65-K69 WeakPolarHBondContact OD1-CE 3.02Å; D65-K69 IonicContact OD1-NZ 3.57Å; D65-K69 PolarHBondContact OD1-NZ 3.42Å; D65-K69 IonicContact OD2-NZ 2.7Å; D65-K69 PolarHBondContact OD2-NZ 3.45Å
66	V	97.9	Very high	97.3	Very high	76 Å²	76	89.2 Å²	89.2	46%	0.461	45%	0.45	S	S	.	.	H	α-helix	trans	-65.2	-42.3	174.8	171.2	0	0	0	0	111.2	K62 Y63 L64 E68 K69 L70	K62-V66 WeakPolarHBondContact O-CB 3.25Å; K62-V66 VanDerWaalsContact O-CG2 3.29Å; K62-V66 WeakPolarHBondContact O-CG2 3.32Å; K62-V66 PolarHBondContact O-N 3.49Å; Y63-V66 PolarHBondContact O-N 3.49Å; L64-V66 PolarHBondContact O-N 3.39Å; V66-E68 PolarHBondContact O-N 2.82Å; V66-K69 PolarHBondContact O-N 2.99Å; V66-L70 HydrophobicContact CG1-CD1 3.77Å; V66-L70 HydrophobicContact CG1-CG 4.17Å; V66-L70 WeakPolarHBondContact O-CB 3.35Å; V66-L70 VanDerWaalsContact O-CG 3.26Å; V66-L70 WeakPolarHBondContact O-CG 3.04Å; V66-L70 PolarHBondContact O-N 2.89Å
67	H	96.5	Very high	97	Very high	92 Å²	92	91.4 Å²	91.4	43%	0.426	46%	0.461	S	S	.	.	H	α-helix	trans	-59.1	-45.3	177.3	-179.4	73.1	0	0	0	111.6	Y63 L64 L70 G71	Y63-H67 VanDerWaalsContact O-CB 3.27Å; Y63-H67 WeakPolarHBondContact O-CB 3.49Å; Y63-H67 PolarHBondContact O-N 2.78Å; L64-H67 WeakPolarHBondContact O-CB 3.27Å; L64-H67 PolarHBondContact O-N 3.01Å; H67-L70 PolarHBondContact O-N 2.61Å; H67-G71 PolarHBondContact O-N 3.33Å
68	E	97.5	Very high	96.7	Very high	102 Å²	102	88.9 Å²	88.9	48%	0.477	45%	0.451	S	S	.	.	H	α-helix	trans	-62.5	-46.8	176.1	-173.9	-171.7	167.6	0	0	112	L64 D65 V66 L70 G71 K72	L64-E68 PolarHBondContact O-N 2.94Å; D65-E68 PolarHBondContact O-N 3.22Å; V66-E68 PolarHBondContact O-N 2.82Å; E68-L70 VanDerWaalsContact C-N 3.34Å; E68-L70 PolarHBondContact O-N 3.03Å; E68-G71 PolarHBondContact O-N 3.47Å; E68-K72 HydrophobicContact CG-CD 4.47Å; E68-K72 WeakPolarHBondContact O-CG 3.05Å; E68-K72 PolarHBondContact O-N 2.89Å; E68-K72 WeakPolarHBondContact OE1-CE 3.29Å; E68-K72 IonicContact OE1-NZ 2.9Å; E68-K72 PolarHBondContact OE1-NZ 3.47Å
69	K	98.1	Very high	96.3	Very high	120 Å²	120	83.3 Å²	83.3	52%	0.522	44%	0.439	S	S	.	.	H	α-helix	trans	-60.7	-42.7	178	-75.7	167.3	176.6	159.5	0	112.1	D65 V66 K73	D65-K69 WeakPolarHBondContact O-CB 3.44Å; D65-K69 WeakPolarHBondContact O-CG 3.45Å; D65-K69 PolarHBondContact O-N 2.88Å; D65-K69 WeakPolarHBondContact OD1-CE 3.02Å; D65-K69 IonicContact OD1-NZ 3.57Å; D65-K69 PolarHBondContact OD1-NZ 3.42Å; D65-K69 IonicContact OD2-NZ 2.7Å; D65-K69 PolarHBondContact OD2-NZ 3.45Å; V66-K69 PolarHBondContact O-N 2.99Å; K69-K73 WeakPolarHBondContact O-CB 3.45Å; K69-K73 PolarHBondContact O-N 3.39Å
