A0A077ZD31_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZD31, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 88 aa.

						>A0A077ZD31_TRITR|A0A077ZD31
MDPHRRQVGVYLAEMINNNFDAGEQIKAIRKSIERTESYIVAITFLAYLVTGIVLLSLVCYVCARNSNIKQQRLKQHRLNACNRIVEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.6	Low	74.5	Confident	215 Å²	215	131.5 Å²	131.5	100%	1.059	64%	0.642	S	S	*	*				0	120.1	0	-84.3	-174.6	170.2	0	0	107.2
2	D	68.9	Low	74.9	Confident	111 Å²	111	128.6 Å²	128.6	59%	0.594	63%	0.631	S	S	*	*			trans	-64.4	123	-174.3	-136.9	-49.2	0	0	0	110.7	H4 R5	D2-H4 PolarHBondContact O-N 3.42Å; D2-H4 VanDerWaalsContact O-N 3.13Å; D2-R5 PolarHBondContact O-N 3.06Å; D2-R5 VanDerWaalsContact O-N 3.08Å
3	P	75.2	Confident	75.2	Confident	100 Å²	100	123 Å²	123	65%	0.649	62%	0.618	S	S	*	*	H	α-helix	trans	-55.8	-30.4	179.9	20.7	-32.5	0	0	0	112.4	R5 R6 Q7	P3-R5 VanDerWaalsContact C-N 3.34Å; P3-R5 PolarHBondContact O-N 3.46Å; P3-R6 PolarHBondContact O-N 2.96Å; P3-Q7 PolarHBondContact O-N 3.36Å; P3-Q7 VanDerWaalsContact O-N 3.14Å
4	H	75.6	Confident	75.4	Confident	127 Å²	127	122.1 Å²	122.1	59%	0.588	61%	0.611	S	S	*	*	H	α-helix	trans	-63.7	-36.3	178.8	-157.8	-36.7	0	0	0	112.9	D2 Q7 V8	D2-H4 PolarHBondContact O-N 3.42Å; D2-H4 VanDerWaalsContact O-N 3.13Å; H4-Q7 PolarHBondContact O-N 2.96Å; H4-V8 WeakPolarHBondContact O-CG2 3.41Å; H4-V8 PolarHBondContact O-N 3.43Å; H4-V8 VanDerWaalsContact O-N 3.12Å
5	R	70.1	Confident	75.3	Confident	211 Å²	211	119.5 Å²	119.5	80%	0.796	60%	0.598	S	S	*	*	H	α-helix	trans	-67.4	-36.1	176.6	-82.8	-172	162.1	-166.1	-3.8	112.1	D2 P3 G9	D2-R5 PolarHBondContact O-N 3.06Å; D2-R5 VanDerWaalsContact O-N 3.08Å; P3-R5 VanDerWaalsContact C-N 3.34Å; P3-R5 PolarHBondContact O-N 3.46Å; R5-G9 PolarHBondContact O-N 3.19Å
6	R	76.6	Confident	75.2	Confident	183 Å²	183	118.8 Å²	118.8	69%	0.691	60%	0.595	S	S	*	*	H	α-helix	trans	-65.4	-43.2	174.9	-88.8	-173.8	171.1	-170.7	-2.3	111.4	P3 G9 V10	P3-R6 PolarHBondContact O-N 2.96Å; R6-G9 PolarHBondContact O-N 3.4Å; R6-V10 WeakPolarHBondContact O-CG2 3.41Å; R6-V10 PolarHBondContact O-N 3.45Å
7	Q	82.1	Confident	75.4	Confident	142 Å²	142	118 Å²	118	66%	0.664	59%	0.593	S	S	*	*	H	α-helix	trans	-64.5	-43.4	-179.8	-169.5	174.7	7.1	0	0	112.3	P3 H4 G9 V10 Y11	P3-Q7 PolarHBondContact O-N 3.36Å; P3-Q7 VanDerWaalsContact O-N 3.14Å; H4-Q7 PolarHBondContact O-N 2.96Å; Q7-G9 VanDerWaalsContact C-N 3.34Å; Q7-G9 PolarHBondContact O-N 2.99Å; Q7-V10 PolarHBondContact O-N 3.24Å; Q7-Y11 WeakPolarHBondContact O-CB 3.4Å; Q7-Y11 PolarHBondContact O-N 3.4Å
8	V	77.7	Confident	75.5	Confident	73 Å²	73	116.5 Å²	116.5	44%	0.442	59%	0.587	S	S	.	*	H	α-helix	trans	-63.2	-41.7	175.2	177.7	0	0	0	0	110.9	H4 Y11 L12	H4-V8 WeakPolarHBondContact O-CG2 3.41Å; H4-V8 PolarHBondContact O-N 3.43Å; H4-V8 VanDerWaalsContact O-N 3.12Å; V8-Y11 PolarHBondContact O-N 3.33Å; V8-L12 VanDerWaalsContact O-CB 3.3Å; V8-L12 WeakPolarHBondContact O-CB 3.46Å; V8-L12 PolarHBondContact O-N 3.36Å
9	G	80.4	Confident	75.3	Confident	41 Å²	41	116.3 Å²	116.3	42%	0.423	59%	0.588	S	S	.	*	H	α-helix	trans	-61.4	-43.8	177.7	0	0	0	0	0	113.5	R5 R6 Q7 L12 A13	R5-G9 PolarHBondContact O-N 3.19Å; R6-G9 PolarHBondContact O-N 3.4Å; Q7-G9 VanDerWaalsContact C-N 3.34Å; Q7-G9 PolarHBondContact O-N 2.99Å; G9-L12 PolarHBondContact O-N 2.88Å; G9-A13 WeakPolarHBondContact O-CB 3.5Å; G9-A13 PolarHBondContact O-N 2.94Å
10	V	82.6	Confident	75.3	Confident	97 Å²	97	117.4 Å²	117.4	59%	0.588	59%	0.589	S	S	*	*	H	α-helix	trans	-64.1	-47.2	176.4	173.3	0	0	0	0	110.7	R6 Q7 L12 A13 E14	R6-V10 WeakPolarHBondContact O-CG2 3.41Å; R6-V10 PolarHBondContact O-N 3.45Å; Q7-V10 PolarHBondContact O-N 3.24Å; V10-L12 VanDerWaalsContact C-N 3.33Å; V10-L12 PolarHBondContact O-N 3.06Å; V10-A13 PolarHBondContact O-N 3.27Å; V10-E14 WeakPolarHBondContact O-CB 3.37Å; V10-E14 PolarHBondContact O-N 3.47Å
11	Y	76.7	Confident	75.3	Confident	146 Å²	146	115.3 Å²	115.3	57%	0.573	58%	0.58	S	S	*	*	H	α-helix	trans	-61.3	-40.8	178.9	-179.4	-112	0	0	0	112.6	Q7 V8 E14 M15	Q7-Y11 WeakPolarHBondContact O-CB 3.4Å; Q7-Y11 PolarHBondContact O-N 3.4Å; V8-Y11 PolarHBondContact O-N 3.33Å; Y11-E14 PolarHBondContact O-N 3.05Å; Y11-M15 HydrophobicContact CD1-CE 3.85Å; Y11-M15 HydrophobicContact CE1-CE 3.14Å; Y11-M15 HydrophobicContact CE2-CE 4.47Å; Y11-M15 PolarHBondContact O-N 3.25Å
12	L	79.9	Confident	76.2	Confident	97 Å²	97	107.1 Å²	107.1	51%	0.508	55%	0.546	S	S	.	.	H	α-helix	trans	-68.9	-39.2	178.5	-152.2	121.3	0	0	0	111.7	V8 G9 V10 M15 I16	V8-L12 VanDerWaalsContact O-CB 3.3Å; V8-L12 WeakPolarHBondContact O-CB 3.46Å; V8-L12 PolarHBondContact O-N 3.36Å; G9-L12 PolarHBondContact O-N 2.88Å; V10-L12 VanDerWaalsContact C-N 3.33Å; V10-L12 PolarHBondContact O-N 3.06Å; L12-M15 PolarHBondContact O-N 3.08Å; L12-I16 HydrophobicContact CD2-CD1 3.94Å; L12-I16 VanDerWaalsContact O-CG1 3.29Å; L12-I16 WeakPolarHBondContact O-CG1 3.43Å; L12-I16 PolarHBondContact O-N 3.48Å
13	A	78.6	Confident	76.4	Confident	56 Å²	56	103.2 Å²	103.2	46%	0.463	53%	0.532	S	S	.	.	H	α-helix	trans	-64.7	-40.7	174.5	0	0	0	0	0	112.1	G9 V10 I16 N17	G9-A13 WeakPolarHBondContact O-CB 3.5Å; G9-A13 PolarHBondContact O-N 2.94Å; V10-A13 PolarHBondContact O-N 3.27Å; A13-I16 PolarHBondContact O-N 3.45Å; A13-N17 WeakPolarHBondContact O-CB 3.41Å; A13-N17 PolarHBondContact O-N 2.89Å
