A0A077ZD66_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZD66, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 72 aa.

						>A0A077ZD66_TRITR|A0A077ZD66
MAPAGPSSGVVAAIAVCSVCAVVLVALAVYFAYKKIKQRRKCEGQYWPAYEEEKNCGQNLPPLPPPAIEGLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.7	Low	82.4	Confident	242 Å²	242	99.3 Å²	99.3	100%	1.192	68%	0.682	S	S	*	*				0	98	0	-57.6	155.1	120.4	0	0	106.4
2	A	70.7	Confident	83.4	Confident	97 Å²	97	95.6 Å²	95.6	80%	0.802	66%	0.663	S	S	*	*			trans	-77.5	132.1	178	0	0	0	0	0	108.3	A4	A2-A4 PolarHBondContact O-N 3.08Å
3	P	73.3	Confident	84.3	Confident	125 Å²	125	92.4 Å²	92.4	81%	0.812	65%	0.647	S	S	*	*			trans	-60.9	128.5	176.4	25.5	-32	0	0	0	108.6	G5	P3-G5 PolarHBondContact O-N 3.03Å
4	A	81.2	Confident	85.1	Confident	104 Å²	104	93.6 Å²	93.6	86%	0.86	64%	0.64	S	S	*	*			trans	-59.3	114.2	171.6	0	0	0	0	0	107.7	A2	A2-A4 PolarHBondContact O-N 3.08Å
5	G	84.5	Confident	85.8	Confident	59 Å²	59	90.5 Å²	90.5	61%	0.608	62%	0.624	S	S	*	*	P	Polyproline II helix	trans	-60.8	159.7	175.7	0	0	0	0	0	111.1	P3 S7	P3-G5 PolarHBondContact O-N 3.03Å; G5-S7 PolarHBondContact O-N 3.11Å
6	P	84.7	Confident	86.4	Confident	90 Å²	90	90.7 Å²	90.7	58%	0.584	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-56.1	143.5	174.7	24	-32.4	0	0	0	110.2	V10 V11	P6-V10 HydrophobicContact CB-CB 4.14Å; P6-V10 HydrophobicContact CB-CG1 3.96Å; P6-V11 HydrophobicContact CB-CG2 4.14Å; P6-V11 HydrophobicContact CG-CG2 3.72Å
7	S	90.5	Very high	87	Confident	76 Å²	76	90.5 Å²	90.5	53%	0.531	62%	0.618	S	S	.	*	P	Polyproline II helix	trans	-58.3	149.1	175.9	60.2	0	0	0	0	110.5	G5 G9 V10 V11	G5-S7 PolarHBondContact O-N 3.11Å; S7-G9 PolarHBondContact O-N 3.32Å; S7-G9 VanDerWaalsContact O-N 3.08Å; S7-V10 WeakPolarHBondContact O-CA 3.47Å; S7-V10 WeakPolarHBondContact O-CB 3.23Å; S7-V10 PolarHBondContact O-N 3.34Å; S7-V10 WeakPolarHBondContact OG-CG2 3.2Å; S7-V11 PolarHBondContact O-N 2.95Å; S7-V11 VanDerWaalsContact O-N 3.16Å
8	S	87.6	Confident	87.5	Confident	106 Å²	106	88.8 Å²	88.8	74%	0.741	61%	0.607	S	S	*	*	H	α-helix	trans	-52.5	-34.7	-179	53.3	0	0	0	0	112.8	V11 A12	S8-V11 PolarHBondContact O-N 3.04Å; S8-A12 WeakPolarHBondContact O-CB 3.29Å; S8-A12 PolarHBondContact O-N 3.24Å
9	G	91	Very high	88	Confident	48 Å²	48	89.1 Å²	89.1	50%	0.495	61%	0.605	S	S	.	*	H	α-helix	trans	-62.7	-40.3	174	0	0	0	0	0	113.7	S7 A13	S7-G9 PolarHBondContact O-N 3.32Å; S7-G9 VanDerWaalsContact O-N 3.08Å; G9-A13 WeakPolarHBondContact O-CB 3.06Å; G9-A13 PolarHBondContact O-N 3.19Å
10	V	94.8	Very high	88.5	Confident	68 Å²	68	88 Å²	88	41%	0.412	60%	0.598	S	S	.	*	H	α-helix	trans	-67.1	-42.6	176.7	173	0	0	0	0	110.6	P6 S7 A12 A13 I14	P6-V10 HydrophobicContact CB-CB 4.14Å; P6-V10 HydrophobicContact CB-CG1 3.96Å; S7-V10 WeakPolarHBondContact O-CA 3.47Å; S7-V10 WeakPolarHBondContact O-CB 3.23Å; S7-V10 PolarHBondContact O-N 3.34Å; S7-V10 WeakPolarHBondContact OG-CG2 3.2Å; V10-A12 PolarHBondContact O-N 3.09Å; V10-A13 PolarHBondContact O-N 3.16Å; V10-I14 HydrophobicContact CG1-CD1 3.75Å; V10-I14 HydrophobicContact CG1-CG1 4.41Å; V10-I14 VanDerWaalsContact O-CG1 3.29Å; V10-I14 WeakPolarHBondContact O-CG1 3.28Å; V10-I14 PolarHBondContact O-N 3.44Å