70	L	96	Very high	95.7	Very high	112 Å²	112	87 Å²	87	59%	0.586	46%	0.455	S	S	*	.	H	α-helix	trans	-64.1	-44.1	175.4	-73.3	173.5	0	0	0	111.2	V66 H67 E68 K72 K73 L74	V66-L70 HydrophobicContact CG1-CD1 3.77Å; V66-L70 HydrophobicContact CG1-CG 4.17Å; V66-L70 WeakPolarHBondContact O-CB 3.35Å; V66-L70 VanDerWaalsContact O-CG 3.26Å; V66-L70 WeakPolarHBondContact O-CG 3.04Å; V66-L70 PolarHBondContact O-N 2.89Å; H67-L70 PolarHBondContact O-N 2.61Å; E68-L70 VanDerWaalsContact C-N 3.34Å; E68-L70 PolarHBondContact O-N 3.03Å; L70-K72 PolarHBondContact O-N 3.14Å; L70-K73 PolarHBondContact O-N 2.91Å; L70-L74 WeakPolarHBondContact O-CB 3.25Å; L70-L74 PolarHBondContact O-N 2.86Å
71	G	95.4	Very high	95.2	Very high	34 Å²	34	90 Å²	90	35%	0.351	47%	0.469	S	S	.	.	H	α-helix	trans	-56.5	-51.1	175.3	0	0	0	0	0	112	H67 E68 K73 L74 T75	H67-G71 PolarHBondContact O-N 3.33Å; E68-G71 PolarHBondContact O-N 3.47Å; G71-K73 VanDerWaalsContact C-N 3.31Å; G71-K73 PolarHBondContact O-N 3.17Å; G71-L74 PolarHBondContact O-N 3.47Å; G71-T75 PolarHBondContact O-N 3.07Å; G71-T75 PolarHBondContact O-OG1 3.1Å
72	K	96.8	Very high	94.7	Very high	128 Å²	128	91.5 Å²	91.5	56%	0.557	47%	0.468	S	S	*	.	H	α-helix	trans	-57.8	-43.2	176	-71.8	176	-176.5	170.7	0	112.3	E68 L70 Q76	E68-K72 HydrophobicContact CG-CD 4.47Å; E68-K72 WeakPolarHBondContact O-CG 3.05Å; E68-K72 PolarHBondContact O-N 2.89Å; E68-K72 WeakPolarHBondContact OE1-CE 3.29Å; E68-K72 IonicContact OE1-NZ 2.9Å; E68-K72 PolarHBondContact OE1-NZ 3.47Å; L70-K72 PolarHBondContact O-N 3.14Å; K72-Q76 WeakPolarHBondContact O-CB 3.28Å; K72-Q76 PolarHBondContact O-N 3.42Å
73	K	96	Very high	94.1	Very high	107 Å²	107	89.5 Å²	89.5	47%	0.465	46%	0.462	S	S	.	.	H	α-helix	trans	-65.1	-42	180	-176.6	59.8	-179	178	0	111.7	K69 L70 G71 Q76 M77	K69-K73 WeakPolarHBondContact O-CB 3.45Å; K69-K73 PolarHBondContact O-N 3.39Å; L70-K73 PolarHBondContact O-N 2.91Å; G71-K73 VanDerWaalsContact C-N 3.31Å; G71-K73 PolarHBondContact O-N 3.17Å; K73-Q76 WeakPolarHBondContact O-CB 3.4Å; K73-Q76 PolarHBondContact O-N 3.12Å; K73-M77 HydrophobicContact CD-SD 4.48Å; K73-M77 HydrophobicContact CG-SD 4.18Å; K73-M77 WeakPolarHBondContact O-CG 3.3Å; K73-M77 PolarHBondContact O-N 3.34Å