14	E	77.6	Confident	76.5	Confident	110 Å²	110	104.1 Å²	104.1	51%	0.514	53%	0.528	S	S	.	.	H	α-helix	trans	-64.1	-42.9	176.4	-170.7	171.6	-170.7	0	0	111.7	V10 Y11 I16 N17 N18	V10-E14 WeakPolarHBondContact O-CB 3.37Å; V10-E14 PolarHBondContact O-N 3.47Å; Y11-E14 PolarHBondContact O-N 3.05Å; E14-I16 PolarHBondContact O-N 3.41Å; E14-N17 PolarHBondContact O-N 3.3Å; E14-N18 WeakPolarHBondContact O-CB 3.49Å; E14-N18 VanDerWaalsContact O-CG 3.28Å; E14-N18 PolarHBondContact O-N 2.85Å
15	M	73.5	Confident	76.5	Confident	84 Å²	84	103 Å²	103	41%	0.414	52%	0.522	S	S	.	.	H	α-helix	trans	-61.6	-41.8	173.7	-106.9	-156.7	-89.2	0	0	113	Y11 L12 N19	Y11-M15 HydrophobicContact CD1-CE 3.85Å; Y11-M15 HydrophobicContact CE1-CE 3.14Å; Y11-M15 HydrophobicContact CE2-CE 4.47Å; Y11-M15 PolarHBondContact O-N 3.25Å; L12-M15 PolarHBondContact O-N 3.08Å; M15-N19 WeakPolarHBondContact O-CB 3.46Å; M15-N19 PolarHBondContact O-N 2.96Å; M15-N19 VanDerWaalsContact O-N 3.08Å; M15-N19 PolarHBondContact O-ND2 3.08Å
16	I	74.8	Confident	76.7	Confident	107 Å²	107	98 Å²	98	55%	0.549	51%	0.511	S	S	.	.	H	α-helix	trans	-63.7	-44.7	176.4	-69.5	167.2	0	0	0	110.2	L12 A13 E14 N19 F20	L12-I16 HydrophobicContact CD2-CD1 3.94Å; L12-I16 VanDerWaalsContact O-CG1 3.29Å; L12-I16 WeakPolarHBondContact O-CG1 3.43Å; L12-I16 PolarHBondContact O-N 3.48Å; A13-I16 PolarHBondContact O-N 3.45Å; E14-I16 PolarHBondContact O-N 3.41Å; I16-N19 PolarHBondContact O-N 3.46Å; I16-F20 VanDerWaalsContact O-CB 3.27Å; I16-F20 WeakPolarHBondContact O-CB 3.38Å; I16-F20 PolarHBondContact O-N 3.46Å
17	N	78.7	Confident	76.6	Confident	106 Å²	106	96.9 Å²	96.9	57%	0.567	51%	0.511	S	S	*	.	H	α-helix	trans	-64.1	-45.7	-179.3	-165.4	35.5	0	0	0	111.9	A13 E14 N19 F20 D21	A13-N17 WeakPolarHBondContact O-CB 3.41Å; A13-N17 PolarHBondContact O-N 2.89Å; E14-N17 PolarHBondContact O-N 3.3Å; N17-N19 PolarHBondContact O-N 3.19Å; N17-F20 PolarHBondContact O-N 3.33Å; N17-D21 WeakPolarHBondContact O-CB 3.39Å; N17-D21 PolarHBondContact O-N 3.02Å
18	N	76	Confident	76.3	Confident	91 Å²	91	93 Å²	93	49%	0.487	50%	0.503	S	S	.	.	H	α-helix	trans	-63.9	-39.6	178.8	-70.7	-12.8	0	0	0	112.1	E14 A22	E14-N18 WeakPolarHBondContact O-CB 3.49Å; E14-N18 VanDerWaalsContact O-CG 3.28Å; E14-N18 PolarHBondContact O-N 2.85Å; N18-A22 WeakPolarHBondContact O-CB 3.45Å; N18-A22 PolarHBondContact O-N 3.47Å
19	N	73	Confident	76	Confident	112 Å²	112	94.1 Å²	94.1	60%	0.599	51%	0.506	S	S	*	.	H	α-helix	trans	-72.4	-32.6	176.4	-74.6	-31.4	0	0	0	112.6	M15 I16 N17 G23	M15-N19 WeakPolarHBondContact O-CB 3.46Å; M15-N19 PolarHBondContact O-N 2.96Å; M15-N19 VanDerWaalsContact O-N 3.08Å; M15-N19 PolarHBondContact O-ND2 3.08Å; I16-N19 PolarHBondContact O-N 3.46Å; N17-N19 PolarHBondContact O-N 3.19Å; N19-G23 PolarHBondContact O-N 2.88Å
20	F	73.6	Confident	75.6	Confident	138 Å²	138	100.1 Å²	100.1	61%	0.605	52%	0.515	S	S	*	.	H	α-helix	trans	-67.2	-46.7	175.2	-173.2	-92	0	0	0	111.1	I16 N17 G23 E24	I16-F20 VanDerWaalsContact O-CB 3.27Å; I16-F20 WeakPolarHBondContact O-CB 3.38Å; I16-F20 PolarHBondContact O-N 3.46Å; N17-F20 PolarHBondContact O-N 3.33Å; F20-G23 PolarHBondContact O-N 3.28Å; F20-G23 VanDerWaalsContact O-N 3.16Å; F20-E24 PolarHBondContact O-N 3.29Å
21	D	75.2	Confident	75.3	Confident	75 Å²	75	101.3 Å²	101.3	40%	0.401	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-45.3	175.2	-174.2	17.3	0	0	0	111.2	N17 G23 E24 Q25	N17-D21 WeakPolarHBondContact O-CB 3.39Å; N17-D21 PolarHBondContact O-N 3.02Å; D21-G23 VanDerWaalsContact C-N 3.29Å; D21-G23 PolarHBondContact O-N 2.87Å; D21-E24 PolarHBondContact O-N 3.06Å; D21-E24 VanDerWaalsContact O-N 3.12Å; D21-Q25 VanDerWaalsContact CG-NE2 3.25Å; D21-Q25 WeakPolarHBondContact O-CB 3.35Å; D21-Q25 WeakPolarHBondContact O-CG 3.36Å; D21-Q25 PolarHBondContact O-N 3.38Å; D21-Q25 PolarHBondContact OD1-NE2 3.5Å; D21-Q25 PolarHBondContact OD2-NE2 2.93Å
22	A	72.4	Confident	74.8	Confident	42 Å²	42	97.2 Å²	97.2	35%	0.347	51%	0.506	S	S	.	.	H	α-helix	trans	-58.5	-40.7	173	0	0	0	0	0	112.4	N18 Q25 I26	N18-A22 WeakPolarHBondContact O-CB 3.45Å; N18-A22 PolarHBondContact O-N 3.47Å; A22-Q25 PolarHBondContact O-N 2.85Å; A22-I26 WeakPolarHBondContact O-CB 3.35Å; A22-I26 WeakPolarHBondContact O-CD1 3.45Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.47Å; A22-I26 PolarHBondContact O-N 3.44Å
23	G	73.3	Confident	74.3	Confident	30 Å²	30	96.5 Å²	96.5	31%	0.309	50%	0.501	S	S	.	.	H	α-helix	trans	-64.5	-38.1	175.2	0	0	0	0	0	113.3	N19 F20 D21 K27	N19-G23 PolarHBondContact O-N 2.88Å; F20-G23 PolarHBondContact O-N 3.28Å; F20-G23 VanDerWaalsContact O-N 3.16Å; D21-G23 VanDerWaalsContact C-N 3.29Å; D21-G23 PolarHBondContact O-N 2.87Å; G23-K27 WeakPolarHBondContact O-CG 3.42Å; G23-K27 PolarHBondContact O-N 3.36Å
24	E	78	Confident	73.9	Confident	118 Å²	118	99.5 Å²	99.5	55%	0.551	51%	0.506	S	S	*	.	H	α-helix	trans	-69.9	-43	175.7	-166.9	173.2	177.6	0	0	111.6	F20 D21 I26 K27 A28	F20-E24 PolarHBondContact O-N 3.29Å; D21-E24 PolarHBondContact O-N 3.06Å; D21-E24 VanDerWaalsContact O-N 3.12Å; E24-I26 PolarHBondContact O-N 2.94Å; E24-K27 WeakPolarHBondContact O-CB 3.44Å; E24-K27 PolarHBondContact O-N 3.35Å; E24-A28 PolarHBondContact O-N 3.47Å