11	V	94.5	Very high	88.9	Confident	77 Å²	77	86.2 Å²	86.2	47%	0.467	59%	0.589	S	S	.	*	H	α-helix	trans	-62	-44.9	178	-179.1	0	0	0	0	111.1	P6 S7 S8 A13 I14 A15	P6-V11 HydrophobicContact CB-CG2 4.14Å; P6-V11 HydrophobicContact CG-CG2 3.72Å; S7-V11 PolarHBondContact O-N 2.95Å; S7-V11 VanDerWaalsContact O-N 3.16Å; S8-V11 PolarHBondContact O-N 3.04Å; V11-A13 PolarHBondContact O-N 3.06Å; V11-I14 PolarHBondContact O-N 2.76Å; V11-A15 WeakPolarHBondContact O-CB 3.22Å; V11-A15 PolarHBondContact O-N 3.33Å
12	A	94.7	Very high	91	Very high	55 Å²	55	79.6 Å²	79.6	46%	0.455	56%	0.562	S	S	.	*	H	α-helix	trans	-62.1	-42.9	177.2	0	0	0	0	0	112.2	S8 V10 A15 V16	S8-A12 WeakPolarHBondContact O-CB 3.29Å; S8-A12 PolarHBondContact O-N 3.24Å; V10-A12 PolarHBondContact O-N 3.09Å; A12-A15 PolarHBondContact O-N 2.84Å; A12-V16 WeakPolarHBondContact O-CG2 3.4Å; A12-V16 PolarHBondContact O-N 3.39Å
13	A	94.9	Very high	92.3	Very high	54 Å²	54	78.7 Å²	78.7	45%	0.446	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-46.2	177.7	0	0	0	0	0	112.1	G9 V10 V11 A15 V16 C17	G9-A13 WeakPolarHBondContact O-CB 3.06Å; G9-A13 PolarHBondContact O-N 3.19Å; V10-A13 PolarHBondContact O-N 3.16Å; V11-A13 PolarHBondContact O-N 3.06Å; A13-A15 VanDerWaalsContact C-N 3.33Å; A13-A15 PolarHBondContact O-N 3.44Å; A13-V16 PolarHBondContact O-N 3.23Å; A13-C17 WeakPolarHBondContact O-CB 3.16Å; A13-C17 PolarHBondContact O-N 3.39Å; A13-C17 PolarHBondContact O-SG 2.82Å; A13-C17 VanDerWaalsContact O-SG 3.36Å
14	I	95	Very high	93.4	Very high	109 Å²	109	78.3 Å²	78.3	56%	0.559	54%	0.537	S	S	*	.	H	α-helix	trans	-60.6	-44.4	177.3	-66.6	166.5	0	0	0	110.5	V10 V11 C17 S18	V10-I14 HydrophobicContact CG1-CD1 3.75Å; V10-I14 HydrophobicContact CG1-CG1 4.41Å; V10-I14 VanDerWaalsContact O-CG1 3.29Å; V10-I14 WeakPolarHBondContact O-CG1 3.28Å; V10-I14 PolarHBondContact O-N 3.44Å; V11-I14 PolarHBondContact O-N 2.76Å; I14-C17 PolarHBondContact O-N 3.27Å; I14-S18 VanDerWaalsContact O-CB 3.3Å; I14-S18 WeakPolarHBondContact O-CB 3.36Å; I14-S18 PolarHBondContact O-N 3.35Å; I14-S18 PolarHBondContact O-OG 2.99Å
15	A	95.3	Very high	94.2	Very high	48 Å²	48	77.6 Å²	77.6	40%	0.397	52%	0.522	S	S	.	.	H	α-helix	trans	-58.8	-50.9	177.9	0	0	0	0	0	111.4	V11 A12 A13 C17 S18 V19	V11-A15 WeakPolarHBondContact O-CB 3.22Å; V11-A15 PolarHBondContact O-N 3.33Å; A12-A15 PolarHBondContact O-N 2.84Å; A13-A15 VanDerWaalsContact C-N 3.33Å; A13-A15 PolarHBondContact O-N 3.44Å; A15-C17 PolarHBondContact O-N 3.45Å; A15-S18 PolarHBondContact O-N 2.91Å; A15-S18 PolarHBondContact O-OG 3Å; A15-V19 WeakPolarHBondContact O-CG2 3.39Å; A15-V19 PolarHBondContact O-N 3.19Å