74	L	95.1	Very high	93.7	Very high	115 Å²	115	91.7 Å²	91.7	60%	0.602	48%	0.48	S	S	*	.	H	α-helix	trans	-63.1	-48.6	177.9	-175.7	61.7	0	0	0	111.1	L70 G71 Q76 M77 S78	L70-L74 WeakPolarHBondContact O-CB 3.25Å; L70-L74 PolarHBondContact O-N 2.86Å; G71-L74 PolarHBondContact O-N 3.47Å; L74-Q76 VanDerWaalsContact C-N 3.3Å; L74-Q76 PolarHBondContact O-N 3.37Å; L74-M77 PolarHBondContact O-N 3.36Å; L74-M77 VanDerWaalsContact O-N 3.09Å; L74-S78 PolarHBondContact O-N 3.47Å; L74-S78 PolarHBondContact O-OG 2.95Å
75	T	93.8	Very high	93.1	Very high	92 Å²	92	94.2 Å²	94.2	56%	0.564	49%	0.491	S	S	*	.	H	α-helix	trans	-56.9	-43.8	174.9	-54.8	0	0	0	0	111.8	G71 M77 S78 S79	G71-T75 PolarHBondContact O-N 3.07Å; G71-T75 PolarHBondContact O-OG1 3.1Å; T75-M77 VanDerWaalsContact C-N 3.28Å; T75-M77 PolarHBondContact O-N 3.35Å; T75-S78 PolarHBondContact O-N 2.89Å; T75-S79 PolarHBondContact O-N 3.07Å; T75-S79 VanDerWaalsContact O-N 3.09Å; T75-S79 PolarHBondContact O-OG 2.9Å
76	Q	94.7	Very high	92.6	Very high	107 Å²	107	96.6 Å²	96.6	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-61.5	-36.6	178.1	-165.5	-164.2	12.5	0	0	112.2	K72 K73 L74 Q80	K72-Q76 WeakPolarHBondContact O-CB 3.28Å; K72-Q76 PolarHBondContact O-N 3.42Å; K73-Q76 WeakPolarHBondContact O-CB 3.4Å; K73-Q76 PolarHBondContact O-N 3.12Å; L74-Q76 VanDerWaalsContact C-N 3.3Å; L74-Q76 PolarHBondContact O-N 3.37Å; Q76-Q80 WeakPolarHBondContact O-CG 3.29Å; Q76-Q80 PolarHBondContact O-N 2.05Å; Q76-Q80 PolarHBondContact O-NE2 2.81Å
77	M	92.5	Very high	92.1	Very high	92 Å²	92	99.2 Å²	99.2	45%	0.453	51%	0.505	S	S	.	.	H	α-helix	trans	-70.3	-47.2	178	-71.4	172.7	63.1	0	0	110.9	K73 L74 T75 S79 Q80 D81	K73-M77 HydrophobicContact CD-SD 4.48Å; K73-M77 HydrophobicContact CG-SD 4.18Å; K73-M77 WeakPolarHBondContact O-CG 3.3Å; K73-M77 PolarHBondContact O-N 3.34Å; L74-M77 PolarHBondContact O-N 3.36Å; L74-M77 VanDerWaalsContact O-N 3.09Å; T75-M77 VanDerWaalsContact C-N 3.28Å; T75-M77 PolarHBondContact O-N 3.35Å; M77-S79 VanDerWaalsContact C-N 3.33Å; M77-S79 PolarHBondContact O-N 2.71Å; M77-Q80 WeakPolarHBondContact O-CB 3.48Å; M77-Q80 PolarHBondContact O-N 3.28Å; M77-D81 PolarHBondContact O-N 3.49Å
78	S	91.9	Very high	91.7	Very high	57 Å²	57	99.4 Å²	99.4	40%	0.399	51%	0.509	S	S	.	.	H	α-helix	trans	-57.8	-43.5	178	-54.5	0	0	0	0	112.7	L74 T75 Q80 D81 D82	L74-S78 PolarHBondContact O-N 3.47Å; L74-S78 PolarHBondContact O-OG 2.95Å; T75-S78 PolarHBondContact O-N 2.89Å; S78-Q80 VanDerWaalsContact C-N 3.27Å; S78-Q80 PolarHBondContact O-N 3.25Å; S78-D81 PolarHBondContact O-N 3.13Å; S78-D82 PolarHBondContact O-N 3.48Å