25	Q	75.1	Confident	73.5	Confident	103 Å²	103	101.1 Å²	101.1	48%	0.481	51%	0.507	S	S	.	.	H	α-helix	trans	-61.3	-44.4	175	-71	179.8	40.3	0	0	112	D21 A22 K27 A28 I29	D21-Q25 VanDerWaalsContact CG-NE2 3.25Å; D21-Q25 WeakPolarHBondContact O-CB 3.35Å; D21-Q25 WeakPolarHBondContact O-CG 3.36Å; D21-Q25 PolarHBondContact O-N 3.38Å; D21-Q25 PolarHBondContact OD1-NE2 3.5Å; D21-Q25 PolarHBondContact OD2-NE2 2.93Å; A22-Q25 PolarHBondContact O-N 2.85Å; Q25-K27 VanDerWaalsContact C-N 3.3Å; Q25-K27 PolarHBondContact O-N 3.42Å; Q25-A28 PolarHBondContact O-N 3.43Å; Q25-I29 VanDerWaalsContact O-CG1 3.3Å; Q25-I29 WeakPolarHBondContact O-CG1 3.36Å; Q25-I29 PolarHBondContact O-N 2.96Å
26	I	74.3	Confident	73.6	Confident	107 Å²	107	100.4 Å²	100.4	55%	0.549	51%	0.508	S	S	.	.	H	α-helix	trans	-61.3	-39.8	175.9	-69.3	165.6	0	0	0	111	A22 E24 R30	A22-I26 WeakPolarHBondContact O-CB 3.35Å; A22-I26 WeakPolarHBondContact O-CD1 3.45Å; A22-I26 VanDerWaalsContact O-CG1 3.23Å; A22-I26 WeakPolarHBondContact O-CG1 3.47Å; A22-I26 PolarHBondContact O-N 3.44Å; E24-I26 PolarHBondContact O-N 2.94Å; I26-R30 WeakPolarHBondContact O-CB 3.44Å; I26-R30 PolarHBondContact O-N 3.02Å
27	K	74.3	Confident	73.6	Confident	159 Å²	159	101.2 Å²	101.2	69%	0.691	51%	0.509	S	S	*	.	H	α-helix	trans	-66	-40.9	175.1	-74.9	174.5	-175.7	175.1	0	112	G23 E24 Q25 R30 K31	G23-K27 WeakPolarHBondContact O-CG 3.42Å; G23-K27 PolarHBondContact O-N 3.36Å; E24-K27 WeakPolarHBondContact O-CB 3.44Å; E24-K27 PolarHBondContact O-N 3.35Å; Q25-K27 VanDerWaalsContact C-N 3.3Å; Q25-K27 PolarHBondContact O-N 3.42Å; K27-R30 PolarHBondContact O-N 3.28Å; K27-K31 WeakPolarHBondContact O-CB 3.45Å; K27-K31 PolarHBondContact O-N 3.37Å
28	A	76.8	Confident	73.5	Confident	60 Å²	60	99.5 Å²	99.5	50%	0.496	51%	0.506	S	S	.	.	H	α-helix	trans	-64.6	-42.8	177.5	0	0	0	0	0	111.9	E24 Q25 K31 S32	E24-A28 PolarHBondContact O-N 3.47Å; Q25-A28 PolarHBondContact O-N 3.43Å; A28-K31 PolarHBondContact O-N 3.38Å; A28-S32 PolarHBondContact O-N 2.88Å
29	I	70.8	Confident	73.8	Confident	98 Å²	98	102.3 Å²	102.3	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-44.4	175	-65.6	168.9	0	0	0	110.6	Q25 K31 S32 I33	Q25-I29 VanDerWaalsContact O-CG1 3.3Å; Q25-I29 WeakPolarHBondContact O-CG1 3.36Å; Q25-I29 PolarHBondContact O-N 2.96Å; I29-K31 VanDerWaalsContact C-N 3.32Å; I29-K31 PolarHBondContact O-N 3.22Å; I29-S32 PolarHBondContact O-N 2.87Å; I29-S32 PolarHBondContact O-OG 3.41Å; I29-I33 HydrophobicContact CG2-CD1 3.77Å; I29-I33 HydrophobicContact CG2-CG1 4.35Å; I29-I33 VanDerWaalsContact O-CG1 3.29Å; I29-I33 WeakPolarHBondContact O-CG1 3.3Å; I29-I33 PolarHBondContact O-N 3.26Å
30	R	73.1	Confident	74.4	Confident	166 Å²	166	101.9 Å²	101.9	63%	0.626	51%	0.507	S	S	*	.	H	α-helix	trans	-59.2	-45.5	175.9	-175.2	-179.1	-67	-164.5	-2.1	111.4	I26 K27 S32 I33 E34	I26-R30 WeakPolarHBondContact O-CB 3.44Å; I26-R30 PolarHBondContact O-N 3.02Å; K27-R30 PolarHBondContact O-N 3.28Å; R30-S32 VanDerWaalsContact C-N 3.3Å; R30-S32 PolarHBondContact O-N 3.42Å; R30-I33 PolarHBondContact O-N 3.28Å; R30-E34 WeakPolarHBondContact O-CG 3.32Å; R30-E34 PolarHBondContact O-N 2.9Å
31	K	75.2	Confident	75.1	Confident	122 Å²	122	100 Å²	100	53%	0.53	51%	0.506	S	S	.	.	H	α-helix	trans	-64.4	-32.6	178.4	-170.9	175.5	-175.7	176.1	0	112.7	K27 A28 I29 R35	K27-K31 WeakPolarHBondContact O-CB 3.45Å; K27-K31 PolarHBondContact O-N 3.37Å; A28-K31 PolarHBondContact O-N 3.38Å; I29-K31 VanDerWaalsContact C-N 3.32Å; I29-K31 PolarHBondContact O-N 3.22Å; K31-R35 WeakPolarHBondContact O-CG 3.44Å; K31-R35 PolarHBondContact O-N 3.33Å
32	S	67.1	Low	75.7	Confident	61 Å²	61	98.7 Å²	98.7	43%	0.427	51%	0.506	S	S	.	.	H	α-helix	trans	-74.2	-38.7	174.5	67.9	0	0	0	0	111.7	A28 I29 R30 R35 T36	A28-S32 PolarHBondContact O-N 2.88Å; I29-S32 PolarHBondContact O-N 2.87Å; I29-S32 PolarHBondContact O-OG 3.41Å; R30-S32 VanDerWaalsContact C-N 3.3Å; R30-S32 PolarHBondContact O-N 3.42Å; S32-R35 WeakPolarHBondContact O-CB 3.3Å; S32-R35 PolarHBondContact O-N 2.94Å; S32-T36 WeakPolarHBondContact O-CG2 3.46Å; S32-T36 PolarHBondContact O-N 3.4Å
33	I	68.4	Low	76.6	Confident	82 Å²	82	102 Å²	102	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-60.9	-48.2	174.3	-67.9	167.6	0	0	0	110.9	I29 R30 R35 T36 E37	I29-I33 HydrophobicContact CG2-CD1 3.77Å; I29-I33 HydrophobicContact CG2-CG1 4.35Å; I29-I33 VanDerWaalsContact O-CG1 3.29Å; I29-I33 WeakPolarHBondContact O-CG1 3.3Å; I29-I33 PolarHBondContact O-N 3.26Å; R30-I33 PolarHBondContact O-N 3.28Å; I33-R35 PolarHBondContact O-N 3.44Å; I33-T36 VanDerWaalsContact CA-OG1 3.31Å; I33-T36 WeakPolarHBondContact CA-OG1 3.29Å; I33-T36 WeakPolarHBondContact O-CA 3.33Å; I33-T36 PolarHBondContact O-N 2.92Å; I33-T36 PolarHBondContact O-OG1 3.35Å; I33-E37 PolarHBondContact O-N 3.46Å
34	E	71	Confident	77.4	Confident	118 Å²	118	103.6 Å²	103.6	55%	0.551	52%	0.521	S	S	*	.	H	α-helix	trans	-56.5	-38.4	177.2	-75.2	171.2	-173.5	0	0	112.1	R30	R30-E34 WeakPolarHBondContact O-CG 3.32Å; R30-E34 PolarHBondContact O-N 2.9Å
35	R	68.3	Low	78.1	Confident	145 Å²	145	104 Å²	104	55%	0.547	52%	0.521	S	S	.	.	H	α-helix	trans	-65.5	-45.8	172	-72.6	-176.9	-163.9	172.2	0.9	111.4	K31 S32 I33 E37 S38 Y39	K31-R35 WeakPolarHBondContact O-CG 3.44Å; K31-R35 PolarHBondContact O-N 3.33Å; S32-R35 WeakPolarHBondContact O-CB 3.3Å; S32-R35 PolarHBondContact O-N 2.94Å; I33-R35 PolarHBondContact O-N 3.44Å; R35-E37 VanDerWaalsContact C-N 3.3Å; R35-E37 PolarHBondContact O-N 2.97Å; R35-S38 PolarHBondContact O-N 2.95Å; R35-S38 PolarHBondContact O-OG 3.46Å; R35-Y39 HydrophobicContact CB-CD2 4.41Å; R35-Y39 HydrophobicContact CB-CE2 4.17Å; R35-Y39 WeakPolarHBondContact O-CD2 3.3Å; R35-Y39 PolarHBondContact O-N 2.92Å