16	V	96.3	Very high	94.8	Very high	93 Å²	93	77.5 Å²	77.5	56%	0.564	52%	0.516	S	S	*	.	H	α-helix	trans	-62	-46.9	179.1	175.9	0	0	0	0	111.3	A12 A13 S18 V19 C20	A12-V16 WeakPolarHBondContact O-CG2 3.4Å; A12-V16 PolarHBondContact O-N 3.39Å; A13-V16 PolarHBondContact O-N 3.23Å; V16-S18 VanDerWaalsContact C-N 3.31Å; V16-S18 PolarHBondContact O-N 3.4Å; V16-V19 PolarHBondContact O-N 3.45Å; V16-C20 PolarHBondContact O-N 3.01Å; V16-C20 PolarHBondContact O-SG 3.04Å; V16-C20 VanDerWaalsContact O-SG 3.34Å
17	C	96	Very high	95.4	Very high	87 Å²	87	77.2 Å²	77.2	59%	0.588	51%	0.509	S	S	*	.	H	α-helix	trans	-58.8	-42.1	177	-74.6	0	0	0	0	112.2	A13 I14 A15 C20 A21	A13-C17 WeakPolarHBondContact O-CB 3.16Å; A13-C17 PolarHBondContact O-N 3.39Å; A13-C17 PolarHBondContact O-SG 2.82Å; A13-C17 VanDerWaalsContact O-SG 3.36Å; I14-C17 PolarHBondContact O-N 3.27Å; A15-C17 PolarHBondContact O-N 3.45Å; C17-C20 PolarHBondContact O-N 2.89Å; C17-A21 VanDerWaalsContact O-CB 3.31Å; C17-A21 WeakPolarHBondContact O-CB 3.36Å; C17-A21 PolarHBondContact O-N 3.47Å
18	S	96.1	Very high	95.8	Very high	60 Å²	60	76.5 Å²	76.5	42%	0.42	51%	0.507	S	S	.	.	H	α-helix	trans	-64.4	-43.1	179.1	72.8	0	0	0	0	111.9	I14 A15 V16 A21 V22	I14-S18 VanDerWaalsContact O-CB 3.3Å; I14-S18 WeakPolarHBondContact O-CB 3.36Å; I14-S18 PolarHBondContact O-N 3.35Å; I14-S18 PolarHBondContact O-OG 2.99Å; A15-S18 PolarHBondContact O-N 2.91Å; A15-S18 PolarHBondContact O-OG 3Å; V16-S18 VanDerWaalsContact C-N 3.31Å; V16-S18 PolarHBondContact O-N 3.4Å; S18-A21 PolarHBondContact O-N 3.26Å; S18-V22 WeakPolarHBondContact O-CG2 3.27Å; S18-V22 PolarHBondContact O-N 2.97Å
19	V	97	Very high	96.3	Very high	94 Å²	94	75.9 Å²	75.9	57%	0.57	50%	0.499	S	S	*	.	H	α-helix	trans	-64.2	-46.8	176.8	173.8	0	0	0	0	110.4	A15 V16 A21 V22 V23	A15-V19 WeakPolarHBondContact O-CG2 3.39Å; A15-V19 PolarHBondContact O-N 3.19Å; V16-V19 PolarHBondContact O-N 3.45Å; V19-A21 VanDerWaalsContact C-N 3.33Å; V19-A21 PolarHBondContact O-N 3.39Å; V19-V22 PolarHBondContact O-N 2.77Å; V19-V23 WeakPolarHBondContact O-CG2 3.39Å; V19-V23 PolarHBondContact O-N 3.23Å
20	C	97.4	Very high	96.6	Very high	67 Å²	67	80.1 Å²	80.1	45%	0.453	50%	0.501	S	S	.	.	H	α-helix	trans	-59.4	-43.1	176	-70	0	0	0	0	112.1	V16 C17 V23 L24	V16-C20 PolarHBondContact O-N 3.01Å; V16-C20 PolarHBondContact O-SG 3.04Å; V16-C20 VanDerWaalsContact O-SG 3.34Å; C17-C20 PolarHBondContact O-N 2.89Å; C20-V23 PolarHBondContact O-N 3.2Å; C20-L24 WeakPolarHBondContact O-CB 3.45Å; C20-L24 WeakPolarHBondContact O-CG 3.33Å; C20-L24 PolarHBondContact O-N 3.11Å
21	A	97.3	Very high	96.7	Very high	51 Å²	51	83 Å²	83	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-62.4	-45	178.5	0	0	0	0	0	111.6	C17 S18 V19 V23 L24 V25	C17-A21 VanDerWaalsContact O-CB 3.31Å; C17-A21 WeakPolarHBondContact O-CB 3.36Å; C17-A21 PolarHBondContact O-N 3.47Å; S18-A21 PolarHBondContact O-N 3.26Å; V19-A21 VanDerWaalsContact C-N 3.33Å; V19-A21 PolarHBondContact O-N 3.39Å; A21-V23 VanDerWaalsContact C-N 3.35Å; A21-V23 PolarHBondContact O-N 2.92Å; A21-L24 PolarHBondContact O-N 3.46Å; A21-V25 WeakPolarHBondContact O-CB 3.39Å; A21-V25 VanDerWaalsContact O-CG2 3.25Å; A21-V25 WeakPolarHBondContact O-CG2 3.47Å; A21-V25 PolarHBondContact O-N 2.95Å