79	S	89.4	Confident	91.3	Very high	54 Å²	54	99.5 Å²	99.5	38%	0.378	51%	0.509	S	S	.	.	H	α-helix	trans	-66.9	-26.1	177.3	-58.1	0	0	0	0	114	T75 M77 Q83	T75-S79 PolarHBondContact O-N 3.07Å; T75-S79 VanDerWaalsContact O-N 3.09Å; T75-S79 PolarHBondContact O-OG 2.9Å; M77-S79 VanDerWaalsContact C-N 3.33Å; M77-S79 PolarHBondContact O-N 2.71Å; S79-Q83 VanDerWaalsContact O-CG 3.25Å; S79-Q83 WeakPolarHBondContact O-CG 3.31Å; S79-Q83 PolarHBondContact O-N 3.22Å; S79-Q83 PolarHBondContact O-NE2 3.05Å; S79-Q83 VanDerWaalsContact O-NE2 3.15Å
80	Q	87.8	Confident	90.7	Very high	92 Å²	92	99.9 Å²	99.9	43%	0.43	51%	0.513	S	S	.	.	H	α-helix	trans	-73.6	-41.6	173.5	-78	168.9	79.5	0	0	110.7	Q76 M77 S78 D82 Q83 V84	Q76-Q80 WeakPolarHBondContact O-CG 3.29Å; Q76-Q80 PolarHBondContact O-N 2.05Å; Q76-Q80 PolarHBondContact O-NE2 2.81Å; M77-Q80 WeakPolarHBondContact O-CB 3.48Å; M77-Q80 PolarHBondContact O-N 3.28Å; S78-Q80 VanDerWaalsContact C-N 3.27Å; S78-Q80 PolarHBondContact O-N 3.25Å; Q80-D82 VanDerWaalsContact C-N 3.35Å; Q80-D82 PolarHBondContact O-N 3.43Å; Q80-Q83 PolarHBondContact O-N 3.15Å; Q80-V84 WeakPolarHBondContact O-CG2 3.31Å; Q80-V84 PolarHBondContact O-N 3.32Å
81	D	87.5	Confident	90.2	Very high	108 Å²	108	101 Å²	101	58%	0.578	52%	0.515	S	S	*	.	H	α-helix	trans	-61.9	-42.9	177.7	-64.2	-24.7	0	0	0	111.3	M77 S78 Q83 V84 M85	M77-D81 PolarHBondContact O-N 3.49Å; S78-D81 PolarHBondContact O-N 3.13Å; D81-Q83 VanDerWaalsContact C-N 3.33Å; D81-Q83 PolarHBondContact O-N 3.12Å; D81-V84 PolarHBondContact O-N 3.11Å; D81-M85 WeakPolarHBondContact O-CB 3.27Å; D81-M85 PolarHBondContact O-N 3.48Å
82	D	87.2	Confident	89.5	Confident	93 Å²	93	105.2 Å²	105.2	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-59.7	-42.1	175.1	-69.7	-31.2	0	0	0	112	S78 Q80 M85 Q86	S78-D82 PolarHBondContact O-N 3.48Å; Q80-D82 VanDerWaalsContact C-N 3.35Å; Q80-D82 PolarHBondContact O-N 3.43Å; D82-M85 PolarHBondContact O-N 2.89Å; D82-Q86 WeakPolarHBondContact O-CB 3.45Å; D82-Q86 VanDerWaalsContact O-CG 3.23Å; D82-Q86 WeakPolarHBondContact O-CG 3.03Å; D82-Q86 PolarHBondContact O-N 2.88Å
83	Q	87.4	Confident	88.7	Confident	106 Å²	106	105.5 Å²	105.5	50%	0.495	53%	0.53	S	S	.	.	H	α-helix	trans	-67.3	-39.4	178.3	-73.7	172.2	46.2	0	0	112.3	S79 Q80 D81 K87	S79-Q83 VanDerWaalsContact O-CG 3.25Å; S79-Q83 WeakPolarHBondContact O-CG 3.31Å; S79-Q83 PolarHBondContact O-N 3.22Å; S79-Q83 PolarHBondContact O-NE2 3.05Å; S79-Q83 VanDerWaalsContact O-NE2 3.15Å; Q80-Q83 PolarHBondContact O-N 3.15Å; D81-Q83 VanDerWaalsContact C-N 3.33Å; D81-Q83 PolarHBondContact O-N 3.12Å; Q83-K87 WeakPolarHBondContact O-CG 3.08Å; Q83-K87 PolarHBondContact O-N 2.8Å; Q83-K87 VanDerWaalsContact O-N 3.12Å