36	T	76.6	Confident	79	Confident	69 Å²	69	104.1 Å²	104.1	42%	0.423	52%	0.524	S	S	.	.	H	α-helix	trans	-60.9	-36.4	-178.3	55.3	0	0	0	0	113.2	S32 I33 S38 Y39 I40	S32-T36 WeakPolarHBondContact O-CG2 3.46Å; S32-T36 PolarHBondContact O-N 3.4Å; I33-T36 VanDerWaalsContact CA-OG1 3.31Å; I33-T36 WeakPolarHBondContact CA-OG1 3.29Å; I33-T36 WeakPolarHBondContact O-CA 3.33Å; I33-T36 PolarHBondContact O-N 2.92Å; I33-T36 PolarHBondContact O-OG1 3.35Å; T36-S38 PolarHBondContact O-N 3.29Å; T36-Y39 PolarHBondContact O-N 2.9Å; T36-I40 VanDerWaalsContact O-CG1 3.25Å; T36-I40 WeakPolarHBondContact O-CG1 3.45Å; T36-I40 PolarHBondContact O-N 2.92Å
37	E	74.2	Confident	79.9	Confident	123 Å²	123	101.4 Å²	101.4	58%	0.575	52%	0.518	S	S	*	.	H	α-helix	trans	-59.9	-46.2	177	-70	-178.1	165.8	0	0	111.4	I33 R35 Y39 I40 V41	I33-E37 PolarHBondContact O-N 3.46Å; R35-E37 VanDerWaalsContact C-N 3.3Å; R35-E37 PolarHBondContact O-N 2.97Å; E37-Y39 VanDerWaalsContact C-N 3.33Å; E37-Y39 PolarHBondContact O-N 3.39Å; E37-I40 PolarHBondContact O-N 3.45Å; E37-V41 WeakPolarHBondContact O-CG2 3.36Å; E37-V41 PolarHBondContact O-N 3.39Å
38	S	77.6	Confident	80.9	Confident	71 Å²	71	102.3 Å²	102.3	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-39.1	176.7	72.4	0	0	0	0	112.8	R35 T36 V41 A42	R35-S38 PolarHBondContact O-N 2.95Å; R35-S38 PolarHBondContact O-OG 3.46Å; T36-S38 PolarHBondContact O-N 3.29Å; S38-V41 PolarHBondContact O-N 2.95Å; S38-A42 WeakPolarHBondContact O-CB 3.39Å; S38-A42 PolarHBondContact O-N 3.38Å
39	Y	82.5	Confident	81.8	Confident	150 Å²	150	103.5 Å²	103.5	59%	0.588	52%	0.516	S	S	*	.	H	α-helix	trans	-67.6	-40.5	177	-74.4	-65.9	0	0	0	112.2	R35 T36 E37 A42 I43	R35-Y39 HydrophobicContact CB-CD2 4.41Å; R35-Y39 HydrophobicContact CB-CE2 4.17Å; R35-Y39 WeakPolarHBondContact O-CD2 3.3Å; R35-Y39 PolarHBondContact O-N 2.92Å; T36-Y39 PolarHBondContact O-N 2.9Å; E37-Y39 VanDerWaalsContact C-N 3.33Å; E37-Y39 PolarHBondContact O-N 3.39Å; Y39-A42 PolarHBondContact O-N 2.98Å; Y39-I43 WeakPolarHBondContact O-CB 3.48Å; Y39-I43 WeakPolarHBondContact O-CD1 3.04Å; Y39-I43 WeakPolarHBondContact O-CG1 3.29Å; Y39-I43 PolarHBondContact O-N 3.4Å
40	I	85.6	Confident	83.1	Confident	102 Å²	102	103 Å²	103	52%	0.523	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-44.2	177.7	-68.8	163.5	0	0	0	110.3	T36 E37 A42 I43 T44	T36-I40 VanDerWaalsContact O-CG1 3.25Å; T36-I40 WeakPolarHBondContact O-CG1 3.45Å; T36-I40 PolarHBondContact O-N 2.92Å; E37-I40 PolarHBondContact O-N 3.45Å; I40-A42 PolarHBondContact O-N 3.26Å; I40-I43 PolarHBondContact O-N 3.31Å; I40-T44 HydrophobicContact CG2-CG2 4.45Å; I40-T44 WeakPolarHBondContact O-CB 3.5Å; I40-T44 WeakPolarHBondContact O-CG2 3.32Å; I40-T44 PolarHBondContact O-N 2.9Å; I40-T44 PolarHBondContact O-OG1 3.42Å
41	V	87.6	Confident	84.1	Confident	98 Å²	98	99 Å²	99	59%	0.594	51%	0.511	S	S	*	.	H	α-helix	trans	-62.6	-43.1	176.1	175.2	0	0	0	0	111.1	E37 S38 T44 F45	E37-V41 WeakPolarHBondContact O-CG2 3.36Å; E37-V41 PolarHBondContact O-N 3.39Å; S38-V41 PolarHBondContact O-N 2.95Å; V41-T44 WeakPolarHBondContact CA-OG1 3.38Å; V41-T44 PolarHBondContact O-N 2.77Å; V41-T44 PolarHBondContact O-OG1 3.28Å; V41-F45 VanDerWaalsContact O-CB 3.32Å; V41-F45 WeakPolarHBondContact O-CB 3.48Å; V41-F45 PolarHBondContact O-N 3.01Å
42	A	87.4	Confident	85	Confident	48 Å²	48	94.5 Å²	94.5	40%	0.397	50%	0.5	S	S	.	.	H	α-helix	trans	-63.7	-43.6	177.2	0	0	0	0	0	112.5	S38 Y39 I40 F45 L46	S38-A42 WeakPolarHBondContact O-CB 3.39Å; S38-A42 PolarHBondContact O-N 3.38Å; Y39-A42 PolarHBondContact O-N 2.98Å; I40-A42 PolarHBondContact O-N 3.26Å; A42-F45 PolarHBondContact O-N 3.28Å; A42-L46 WeakPolarHBondContact O-CG 3.33Å; A42-L46 PolarHBondContact O-N 2.97Å
43	I	91.1	Very high	86.5	Confident	111 Å²	111	96.7 Å²	96.7	57%	0.569	51%	0.506	S	S	*	.	H	α-helix	trans	-65.1	-45	179	-69.7	165.1	0	0	0	110.9	Y39 I40 L46 A47	Y39-I43 WeakPolarHBondContact O-CB 3.48Å; Y39-I43 WeakPolarHBondContact O-CD1 3.04Å; Y39-I43 WeakPolarHBondContact O-CG1 3.29Å; Y39-I43 PolarHBondContact O-N 3.4Å; I40-I43 PolarHBondContact O-N 3.31Å; I43-L46 PolarHBondContact O-N 2.88Å; I43-A47 WeakPolarHBondContact O-CB 3.38Å; I43-A47 PolarHBondContact O-N 2.97Å
44	T	90.6	Very high	87.8	Confident	65 Å²	65	97.1 Å²	97.1	40%	0.399	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-42	177.5	49.7	0	0	0	0	111.4	I40 V41 L46 A47 Y48	I40-T44 HydrophobicContact CG2-CG2 4.45Å; I40-T44 WeakPolarHBondContact O-CB 3.5Å; I40-T44 WeakPolarHBondContact O-CG2 3.32Å; I40-T44 PolarHBondContact O-N 2.9Å; I40-T44 PolarHBondContact O-OG1 3.42Å; V41-T44 WeakPolarHBondContact CA-OG1 3.38Å; V41-T44 PolarHBondContact O-N 2.77Å; V41-T44 PolarHBondContact O-OG1 3.28Å; T44-L46 PolarHBondContact O-N 3.26Å; T44-A47 WeakPolarHBondContact O-CB 3.35Å; T44-A47 PolarHBondContact O-N 3.5Å; T44-Y48 WeakPolarHBondContact O-CD2 3.32Å; T44-Y48 PolarHBondContact O-N 2.99Å