22	V	97.7	Very high	96.8	Very high	103 Å²	103	81.6 Å²	81.6	62%	0.624	51%	0.505	S	S	*	.	H	α-helix	trans	-61.6	-43.6	177.1	173.7	0	0	0	0	111.2	S18 V19 V25 A26	S18-V22 WeakPolarHBondContact O-CG2 3.27Å; S18-V22 PolarHBondContact O-N 2.97Å; V19-V22 PolarHBondContact O-N 2.77Å; V22-V25 PolarHBondContact O-N 3.18Å; V22-A26 WeakPolarHBondContact O-CB 3.44Å; V22-A26 PolarHBondContact O-N 2.9Å
23	V	97.9	Very high	96.8	Very high	78 Å²	78	85.7 Å²	85.7	47%	0.473	51%	0.509	S	S	.	.	H	α-helix	trans	-62.3	-45.5	177.6	172.5	0	0	0	0	111.2	V19 C20 A21 A26 L27	V19-V23 WeakPolarHBondContact O-CG2 3.39Å; V19-V23 PolarHBondContact O-N 3.23Å; C20-V23 PolarHBondContact O-N 3.2Å; A21-V23 VanDerWaalsContact C-N 3.35Å; A21-V23 PolarHBondContact O-N 2.92Å; V23-A26 PolarHBondContact O-N 3.38Å; V23-L27 HydrophobicContact CG1-CD1 4.15Å; V23-L27 WeakPolarHBondContact O-CG 3.25Å; V23-L27 PolarHBondContact O-N 3.47Å
24	L	97.5	Very high	96.8	Very high	117 Å²	117	87.5 Å²	87.5	61%	0.613	51%	0.507	S	S	*	.	H	α-helix	trans	-63.3	-43	178.2	-72.4	175.6	0	0	0	112	C20 A21 L27 A28	C20-L24 WeakPolarHBondContact O-CB 3.45Å; C20-L24 WeakPolarHBondContact O-CG 3.33Å; C20-L24 PolarHBondContact O-N 3.11Å; A21-L24 PolarHBondContact O-N 3.46Å; L24-L27 PolarHBondContact O-N 3.43Å; L24-A28 WeakPolarHBondContact O-CB 3.26Å; L24-A28 PolarHBondContact O-N 2.85Å
25	V	97.9	Very high	96.6	Very high	90 Å²	90	88.4 Å²	88.4	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-63.3	-44.7	176.4	171.9	0	0	0	0	110.6	A21 V22 L27 A28 V29	A21-V25 WeakPolarHBondContact O-CB 3.39Å; A21-V25 VanDerWaalsContact O-CG2 3.25Å; A21-V25 WeakPolarHBondContact O-CG2 3.47Å; A21-V25 PolarHBondContact O-N 2.95Å; V22-V25 PolarHBondContact O-N 3.18Å; V25-L27 VanDerWaalsContact C-N 3.34Å; V25-L27 PolarHBondContact O-N 2.83Å; V25-A28 PolarHBondContact O-N 3.39Å; V25-V29 HydrophobicContact CG1-CG2 4.31Å; V25-V29 WeakPolarHBondContact O-CB 3.36Å; V25-V29 VanDerWaalsContact O-CG2 3.28Å; V25-V29 WeakPolarHBondContact O-CG2 3.26Å; V25-V29 PolarHBondContact O-N 3.41Å
26	A	97.8	Very high	96.4	Very high	57 Å²	57	90.1 Å²	90.1	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-60.2	-43.4	177.5	0	0	0	0	0	111.9	V22 V23 Y30	V22-A26 WeakPolarHBondContact O-CB 3.44Å; V22-A26 PolarHBondContact O-N 2.9Å; V23-A26 PolarHBondContact O-N 3.38Å; A26-Y30 VanDerWaalsContact O-CB 3.3Å; A26-Y30 WeakPolarHBondContact O-CB 3.3Å; A26-Y30 PolarHBondContact O-N 2.88Å
27	L	97.5	Very high	96.2	Very high	84 Å²	84	90.6 Å²	90.6	44%	0.44	50%	0.503	S	S	.	.	H	α-helix	trans	-63.9	-46.7	175	-71.4	174.3	0	0	0	111.6	V23 L24 V25 V29 Y30 F31	V23-L27 HydrophobicContact CG1-CD1 4.15Å; V23-L27 WeakPolarHBondContact O-CG 3.25Å; V23-L27 PolarHBondContact O-N 3.47Å; L24-L27 PolarHBondContact O-N 3.43Å; V25-L27 VanDerWaalsContact C-N 3.34Å; V25-L27 PolarHBondContact O-N 2.83Å; L27-V29 VanDerWaalsContact C-N 3.33Å; L27-V29 PolarHBondContact O-N 3.19Å; L27-Y30 PolarHBondContact O-N 3.29Å; L27-F31 VanDerWaalsContact O-CD2 3.26Å; L27-F31 WeakPolarHBondContact O-CD2 3.41Å; L27-F31 PolarHBondContact O-N 3.47Å