84	V	89.4	Confident	87.4	Confident	96 Å²	96	103.3 Å²	103.3	58%	0.582	54%	0.539	S	S	*	.	H	α-helix	trans	-66	-44.4	176.6	172.4	0	0	0	0	109.9	Q80 D81 K87 L88	Q80-V84 WeakPolarHBondContact O-CG2 3.31Å; Q80-V84 PolarHBondContact O-N 3.32Å; D81-V84 PolarHBondContact O-N 3.11Å; V84-K87 PolarHBondContact O-N 3.35Å; V84-L88 WeakPolarHBondContact O-CB 3.5Å; V84-L88 PolarHBondContact O-N 3.01Å
85	M	86.6	Confident	85.9	Confident	130 Å²	130	106.2 Å²	106.2	64%	0.64	55%	0.549	S	S	*	.	H	α-helix	trans	-65	-42.6	179.3	-170.1	163.5	-71.7	0	0	112.2	D81 D82 K87 L88 Q89	D81-M85 WeakPolarHBondContact O-CB 3.27Å; D81-M85 PolarHBondContact O-N 3.48Å; D82-M85 PolarHBondContact O-N 2.89Å; M85-K87 PolarHBondContact O-N 2.95Å; M85-L88 PolarHBondContact O-N 3.23Å; M85-Q89 WeakPolarHBondContact O-CB 3.3Å; M85-Q89 PolarHBondContact O-N 3.21Å
86	Q	87.1	Confident	83.9	Confident	116 Å²	116	110 Å²	110	54%	0.542	58%	0.579	S	S	.	*	H	α-helix	trans	-60.9	-43.2	175.3	-75.9	174.5	14	0	0	112.3	D82 Q89 Q90	D82-Q86 WeakPolarHBondContact O-CB 3.45Å; D82-Q86 VanDerWaalsContact O-CG 3.23Å; D82-Q86 WeakPolarHBondContact O-CG 3.03Å; D82-Q86 PolarHBondContact O-N 2.88Å; Q86-Q89 PolarHBondContact O-N 2.74Å; Q86-Q90 VanDerWaalsContact O-CG 3.31Å; Q86-Q90 WeakPolarHBondContact O-CG 3.27Å; Q86-Q90 PolarHBondContact O-N 3.37Å
87	K	88.1	Confident	83.3	Confident	130 Å²	130	110.1 Å²	110.1	57%	0.565	58%	0.583	S	S	*	*	H	α-helix	trans	-64.6	-41.9	176.8	-75.6	175.9	-178.5	176.6	0	111.9	Q83 V84 M85 Q90 Q91	Q83-K87 WeakPolarHBondContact O-CG 3.08Å; Q83-K87 PolarHBondContact O-N 2.8Å; Q83-K87 VanDerWaalsContact O-N 3.12Å; V84-K87 PolarHBondContact O-N 3.35Å; M85-K87 PolarHBondContact O-N 2.95Å; K87-Q90 PolarHBondContact O-N 2.89Å; K87-Q91 WeakPolarHBondContact O-CG 3.45Å; K87-Q91 PolarHBondContact O-N 2.05Å
88	L	88.4	Confident	82.9	Confident	96 Å²	96	111.1 Å²	111.1	50%	0.503	59%	0.59	S	S	.	*	H	α-helix	trans	-64.6	-41.8	177.6	-175.1	62.7	0	0	0	111.4	V84 M85 Q90 Q91 M92	V84-L88 WeakPolarHBondContact O-CB 3.5Å; V84-L88 PolarHBondContact O-N 3.01Å; M85-L88 PolarHBondContact O-N 3.23Å; L88-Q90 VanDerWaalsContact C-N 3.35Å; L88-Q90 PolarHBondContact O-N 3.48Å; L88-Q91 PolarHBondContact O-N 3.33Å; L88-M92 WeakPolarHBondContact O-CG 3.34Å; L88-M92 PolarHBondContact O-N 3.4Å