45	F	92.1	Very high	89.1	Confident	127 Å²	127	96.2 Å²	96.2	56%	0.557	51%	0.51	S	S	*	.	H	α-helix	trans	-59.8	-46.1	174	-176.4	-104.7	0	0	0	112.3	V41 A42 A47 Y48 L49	V41-F45 VanDerWaalsContact O-CB 3.32Å; V41-F45 WeakPolarHBondContact O-CB 3.48Å; V41-F45 PolarHBondContact O-N 3.01Å; A42-F45 PolarHBondContact O-N 3.28Å; F45-A47 VanDerWaalsContact C-N 3.34Å; F45-A47 PolarHBondContact O-N 3.02Å; F45-Y48 PolarHBondContact O-N 2.91Å; F45-L49 HydrophobicContact CD1-CD1 3.92Å; F45-L49 HydrophobicContact CD1-CG 4.42Å; F45-L49 HydrophobicContact CE1-CD1 3.47Å; F45-L49 VanDerWaalsContact CE1-CD1 3.47Å; F45-L49 HydrophobicContact CE1-CG 4.1Å; F45-L49 HydrophobicContact CZ-CD1 4.02Å; F45-L49 HydrophobicContact CZ-CD2 4.34Å; F45-L49 HydrophobicContact CZ-CG 4.26Å; F45-L49 WeakPolarHBondContact O-CG 3.47Å; F45-L49 PolarHBondContact O-N 2.87Å
46	L	94.3	Very high	90.4	Very high	104 Å²	104	95 Å²	95	55%	0.545	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-41	175.5	-73.4	172.2	0	0	0	112.2	A42 I43 T44 L49 V50	A42-L46 WeakPolarHBondContact O-CG 3.33Å; A42-L46 PolarHBondContact O-N 2.97Å; I43-L46 PolarHBondContact O-N 2.88Å; T44-L46 PolarHBondContact O-N 3.26Å; L46-L49 PolarHBondContact O-N 3.5Å; L46-V50 WeakPolarHBondContact O-CG2 3.4Å; L46-V50 PolarHBondContact O-N 3.26Å
47	A	94.3	Very high	91.3	Very high	50 Å²	50	95 Å²	95	41%	0.413	52%	0.517	S	S	.	.	H	α-helix	trans	-60.3	-46	175.8	0	0	0	0	0	111.4	I43 T44 F45 L49 V50 T51	I43-A47 WeakPolarHBondContact O-CB 3.38Å; I43-A47 PolarHBondContact O-N 2.97Å; T44-A47 WeakPolarHBondContact O-CB 3.35Å; T44-A47 PolarHBondContact O-N 3.5Å; F45-A47 VanDerWaalsContact C-N 3.34Å; F45-A47 PolarHBondContact O-N 3.02Å; A47-L49 VanDerWaalsContact C-N 3.34Å; A47-L49 PolarHBondContact O-N 2.92Å; A47-V50 PolarHBondContact O-N 3.45Å; A47-T51 PolarHBondContact O-N 3.42Å; A47-T51 PolarHBondContact O-OG1 2.96Å
48	Y	95	Very high	92.4	Very high	179 Å²	179	93.9 Å²	93.9	70%	0.702	51%	0.514	S	S	*	.	H	α-helix	trans	-61.6	-39.5	176.1	-74.3	-59.9	0	0	0	112.9	T44 F45 G52	T44-Y48 WeakPolarHBondContact O-CD2 3.32Å; T44-Y48 PolarHBondContact O-N 2.99Å; F45-Y48 PolarHBondContact O-N 2.91Å; Y48-G52 PolarHBondContact O-N 2.88Å
49	L	95.9	Very high	93.3	Very high	84 Å²	84	94.7 Å²	94.7	44%	0.44	52%	0.516	S	S	.	.	H	α-helix	trans	-62.3	-47	174.6	-72.5	178.6	0	0	0	111.7	F45 L46 A47 G52 I53	F45-L49 HydrophobicContact CD1-CD1 3.92Å; F45-L49 HydrophobicContact CD1-CG 4.42Å; F45-L49 HydrophobicContact CE1-CD1 3.47Å; F45-L49 VanDerWaalsContact CE1-CD1 3.47Å; F45-L49 HydrophobicContact CE1-CG 4.1Å; F45-L49 HydrophobicContact CZ-CD1 4.02Å; F45-L49 HydrophobicContact CZ-CD2 4.34Å; F45-L49 HydrophobicContact CZ-CG 4.26Å; F45-L49 WeakPolarHBondContact O-CG 3.47Å; F45-L49 PolarHBondContact O-N 2.87Å; L46-L49 PolarHBondContact O-N 3.5Å; A47-L49 VanDerWaalsContact C-N 3.34Å; A47-L49 PolarHBondContact O-N 2.92Å; L49-G52 PolarHBondContact O-N 3.39Å; L49-I53 VanDerWaalsContact O-CG1 3.29Å; L49-I53 WeakPolarHBondContact O-CG1 3.34Å; L49-I53 PolarHBondContact O-N 2.9Å
50	V	96.3	Very high	94	Very high	89 Å²	89	91.5 Å²	91.5	54%	0.539	52%	0.515	S	S	.	.	H	α-helix	trans	-62.5	-47.7	178.7	172.7	0	0	0	0	110.8	L46 A47 G52 I53 V54	L46-V50 WeakPolarHBondContact O-CG2 3.4Å; L46-V50 PolarHBondContact O-N 3.26Å; A47-V50 PolarHBondContact O-N 3.45Å; V50-G52 VanDerWaalsContact C-N 3.31Å; V50-G52 PolarHBondContact O-N 2.95Å; V50-I53 PolarHBondContact O-N 3.31Å; V50-V54 HydrophobicContact CG1-CG2 4.43Å; V50-V54 VanDerWaalsContact O-CG2 3.32Å; V50-V54 WeakPolarHBondContact O-CG2 3.33Å; V50-V54 PolarHBondContact O-N 3.06Å
51	T	94.9	Very high	94.6	Very high	80 Å²	80	93.6 Å²	93.6	49%	0.491	52%	0.517	S	S	.	.	H	α-helix	trans	-59.5	-42.5	176.6	-56.4	0	0	0	0	111.5	A47 V54 L55	A47-T51 PolarHBondContact O-N 3.42Å; A47-T51 PolarHBondContact O-OG1 2.96Å; T51-V54 PolarHBondContact O-N 3.49Å; T51-L55 HydrophobicContact CG2-CD1 4.03Å; T51-L55 HydrophobicContact CG2-CG 4.43Å; T51-L55 WeakPolarHBondContact O-CB 3.44Å; T51-L55 VanDerWaalsContact O-CG 3.29Å; T51-L55 WeakPolarHBondContact O-CG 3.47Å; T51-L55 PolarHBondContact O-N 3.41Å
52	G	95.2	Very high	95	Very high	29 Å²	29	92.2 Å²	92.2	30%	0.299	51%	0.508	S	S	.	.	H	α-helix	trans	-59.9	-45.5	175.8	0	0	0	0	0	113.1	Y48 L49 V50 L55 L56	Y48-G52 PolarHBondContact O-N 2.88Å; L49-G52 PolarHBondContact O-N 3.39Å; V50-G52 VanDerWaalsContact C-N 3.31Å; V50-G52 PolarHBondContact O-N 2.95Å; G52-L55 PolarHBondContact O-N 3.18Å; G52-L56 WeakPolarHBondContact O-CG 3.48Å; G52-L56 PolarHBondContact O-N 3.3Å
53	I	96.9	Very high	95.4	Very high	107 Å²	107	93.5 Å²	93.5	55%	0.549	51%	0.514	S	S	.	.	H	α-helix	trans	-63.8	-43.4	177.9	-68.1	162.6	0	0	0	111.3	L49 V50 L56 S57	L49-I53 VanDerWaalsContact O-CG1 3.29Å; L49-I53 WeakPolarHBondContact O-CG1 3.34Å; L49-I53 PolarHBondContact O-N 2.9Å; V50-I53 PolarHBondContact O-N 3.31Å; I53-L56 PolarHBondContact O-N 3.02Å; I53-S57 WeakPolarHBondContact O-CB 3.21Å; I53-S57 PolarHBondContact O-N 2.91Å; I53-S57 PolarHBondContact O-OG 2.72Å
54	V	97.2	Very high	95.5	Very high	90 Å²	90	90.6 Å²	90.6	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-62.8	-44.6	178.2	171.1	0	0	0	0	110.6	V50 T51 S57 L58	V50-V54 HydrophobicContact CG1-CG2 4.43Å; V50-V54 VanDerWaalsContact O-CG2 3.32Å; V50-V54 WeakPolarHBondContact O-CG2 3.33Å; V50-V54 PolarHBondContact O-N 3.06Å; T51-V54 PolarHBondContact O-N 3.49Å; V54-S57 PolarHBondContact O-N 3.35Å; V54-L58 WeakPolarHBondContact O-CB 3.31Å; V54-L58 PolarHBondContact O-N 2.66Å