28	A	97.6	Very high	95.7	Very high	61 Å²	61	91.9 Å²	91.9	50%	0.504	50%	0.5	S	S	.	.	H	α-helix	trans	-58.7	-45.5	178.6	0	0	0	0	0	111.6	L24 V25 F31 A32	L24-A28 WeakPolarHBondContact O-CB 3.26Å; L24-A28 PolarHBondContact O-N 2.85Å; V25-A28 PolarHBondContact O-N 3.39Å; A28-F31 PolarHBondContact O-N 2.9Å; A28-A32 VanDerWaalsContact O-CB 3.25Å; A28-A32 WeakPolarHBondContact O-CB 3.27Å; A28-A32 PolarHBondContact O-N 3.26Å
29	V	97.8	Very high	95.1	Very high	93 Å²	93	96.3 Å²	96.3	56%	0.564	51%	0.508	S	S	*	.	H	α-helix	trans	-63.1	-44.3	175.8	172.5	0	0	0	0	110.9	V25 L27 A32 Y33	V25-V29 HydrophobicContact CG1-CG2 4.31Å; V25-V29 WeakPolarHBondContact O-CB 3.36Å; V25-V29 VanDerWaalsContact O-CG2 3.28Å; V25-V29 WeakPolarHBondContact O-CG2 3.26Å; V25-V29 PolarHBondContact O-N 3.41Å; L27-V29 VanDerWaalsContact C-N 3.33Å; L27-V29 PolarHBondContact O-N 3.19Å; V29-A32 PolarHBondContact O-N 2.87Å; V29-Y33 VanDerWaalsContact O-CB 3.26Å; V29-Y33 WeakPolarHBondContact O-CB 3.28Å; V29-Y33 PolarHBondContact O-N 3.42Å
30	Y	97.2	Very high	94.4	Very high	136 Å²	136	100.2 Å²	100.2	53%	0.533	51%	0.513	S	S	.	.	H	α-helix	trans	-61.7	-46.6	177.9	177	-98.7	0	0	0	112.4	A26 L27 Y33 K34	A26-Y30 VanDerWaalsContact O-CB 3.3Å; A26-Y30 WeakPolarHBondContact O-CB 3.3Å; A26-Y30 PolarHBondContact O-N 2.88Å; L27-Y30 PolarHBondContact O-N 3.29Å; Y30-Y33 PolarHBondContact O-N 3.48Å; Y30-K34 HydrophobicContact CE1-CD 4.37Å; Y30-K34 VanDerWaalsContact O-CB 3.3Å; Y30-K34 WeakPolarHBondContact O-CB 3.25Å; Y30-K34 PolarHBondContact O-N 2.85Å
31	F	96.7	Very high	93.5	Very high	128 Å²	128	103.6 Å²	103.6	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-65.4	-42.4	177.2	-86.1	-74.5	0	0	0	112	L27 A28 K34 K35	L27-F31 VanDerWaalsContact O-CD2 3.26Å; L27-F31 WeakPolarHBondContact O-CD2 3.41Å; L27-F31 PolarHBondContact O-N 3.47Å; A28-F31 PolarHBondContact O-N 2.9Å; F31-K34 PolarHBondContact O-N 3.38Å; F31-K35 WeakPolarHBondContact O-CB 3.33Å; F31-K35 PolarHBondContact O-N 3.42Å
32	A	96.8	Very high	92.2	Very high	48 Å²	48	104.4 Å²	104.4	40%	0.397	52%	0.521	S	S	.	.	H	α-helix	trans	-60.5	-48.2	175.1	0	0	0	0	0	111	A28 V29 K34 K35 I36	A28-A32 VanDerWaalsContact O-CB 3.25Å; A28-A32 WeakPolarHBondContact O-CB 3.27Å; A28-A32 PolarHBondContact O-N 3.26Å; V29-A32 PolarHBondContact O-N 2.87Å; A32-K34 PolarHBondContact O-N 3.41Å; A32-K35 PolarHBondContact O-N 2.9Å; A32-I36 VanDerWaalsContact O-CG1 3.27Å; A32-I36 WeakPolarHBondContact O-CG1 3.5Å; A32-I36 PolarHBondContact O-N 2.85Å
33	Y	96	Very high	90.9	Very high	142 Å²	142	106.2 Å²	106.2	56%	0.557	52%	0.523	S	S	*	.	H	α-helix	trans	-59.9	-45.9	176.3	176.3	-104.9	0	0	0	111.9	V29 Y30 K35 I36 K37	V29-Y33 VanDerWaalsContact O-CB 3.26Å; V29-Y33 WeakPolarHBondContact O-CB 3.28Å; V29-Y33 PolarHBondContact O-N 3.42Å; Y30-Y33 PolarHBondContact O-N 3.48Å; Y33-K35 PolarHBondContact O-N 2.89Å; Y33-I36 PolarHBondContact O-N 3.43Å; Y33-K37 HydrophobicContact CE1-CD 4.21Å; Y33-K37 VanDerWaalsContact O-CB 3.27Å; Y33-K37 WeakPolarHBondContact O-CB 3.47Å; Y33-K37 PolarHBondContact O-N 3.43Å