89	Q	87.3	Confident	82.4	Confident	104 Å²	104	114.1 Å²	114.1	49%	0.486	60%	0.6	S	S	.	*	H	α-helix	trans	-63.6	-39.7	177	-170	173	-1.4	0	0	112	M85 Q86 M92 Q93	M85-Q89 WeakPolarHBondContact O-CB 3.3Å; M85-Q89 PolarHBondContact O-N 3.21Å; Q86-Q89 PolarHBondContact O-N 2.74Å; Q89-M92 PolarHBondContact O-N 2.76Å; Q89-Q93 WeakPolarHBondContact O-CG 3.29Å; Q89-Q93 PolarHBondContact O-N 3.11Å
90	Q	86.8	Confident	81.9	Confident	129 Å²	129	117.6 Å²	117.6	60%	0.603	61%	0.613	S	S	*	*	H	α-helix	trans	-64.5	-38.7	174.3	-72.9	171.9	5	0	0	112.5	Q86 K87 L88 Q93 G94	Q86-Q90 VanDerWaalsContact O-CG 3.31Å; Q86-Q90 WeakPolarHBondContact O-CG 3.27Å; Q86-Q90 PolarHBondContact O-N 3.37Å; K87-Q90 PolarHBondContact O-N 2.89Å; L88-Q90 VanDerWaalsContact C-N 3.35Å; L88-Q90 PolarHBondContact O-N 3.48Å; Q90-Q93 PolarHBondContact O-N 3.3Å; Q90-G94 PolarHBondContact O-N 3.08Å; Q90-G94 VanDerWaalsContact O-N 3.09Å
91	Q	85.3	Confident	81.6	Confident	135 Å²	135	119.2 Å²	119.2	63%	0.631	63%	0.625	S	S	*	*	H	α-helix	trans	-67.1	-37.5	176.4	-74.8	-179.1	-12.1	0	0	112.6	K87 L88 G94	K87-Q91 WeakPolarHBondContact O-CG 3.45Å; K87-Q91 PolarHBondContact O-N 2.05Å; L88-Q91 PolarHBondContact O-N 3.33Å; Q91-G94 PolarHBondContact O-N 3.13Å
92	M	81.3	Confident	81.2	Confident	122 Å²	122	119.9 Å²	119.9	60%	0.601	63%	0.628	S	S	*	*	H	α-helix	trans	-69.2	-34.6	175.1	-67.8	-166.1	-59	0	0	112.5	L88 Q89	L88-M92 WeakPolarHBondContact O-CG 3.34Å; L88-M92 PolarHBondContact O-N 3.4Å; Q89-M92 PolarHBondContact O-N 2.76Å
93	Q	79.2	Confident	80.7	Confident	134 Å²	134	121.9 Å²	121.9	63%	0.626	64%	0.637	S	S	*	*	H	α-helix	trans	-72.3	-28.2	176.6	-73.5	178.5	-17.3	0	0	113.1	Q89 Q90 Q95	Q89-Q93 WeakPolarHBondContact O-CG 3.29Å; Q89-Q93 PolarHBondContact O-N 3.11Å; Q90-Q93 PolarHBondContact O-N 3.3Å; Q93-Q95 VanDerWaalsContact C-N 3.34Å
94	G	69.6	Low	80.2	Confident	62 Å²	62	123.1 Å²	123.1	64%	0.639	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	-0.6	178	0	0	0	0	0	115.8	Q90 Q91	Q90-G94 PolarHBondContact O-N 3.08Å; Q90-G94 VanDerWaalsContact O-N 3.09Å; Q91-G94 PolarHBondContact O-N 3.13Å
95	Q	61.7	Low	79.5	Confident	176 Å²	176	125.3 Å²	125.3	82%	0.822	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102	8.4	178.1	-80.2	-172	0.9	0	0	114.2	Q93	Q93-Q95 VanDerWaalsContact C-N 3.34Å
96	S	52.5	Low	78.8	Confident	170 Å²	170	124.9 Å²	124.9	100%	1.189	66%	0.655	S	S	*	*			trans	-106	0	167	-61.3	0	0	0	0	110.5

Retrieved 96 of 96 residues in 578.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).