55	L	96.6	Very high	95.7	Very high	99 Å²	99	94.5 Å²	94.5	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-62.9	-47	177.7	-74.1	171.9	0	0	0	112	T51 G52 S57 L58 V59	T51-L55 HydrophobicContact CG2-CD1 4.03Å; T51-L55 HydrophobicContact CG2-CG 4.43Å; T51-L55 WeakPolarHBondContact O-CB 3.44Å; T51-L55 VanDerWaalsContact O-CG 3.29Å; T51-L55 WeakPolarHBondContact O-CG 3.47Å; T51-L55 PolarHBondContact O-N 3.41Å; G52-L55 PolarHBondContact O-N 3.18Å; L55-S57 VanDerWaalsContact C-N 3.34Å; L55-S57 PolarHBondContact O-N 3.21Å; L55-L58 PolarHBondContact O-N 3.25Å; L55-V59 WeakPolarHBondContact O-CG2 3.49Å; L55-V59 PolarHBondContact O-N 3.45Å
56	L	96.4	Very high	95.8	Very high	120 Å²	120	92.6 Å²	92.6	63%	0.628	51%	0.509	S	S	*	.	H	α-helix	trans	-60.5	-44	176.6	-74.8	170.4	0	0	0	111.7	G52 I53 L58 V59 C60	G52-L56 WeakPolarHBondContact O-CG 3.48Å; G52-L56 PolarHBondContact O-N 3.3Å; I53-L56 PolarHBondContact O-N 3.02Å; L56-L58 VanDerWaalsContact C-N 3.34Å; L56-L58 PolarHBondContact O-N 3.3Å; L56-V59 PolarHBondContact O-N 3.5Å; L56-C60 WeakPolarHBondContact O-CB 3.25Å; L56-C60 PolarHBondContact O-N 3.24Å; L56-C60 PolarHBondContact O-SG 2.98Å; L56-C60 VanDerWaalsContact O-SG 3.33Å
57	S	96.2	Very high	95.6	Very high	69 Å²	69	90.3 Å²	90.3	48%	0.483	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-41.9	177.7	-57.8	0	0	0	0	111.7	I53 V54 L55 C60 Y61	I53-S57 WeakPolarHBondContact O-CB 3.21Å; I53-S57 PolarHBondContact O-N 2.91Å; I53-S57 PolarHBondContact O-OG 2.72Å; V54-S57 PolarHBondContact O-N 3.35Å; L55-S57 VanDerWaalsContact C-N 3.34Å; L55-S57 PolarHBondContact O-N 3.21Å; S57-C60 PolarHBondContact O-N 2.91Å; S57-Y61 WeakPolarHBondContact O-CB 3.43Å; S57-Y61 PolarHBondContact O-N 3Å
58	L	97.1	Very high	95.5	Very high	100 Å²	100	92.2 Å²	92.2	52%	0.524	51%	0.506	S	S	.	.	H	α-helix	trans	-63.7	-45.7	177	-176.6	67.7	0	0	0	111.5	V54 L55 L56 Y61 V62	V54-L58 WeakPolarHBondContact O-CB 3.31Å; V54-L58 PolarHBondContact O-N 2.66Å; L55-L58 PolarHBondContact O-N 3.25Å; L56-L58 VanDerWaalsContact C-N 3.34Å; L56-L58 PolarHBondContact O-N 3.3Å; L58-Y61 PolarHBondContact O-N 3.23Å; L58-V62 WeakPolarHBondContact O-CG2 3.5Å; L58-V62 PolarHBondContact O-N 3.26Å
59	V	97.2	Very high	95.4	Very high	87 Å²	87	86.4 Å²	86.4	53%	0.527	49%	0.486	S	S	.	.	H	α-helix	trans	-60.2	-48.5	176.6	171.5	0	0	0	0	110.4	L55 L56 Y61 V62 C63	L55-V59 WeakPolarHBondContact O-CG2 3.49Å; L55-V59 PolarHBondContact O-N 3.45Å; L56-V59 PolarHBondContact O-N 3.5Å; V59-Y61 VanDerWaalsContact C-N 3.32Å; V59-Y61 PolarHBondContact O-N 3.37Å; V59-V62 PolarHBondContact O-N 2.94Å; V59-C63 WeakPolarHBondContact O-CB 3.47Å; V59-C63 PolarHBondContact O-N 2.93Å; V59-C63 PolarHBondContact O-SG 3.4Å
60	C	96.6	Very high	95.1	Very high	84 Å²	84	89.2 Å²	89.2	57%	0.568	50%	0.495	S	S	*	.	H	α-helix	trans	-58.3	-43.2	176.3	-73.6	0	0	0	0	112.3	L56 S57 C63 A64	L56-C60 WeakPolarHBondContact O-CB 3.25Å; L56-C60 PolarHBondContact O-N 3.24Å; L56-C60 PolarHBondContact O-SG 2.98Å; L56-C60 VanDerWaalsContact O-SG 3.33Å; S57-C60 PolarHBondContact O-N 2.91Å; C60-C63 PolarHBondContact O-N 2.96Å; C60-A64 VanDerWaalsContact O-CB 3.3Å; C60-A64 WeakPolarHBondContact O-CB 3.46Å; C60-A64 PolarHBondContact O-N 3.37Å
61	Y	96.8	Very high	94.8	Very high	146 Å²	146	89.5 Å²	89.5	57%	0.573	49%	0.49	S	S	*	.	H	α-helix	trans	-61.6	-45.6	176.6	178.7	-98.5	0	0	0	112	S57 L58 V59 A64 R65	S57-Y61 WeakPolarHBondContact O-CB 3.43Å; S57-Y61 PolarHBondContact O-N 3Å; L58-Y61 PolarHBondContact O-N 3.23Å; V59-Y61 VanDerWaalsContact C-N 3.32Å; V59-Y61 PolarHBondContact O-N 3.37Å; Y61-A64 PolarHBondContact O-N 2.85Å; Y61-R65 VanDerWaalsContact O-CB 3.3Å; Y61-R65 WeakPolarHBondContact O-CB 3.05Å; Y61-R65 PolarHBondContact O-N 3.41Å
62	V	96.5	Very high	94.6	Very high	68 Å²	68	91.8 Å²	91.8	41%	0.412	50%	0.495	S	S	.	.	H	α-helix	trans	-63.4	-44.3	177.2	171.7	0	0	0	0	111.1	L58 V59 R65 N66	L58-V62 WeakPolarHBondContact O-CG2 3.5Å; L58-V62 PolarHBondContact O-N 3.26Å; V59-V62 PolarHBondContact O-N 2.94Å; V62-R65 PolarHBondContact O-N 2.94Å; V62-N66 WeakPolarHBondContact O-CB 3.29Å; V62-N66 PolarHBondContact O-N 3.19Å; V62-N66 PolarHBondContact O-ND2 3.19Å
63	C	95.5	Very high	94.4	Very high	76 Å²	76	98.1 Å²	98.1	51%	0.514	51%	0.51	S	S	.	.	H	α-helix	trans	-61.3	-46.8	176.2	-70.5	0	0	0	0	112	V59 C60 R65 N66 S67	V59-C63 WeakPolarHBondContact O-CB 3.47Å; V59-C63 PolarHBondContact O-N 2.93Å; V59-C63 PolarHBondContact O-SG 3.4Å; C60-C63 PolarHBondContact O-N 2.96Å; C63-R65 PolarHBondContact O-N 3.39Å; C63-N66 PolarHBondContact O-N 3.21Å; C63-S67 WeakPolarHBondContact O-CB 3.44Å; C63-S67 PolarHBondContact O-N 2.95Å
64	A	95	Very high	94.1	Very high	50 Å²	50	98.2 Å²	98.2	41%	0.413	51%	0.511	S	S	.	.	H	α-helix	trans	-62.3	-43.3	178	0	0	0	0	0	111.6	C60 Y61 S67 N68	C60-A64 VanDerWaalsContact O-CB 3.3Å; C60-A64 WeakPolarHBondContact O-CB 3.46Å; C60-A64 PolarHBondContact O-N 3.37Å; Y61-A64 PolarHBondContact O-N 2.85Å; A64-S67 PolarHBondContact O-N 2.88Å; A64-N68 WeakPolarHBondContact O-CB 3.37Å; A64-N68 PolarHBondContact O-N 3.12Å; A64-N68 PolarHBondContact O-ND2 2.89Å