34	K	95	Very high	89.5	Confident	92 Å²	92	106.4 Å²	106.4	40%	0.4	54%	0.541	S	S	.	.	H	α-helix	trans	-60.3	-44.8	176.8	-177	176.7	172.9	179	0	111.5	Y30 F31 A32 K37 Q38	Y30-K34 HydrophobicContact CE1-CD 4.37Å; Y30-K34 VanDerWaalsContact O-CB 3.3Å; Y30-K34 WeakPolarHBondContact O-CB 3.25Å; Y30-K34 PolarHBondContact O-N 2.85Å; F31-K34 PolarHBondContact O-N 3.38Å; A32-K34 PolarHBondContact O-N 3.41Å; K34-K37 PolarHBondContact O-N 3.4Å; K34-Q38 WeakPolarHBondContact O-CB 3.47Å; K34-Q38 WeakPolarHBondContact O-CG 3.3Å; K34-Q38 PolarHBondContact O-N 2.84Å
35	K	91.2	Very high	88.2	Confident	127 Å²	127	105.4 Å²	105.4	55%	0.552	53%	0.533	S	S	*	.	H	α-helix	trans	-64.5	-43.8	178.4	-175.1	175.9	179.1	173.2	0	111.8	F31 A32 Y33 Q38 R39	F31-K35 WeakPolarHBondContact O-CB 3.33Å; F31-K35 PolarHBondContact O-N 3.42Å; A32-K35 PolarHBondContact O-N 2.9Å; Y33-K35 PolarHBondContact O-N 2.89Å; K35-Q38 PolarHBondContact O-N 3.2Å; K35-R39 WeakPolarHBondContact O-CG 3.37Å; K35-R39 PolarHBondContact O-N 3.39Å
36	I	91.1	Very high	86.9	Confident	85 Å²	85	108.7 Å²	108.7	44%	0.436	54%	0.536	S	S	.	.	H	α-helix	trans	-64.1	-45.7	176.1	-67.3	165	0	0	0	110.1	A32 Y33 Q38 R39 R40	A32-I36 VanDerWaalsContact O-CG1 3.27Å; A32-I36 WeakPolarHBondContact O-CG1 3.5Å; A32-I36 PolarHBondContact O-N 2.85Å; Y33-I36 PolarHBondContact O-N 3.43Å; I36-Q38 VanDerWaalsContact C-N 3.32Å; I36-Q38 PolarHBondContact O-N 2.88Å; I36-R39 PolarHBondContact O-N 3.34Å; I36-R40 WeakPolarHBondContact O-CG 3.33Å; I36-R40 PolarHBondContact O-N 3.43Å
37	K	90.4	Very high	85.9	Confident	103 Å²	103	112.4 Å²	112.4	45%	0.448	54%	0.538	S	S	.	.	H	α-helix	trans	-61.8	-39.3	178.1	-173.5	174.4	-177.3	174.8	0	112.1	Y33 K34 K41	Y33-K37 HydrophobicContact CE1-CD 4.21Å; Y33-K37 VanDerWaalsContact O-CB 3.27Å; Y33-K37 WeakPolarHBondContact O-CB 3.47Å; Y33-K37 PolarHBondContact O-N 3.43Å; K34-K37 PolarHBondContact O-N 3.4Å; K37-K41 WeakPolarHBondContact O-CG 3.35Å; K37-K41 PolarHBondContact O-N 3Å
38	Q	87	Confident	85	Confident	113 Å²	113	111.3 Å²	111.3	53%	0.528	54%	0.536	S	S	.	.	H	α-helix	trans	-65.9	-43.4	173.9	-78	-177	-34.8	0	0	111.8	K34 K35 I36 R40 K41 C42	K34-Q38 WeakPolarHBondContact O-CB 3.47Å; K34-Q38 WeakPolarHBondContact O-CG 3.3Å; K34-Q38 PolarHBondContact O-N 2.84Å; K35-Q38 PolarHBondContact O-N 3.2Å; I36-Q38 VanDerWaalsContact C-N 3.32Å; I36-Q38 PolarHBondContact O-N 2.88Å; Q38-R40 PolarHBondContact O-N 2.87Å; Q38-K41 WeakPolarHBondContact O-CB 3.31Å; Q38-K41 PolarHBondContact O-N 3.31Å; Q38-K41 VanDerWaalsContact O-N 3.11Å; Q38-C42 PolarHBondContact O-N 2.91Å; Q38-C42 PolarHBondContact O-SG 3.33Å
39	R	83.2	Confident	84.1	Confident	153 Å²	153	111.8 Å²	111.8	58%	0.577	54%	0.541	S	S	*	.	H	α-helix	trans	-58.7	-46.8	175.5	-76.1	177.9	172.4	-106.3	-5.4	111.9	K35 I36 K41 C42 E43	K35-R39 WeakPolarHBondContact O-CG 3.37Å; K35-R39 PolarHBondContact O-N 3.39Å; I36-R39 PolarHBondContact O-N 3.34Å; R39-K41 PolarHBondContact O-N 2.9Å; R39-C42 CarbonylContact O-C 3.5Å; R39-C42 PolarHBondContact O-N 2.95Å; R39-E43 WeakPolarHBondContact O-CG 3.33Å; R39-E43 PolarHBondContact O-N 2.94Å