65	R	94.6	Very high	93.7	Very high	147 Å²	147	100.3 Å²	100.3	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-61.4	-47.2	176.6	-172.7	174.5	-178.3	177.4	0.4	111.7	Y61 V62 C63 S67 N68 I69	Y61-R65 VanDerWaalsContact O-CB 3.3Å; Y61-R65 WeakPolarHBondContact O-CB 3.05Å; Y61-R65 PolarHBondContact O-N 3.41Å; V62-R65 PolarHBondContact O-N 2.94Å; C63-R65 PolarHBondContact O-N 3.39Å; R65-S67 VanDerWaalsContact C-N 3.35Å; R65-S67 PolarHBondContact O-N 3.39Å; R65-N68 PolarHBondContact O-N 2.89Å; R65-I69 HydrophobicContact CG-CD1 4.04Å; R65-I69 VanDerWaalsContact O-CG1 3.3Å; R65-I69 WeakPolarHBondContact O-CG1 3.23Å; R65-I69 PolarHBondContact O-N 3.31Å
66	N	92.5	Very high	93.4	Very high	86 Å²	86	101.2 Å²	101.2	46%	0.46	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-40.7	178	-75.1	-19.9	0	0	0	112.2	V62 C63 K70	V62-N66 WeakPolarHBondContact O-CB 3.29Å; V62-N66 PolarHBondContact O-N 3.19Å; V62-N66 PolarHBondContact O-ND2 3.19Å; C63-N66 PolarHBondContact O-N 3.21Å; N66-K70 WeakPolarHBondContact O-CG 3.5Å; N66-K70 PolarHBondContact O-N 3.16Å; N66-K70 VanDerWaalsContact O-N 3.08Å
67	S	91.7	Very high	93.1	Very high	56 Å²	56	101.6 Å²	101.6	39%	0.392	51%	0.513	S	S	.	.	H	α-helix	trans	-61.8	-47.9	175.4	-174.2	0	0	0	0	111.6	C63 A64 R65 I69 K70 Q71	C63-S67 WeakPolarHBondContact O-CB 3.44Å; C63-S67 PolarHBondContact O-N 2.95Å; A64-S67 PolarHBondContact O-N 2.88Å; R65-S67 VanDerWaalsContact C-N 3.35Å; R65-S67 PolarHBondContact O-N 3.39Å; S67-I69 PolarHBondContact O-N 3.2Å; S67-K70 PolarHBondContact O-N 2.93Å; S67-Q71 WeakPolarHBondContact O-CG 3.49Å; S67-Q71 PolarHBondContact O-N 3.5Å
68	N	92.3	Very high	92.7	Very high	91 Å²	91	107.4 Å²	107.4	49%	0.487	52%	0.524	S	S	.	.	H	α-helix	trans	-60.9	-42.9	178.6	-81.9	-39.1	0	0	0	112.5	A64 R65 K70 Q71 Q72	A64-N68 WeakPolarHBondContact O-CB 3.37Å; A64-N68 PolarHBondContact O-N 3.12Å; A64-N68 PolarHBondContact O-ND2 2.89Å; R65-N68 PolarHBondContact O-N 2.89Å; N68-K70 VanDerWaalsContact C-N 3.34Å; N68-K70 PolarHBondContact O-N 2.96Å; N68-Q71 PolarHBondContact O-N 2.83Å; N68-Q72 WeakPolarHBondContact O-CB 3.48Å; N68-Q72 WeakPolarHBondContact O-CG 3.48Å; N68-Q72 PolarHBondContact O-N 2.96Å
69	I	91.5	Very high	92.3	Very high	57 Å²	57	108.1 Å²	108.1	29%	0.292	53%	0.528	S	S	.	.	H	α-helix	trans	-61.9	-43.8	176.5	-67.6	166	0	0	0	110.6	R65 S67 Q72 R73	R65-I69 HydrophobicContact CG-CD1 4.04Å; R65-I69 VanDerWaalsContact O-CG1 3.3Å; R65-I69 WeakPolarHBondContact O-CG1 3.23Å; R65-I69 PolarHBondContact O-N 3.31Å; S67-I69 PolarHBondContact O-N 3.2Å; I69-Q72 PolarHBondContact O-N 2.89Å; I69-R73 WeakPolarHBondContact O-CG 3.39Å; I69-R73 PolarHBondContact O-N 3.24Å
70	K	91	Very high	91.9	Very high	142 Å²	142	107.9 Å²	107.9	62%	0.617	52%	0.524	S	S	*	.	H	α-helix	trans	-63.1	-43.7	176.5	-72.1	-179.1	-176.7	-175.2	0	111.5	N66 S67 N68 R73 L74	N66-K70 WeakPolarHBondContact O-CG 3.5Å; N66-K70 PolarHBondContact O-N 3.16Å; N66-K70 VanDerWaalsContact O-N 3.08Å; S67-K70 PolarHBondContact O-N 2.93Å; N68-K70 VanDerWaalsContact C-N 3.34Å; N68-K70 PolarHBondContact O-N 2.96Å; K70-R73 PolarHBondContact O-N 3.47Å; K70-L74 WeakPolarHBondContact O-CG 3.33Å; K70-L74 PolarHBondContact O-N 3.08Å
71	Q	89.3	Confident	91.5	Very high	96 Å²	96	106.4 Å²	106.4	45%	0.449	52%	0.517	S	S	.	.	H	α-helix	trans	-65.1	-40.4	177.9	-73.4	-169.8	11.1	0	0	112.6	S67 N68 L74 K75	S67-Q71 WeakPolarHBondContact O-CG 3.49Å; S67-Q71 PolarHBondContact O-N 3.5Å; N68-Q71 PolarHBondContact O-N 2.83Å; Q71-L74 PolarHBondContact O-N 3.44Å; Q71-K75 WeakPolarHBondContact O-CB 3.3Å; Q71-K75 WeakPolarHBondContact O-CG 3.36Å; Q71-K75 PolarHBondContact O-N 3.18Å
72	Q	90.4	Very high	91.2	Very high	127 Å²	127	103.2 Å²	103.2	59%	0.593	52%	0.515	S	S	*	.	H	α-helix	trans	-62.1	-43.6	175.4	-77	178	-19.5	0	0	111.4	N68 I69 L74 K75 Q76	N68-Q72 WeakPolarHBondContact O-CB 3.48Å; N68-Q72 WeakPolarHBondContact O-CG 3.48Å; N68-Q72 PolarHBondContact O-N 2.96Å; I69-Q72 PolarHBondContact O-N 2.89Å; Q72-L74 PolarHBondContact O-N 2.92Å; Q72-K75 PolarHBondContact O-N 3.43Å; Q72-Q76 WeakPolarHBondContact O-CB 3.44Å; Q72-Q76 PolarHBondContact O-N 3.02Å
73	R	91.4	Very high	90.9	Very high	163 Å²	163	104.9 Å²	104.9	62%	0.615	52%	0.522	S	S	*	.	H	α-helix	trans	-59.9	-46	174.6	-70.5	177.1	-171.7	-179.9	2.4	111.8	I69 K70 K75 Q76 H77	I69-R73 WeakPolarHBondContact O-CG 3.39Å; I69-R73 PolarHBondContact O-N 3.24Å; K70-R73 PolarHBondContact O-N 3.47Å; R73-K75 PolarHBondContact O-N 2.98Å; R73-Q76 WeakPolarHBondContact O-CB 3.33Å; R73-Q76 PolarHBondContact O-N 2.92Å; R73-H77 PolarHBondContact O-CD2 3.47Å; R73-H77 PolarHBondContact O-N 3.18Å
74	L	90.1	Very high	90.7	Very high	109 Å²	109	110.4 Å²	110.4	57%	0.571	53%	0.532	S	S	*	.	H	α-helix	trans	-62.5	-41.5	176.9	-70.7	173.1	0	0	0	112.4	K70 Q71 Q72 H77 R78	K70-L74 WeakPolarHBondContact O-CG 3.33Å; K70-L74 PolarHBondContact O-N 3.08Å; Q71-L74 PolarHBondContact O-N 3.44Å; Q72-L74 PolarHBondContact O-N 2.92Å; L74-H77 PolarHBondContact O-N 2.9Å; L74-R78 WeakPolarHBondContact O-CG 3.3Å; L74-R78 PolarHBondContact O-N 3.34Å; L74-R78 VanDerWaalsContact O-N 3.08Å
75	K	88.9	Confident	90.4	Very high	133 Å²	133	114.1 Å²	114.1	58%	0.578	54%	0.544	S	S	*	.	H	α-helix	trans	-62.1	-44.6	174	-74.5	178.2	179.4	-178.2	0	111.3	Q71 Q72 R73 H77 R78 L79	Q71-K75 WeakPolarHBondContact O-CB 3.3Å; Q71-K75 WeakPolarHBondContact O-CG 3.36Å; Q71-K75 PolarHBondContact O-N 3.18Å; Q72-K75 PolarHBondContact O-N 3.43Å; R73-K75 PolarHBondContact O-N 2.98Å; K75-H77 PolarHBondContact O-N 3.43Å; K75-R78 PolarHBondContact O-N 2.93Å; K75-L79 WeakPolarHBondContact O-CG 3.27Å; K75-L79 PolarHBondContact O-N 3.46Å
76	Q	91.3	Very high	90.1	Very high	119 Å²	119	113 Å²	113	56%	0.556	55%	0.553	S	S	*	*	H	α-helix	trans	-60.3	-43.6	176.8	-158.7	92.9	11.3	0	0	111.7	Q72 R73 R78 L79 N80	Q72-Q76 WeakPolarHBondContact O-CB 3.44Å; Q72-Q76 PolarHBondContact O-N 3.02Å; R73-Q76 WeakPolarHBondContact O-CB 3.33Å; R73-Q76 PolarHBondContact O-N 2.92Å; Q76-R78 PolarHBondContact O-N 3.07Å; Q76-L79 PolarHBondContact O-N 3.05Å; Q76-N80 WeakPolarHBondContact O-CB 3.48Å; Q76-N80 PolarHBondContact O-N 3.49Å; Q76-N80 PolarHBondContact O-OD1 3.41Å
77	H	89.1	Confident	89.9	Confident	128 Å²	128	116.5 Å²	116.5	59%	0.593	57%	0.567	S	S	*	*	H	α-helix	trans	-63.1	-40.2	177	-77.8	-65.1	0	0	0	112.6	R73 L74 K75 N80 A81	R73-H77 PolarHBondContact O-CD2 3.47Å; R73-H77 PolarHBondContact O-N 3.18Å; L74-H77 PolarHBondContact O-N 2.9Å; K75-H77 PolarHBondContact O-N 3.43Å; H77-N80 PolarHBondContact O-N 3.3Å; H77-A81 WeakPolarHBondContact O-CB 3.29Å; H77-A81 PolarHBondContact O-N 2.92Å
78	R	87.3	Confident	89.2	Confident	190 Å²	190	120.3 Å²	120.3	72%	0.717	60%	0.601	S	S	*	*	H	α-helix	trans	-64.4	-43.1	174.7	-71.7	-179.5	-178.5	-172.1	0.1	111.8	L74 K75 Q76 A81 C82	L74-R78 WeakPolarHBondContact O-CG 3.3Å; L74-R78 PolarHBondContact O-N 3.34Å; L74-R78 VanDerWaalsContact O-N 3.08Å; K75-R78 PolarHBondContact O-N 2.93Å; Q76-R78 PolarHBondContact O-N 3.07Å; R78-A81 PolarHBondContact O-N 3.28Å; R78-C82 PolarHBondContact O-N 3.12Å
79	L	88.9	Confident	89.1	Confident	115 Å²	115	121.8 Å²	121.8	60%	0.602	61%	0.607	S	S	*	*	H	α-helix	trans	-61.9	-45.3	176.1	-70.9	169.9	0	0	0	111.5	K75 Q76 A81 C82 N83	K75-L79 WeakPolarHBondContact O-CG 3.27Å; K75-L79 PolarHBondContact O-N 3.46Å; Q76-L79 PolarHBondContact O-N 3.05Å; L79-A81 VanDerWaalsContact C-N 3.33Å; L79-A81 PolarHBondContact O-N 3.4Å; L79-C82 PolarHBondContact O-N 3.01Å; L79-N83 WeakPolarHBondContact O-CB 3.41Å; L79-N83 PolarHBondContact O-N 3.42Å
80	N	88.9	Confident	89	Confident	83 Å²	83	125.2 Å²	125.2	44%	0.444	62%	0.624	S	S	.	*	H	α-helix	trans	-64.5	-36.6	177.6	-68.3	-8.9	0	0	0	112.3	Q76 H77 R84	Q76-N80 WeakPolarHBondContact O-CB 3.48Å; Q76-N80 PolarHBondContact O-N 3.49Å; Q76-N80 PolarHBondContact O-OD1 3.41Å; H77-N80 PolarHBondContact O-N 3.3Å; N80-R84 WeakPolarHBondContact O-CG 3.46Å; N80-R84 PolarHBondContact O-N 3.48Å
81	A	88.3	Confident	88.9	Confident	52 Å²	52	124.3 Å²	124.3	43%	0.43	62%	0.624	S	S	.	*	H	α-helix	trans	-67.6	-44.9	175.6	0	0	0	0	0	111.9	H77 R78 L79 R84 I85	H77-A81 WeakPolarHBondContact O-CB 3.29Å; H77-A81 PolarHBondContact O-N 2.92Å; R78-A81 PolarHBondContact O-N 3.28Å; L79-A81 VanDerWaalsContact C-N 3.33Å; L79-A81 PolarHBondContact O-N 3.4Å; A81-R84 PolarHBondContact O-N 3Å; A81-I85 WeakPolarHBondContact O-CG1 3.38Å; A81-I85 PolarHBondContact O-N 3.28Å
82	C	89.9	Confident	88.8	Confident	79 Å²	79	125.9 Å²	125.9	53%	0.534	63%	0.634	S	S	.	*	H	α-helix	trans	-62.8	-42.3	174.5	-74.5	0	0	0	0	112.1	R78 L79 R84 I85 V86	R78-C82 PolarHBondContact O-N 3.12Å; L79-C82 PolarHBondContact O-N 3.01Å; C82-R84 VanDerWaalsContact C-N 3.29Å; C82-R84 PolarHBondContact O-N 2.99Å; C82-I85 PolarHBondContact O-N 3.08Å; C82-V86 WeakPolarHBondContact O-CG2 3.4Å; C82-V86 PolarHBondContact O-N 3.13Å
83	N	92.1	Very high	88.7	Confident	103 Å²	103	125.9 Å²	125.9	55%	0.551	64%	0.637	S	S	*	*	H	α-helix	trans	-60.6	-39.7	179.2	-161.6	68.2	0	0	0	111.8	L79 I85 V86 E87	L79-N83 WeakPolarHBondContact O-CB 3.41Å; L79-N83 PolarHBondContact O-N 3.42Å; N83-I85 VanDerWaalsContact C-N 3.32Å; N83-I85 PolarHBondContact O-N 3.39Å; N83-V86 PolarHBondContact O-N 3.39Å; N83-E87 WeakPolarHBondContact O-CB 3.39Å; N83-E87 PolarHBondContact O-N 3.14Å
84	R	89.7	Confident	88.6	Confident	193 Å²	193	123.4 Å²	123.4	73%	0.728	64%	0.639	S	S	*	*	H	α-helix	trans	-65.3	-31.5	174.1	-74.5	-179.2	-176.7	-173.3	-0.1	113.8	N80 A81 C82 A88	N80-R84 WeakPolarHBondContact O-CG 3.46Å; N80-R84 PolarHBondContact O-N 3.48Å; A81-R84 PolarHBondContact O-N 3Å; C82-R84 VanDerWaalsContact C-N 3.29Å; C82-R84 PolarHBondContact O-N 2.99Å; R84-A88 WeakPolarHBondContact O-CB 3.38Å; R84-A88 PolarHBondContact O-N 3.21Å
85	I	90	Very high	88.4	Confident	127 Å²	127	124.4 Å²	124.4	65%	0.651	64%	0.643	S	S	*	*	H	α-helix	trans	-76.7	-34.9	178	-66.1	166.5	0	0	0	111.1	A81 C82 N83	A81-I85 WeakPolarHBondContact O-CG1 3.38Å; A81-I85 PolarHBondContact O-N 3.28Å; C82-I85 PolarHBondContact O-N 3.08Å; N83-I85 VanDerWaalsContact C-N 3.32Å; N83-I85 PolarHBondContact O-N 3.39Å
86	V	87.8	Confident	88.4	Confident	124 Å²	124	123.8 Å²	123.8	75%	0.752	65%	0.648	S	S	*	*	H	α-helix	trans	-75.5	-28.6	178.1	174.4	0	0	0	0	112	C82 N83	C82-V86 WeakPolarHBondContact O-CG2 3.4Å; C82-V86 PolarHBondContact O-N 3.13Å; N83-V86 PolarHBondContact O-N 3.39Å
87	E	88.3	Confident	88.2	Confident	160 Å²	160	124.2 Å²	124.2	75%	0.748	66%	0.656	S	S	*	*	H	α-helix	trans	-79.2	-19.5	176.7	-170.3	172.8	-170.1	0	0	113.4	N83	N83-E87 WeakPolarHBondContact O-CB 3.39Å; N83-E87 PolarHBondContact O-N 3.14Å
88	A	77.9	Confident	88.1	Confident	136 Å²	136	123.8 Å²	123.8	100%	1.124	66%	0.662	S	S	*	*			trans	-89.1	0	177.1	0	0	0	0	0	112	R84	R84-A88 WeakPolarHBondContact O-CB 3.38Å; R84-A88 PolarHBondContact O-N 3.21Å

Retrieved 88 of 88 residues in 37.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).