40	R	81.5	Confident	83.2	Confident	177 Å²	177	114.5 Å²	114.5	67%	0.668	54%	0.542	S	S	*	.	H	α-helix	trans	-60.4	-29	175.4	-69.2	-174.4	-170	-173.3	3.1	114.2	I36 Q38 C42	I36-R40 WeakPolarHBondContact O-CG 3.33Å; I36-R40 PolarHBondContact O-N 3.43Å; Q38-R40 PolarHBondContact O-N 2.87Å; R40-C42 VanDerWaalsContact C-N 3.34Å
41	K	78.3	Confident	82	Confident	138 Å²	138	111.5 Å²	111.5	60%	0.6	53%	0.533	S	S	*	.	H	α-helix	trans	-72.6	-31.1	174.2	-73.5	-179.7	176.1	-161.5	0	112.2	K37 Q38 R39 Q45	K37-K41 WeakPolarHBondContact O-CG 3.35Å; K37-K41 PolarHBondContact O-N 3Å; Q38-K41 WeakPolarHBondContact O-CB 3.31Å; Q38-K41 PolarHBondContact O-N 3.31Å; Q38-K41 VanDerWaalsContact O-N 3.11Å; R39-K41 PolarHBondContact O-N 2.9Å; K41-Q45 PolarHBondContact O-NE2 3.41Å
42	C	71	Confident	81	Confident	67 Å²	67	111.7 Å²	111.7	45%	0.453	54%	0.535	S	S	.	.	H	α-helix	trans	-90.8	-21.5	179.5	-59	0	0	0	0	112.7	Q38 R39 R40 G44 Q45	Q38-C42 PolarHBondContact O-N 2.91Å; Q38-C42 PolarHBondContact O-SG 3.33Å; R39-C42 CarbonylContact O-C 3.5Å; R39-C42 PolarHBondContact O-N 2.95Å; R40-C42 VanDerWaalsContact C-N 3.34Å; C42-G44 PolarHBondContact O-N 3.46Å; C42-Q45 PolarHBondContact O-N 3.34Å
43	E	68.8	Low	80.1	Confident	141 Å²	141	116.3 Å²	116.3	66%	0.659	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.7	106.8	171.4	-80.8	170.4	-174	0	0	108.7	R39	R39-E43 WeakPolarHBondContact O-CG 3.33Å; R39-E43 PolarHBondContact O-N 2.94Å
44	G	68.7	Low	79.1	Confident	82 Å²	82	115.5 Å²	115.5	85%	0.845	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	100.9	-6.8	-177.5	0	0	0	0	0	115.3	C42 Y46	C42-G44 PolarHBondContact O-N 3.46Å; G44-Y46 PolarHBondContact O-N 3.35Å
45	Q	71.6	Confident	78	Confident	97 Å²	97	115.5 Å²	115.5	45%	0.453	55%	0.552	S	S	.	*			trans	-77.8	109.3	167.1	-67.8	-168.6	31.2	0	0	108.4	K41 C42 W47	K41-Q45 PolarHBondContact O-NE2 3.41Å; C42-Q45 PolarHBondContact O-N 3.34Å; Q45-W47 HydrophobicContact CB-CZ2 4.25Å; Q45-W47 PolarHBondContact O-N 3.02Å; Q45-W47 PolarHBondContact O-NE1 2.94Å
46	Y	69.6	Low	76.9	Confident	158 Å²	158	114.2 Å²	114.2	62%	0.62	56%	0.558	S	S	*	*			trans	-71.4	119.3	170	179.9	-106	0	0	0	108.5	G44 P48 E51	G44-Y46 PolarHBondContact O-N 3.35Å; Y46-P48 HydrophobicContact CD1-CB 4.36Å; Y46-P48 HydrophobicContact CD1-CG 4.33Å; Y46-P48 HydrophobicContact CE1-CB 3.66Å; Y46-P48 HydrophobicContact CE1-CG 4.08Å; Y46-P48 WeakPolarHBondContact O-CD 3.34Å; Y46-E51 WeakPolarHBondContact CD2-OE1 3.32Å; Y46-E51 VanDerWaalsContact CE2-CD 3.43Å; Y46-E51 WeakPolarHBondContact CE2-OE2 3.29Å
47	W	77.5	Confident	75.8	Confident	135 Å²	135	112.8 Å²	112.8	51%	0.511	57%	0.565	S	S	.	*			trans	-112.5	88.6	178.6	-63.8	93.2	0	0	0	107.8	Q45 A49 Y50 E51	Q45-W47 HydrophobicContact CB-CZ2 4.25Å; Q45-W47 PolarHBondContact O-N 3.02Å; Q45-W47 PolarHBondContact O-NE1 2.94Å; W47-A49 VanDerWaalsContact C-N 3.25Å; W47-A49 PolarHBondContact O-N 3.36Å; W47-Y50 PolarHBondContact O-N 3.34Å; W47-E51 PolarHBondContact O-N 3.49Å
48	P	77.2	Confident	74.9	Confident	61 Å²	61	113.2 Å²	113.2	40%	0.396	57%	0.568	S	S	.	*	H	α-helix	trans	-53.6	-44.8	-173.3	15.6	-27.1	0	0	0	111.7	Y46 Y50 E51 E52	Y46-P48 HydrophobicContact CD1-CB 4.36Å; Y46-P48 HydrophobicContact CD1-CG 4.33Å; Y46-P48 HydrophobicContact CE1-CB 3.66Å; Y46-P48 HydrophobicContact CE1-CG 4.08Å; Y46-P48 WeakPolarHBondContact O-CD 3.34Å; P48-Y50 PolarHBondContact O-N 3Å; P48-E51 PolarHBondContact O-N 3.33Å; P48-E52 VanDerWaalsContact O-CB 3.29Å; P48-E52 WeakPolarHBondContact O-CB 3.3Å; P48-E52 WeakPolarHBondContact O-CG 3.37Å; P48-E52 PolarHBondContact O-N 3.3Å
49	A	79.7	Confident	74	Confident	72 Å²	72	114.6 Å²	114.6	60%	0.595	58%	0.579	S	S	*	*	H	α-helix	trans	-63.7	-38	179	0	0	0	0	0	113.8	W47 E53	W47-A49 VanDerWaalsContact C-N 3.25Å; W47-A49 PolarHBondContact O-N 3.36Å; A49-E53 WeakPolarHBondContact O-CB 3.38Å; A49-E53 PolarHBondContact O-N 2.72Å
50	Y	78.2	Confident	73.5	Confident	150 Å²	150	112.2 Å²	112.2	59%	0.588	58%	0.577	S	S	*	*	H	α-helix	trans	-73.9	-38.3	178.4	175.9	-103.1	0	0	0	111.7	W47 P48 E53 K54	W47-Y50 PolarHBondContact O-N 3.34Å; P48-Y50 PolarHBondContact O-N 3Å; Y50-E53 PolarHBondContact O-N 3.42Å; Y50-K54 VanDerWaalsContact O-CB 3.28Å; Y50-K54 WeakPolarHBondContact O-CB 3.44Å; Y50-K54 PolarHBondContact O-N 2.86Å
51	E	72.8	Confident	73.1	Confident	73 Å²	73	108.7 Å²	108.7	34%	0.341	58%	0.578	S	S	.	*	H	α-helix	trans	-68.4	-39.9	175.2	-69.9	-171.5	-157.2	0	0	111.6	Y46 W47 P48 K54 N55	Y46-E51 WeakPolarHBondContact CD2-OE1 3.32Å; Y46-E51 VanDerWaalsContact CE2-CD 3.43Å; Y46-E51 WeakPolarHBondContact CE2-OE2 3.29Å; W47-E51 PolarHBondContact O-N 3.49Å; P48-E51 PolarHBondContact O-N 3.33Å; E51-K54 PolarHBondContact O-N 3.37Å; E51-N55 VanDerWaalsContact O-CB 3.23Å; E51-N55 WeakPolarHBondContact O-CB 3.5Å; E51-N55 PolarHBondContact O-N 3.27Å; E51-N55 PolarHBondContact O-OD1 3.36Å
52	E	74.8	Confident	72.8	Confident	132 Å²	132	108.3 Å²	108.3	62%	0.617	59%	0.589	S	S	*	*	H	α-helix	trans	-60.2	-46.6	171.2	-76.3	172.9	-166.2	0	0	111.6	P48 N55 C56	P48-E52 VanDerWaalsContact O-CB 3.29Å; P48-E52 WeakPolarHBondContact O-CB 3.3Å; P48-E52 WeakPolarHBondContact O-CG 3.37Å; P48-E52 PolarHBondContact O-N 3.3Å; E52-N55 PolarHBondContact O-N 3Å; E52-C56 WeakPolarHBondContact O-CB 3.47Å; E52-C56 PolarHBondContact O-N 3.43Å
53	E	78.2	Confident	72.8	Confident	144 Å²	144	112 Å²	112	67%	0.673	60%	0.603	S	S	*	*	H	α-helix	trans	-63.2	-45.6	177.2	-173.2	-178.2	179.1	0	0	111.9	A49 Y50 N55 C56 G57	A49-E53 WeakPolarHBondContact O-CB 3.38Å; A49-E53 PolarHBondContact O-N 2.72Å; Y50-E53 PolarHBondContact O-N 3.42Å; E53-N55 VanDerWaalsContact C-N 3.33Å; E53-N55 PolarHBondContact O-N 3.44Å; E53-C56 WeakPolarHBondContact O-CB 3.49Å; E53-C56 PolarHBondContact O-N 3.29Å; E53-G57 PolarHBondContact O-N 2.91Å
54	K	76.4	Confident	73.2	Confident	126 Å²	126	110.2 Å²	110.2	55%	0.548	60%	0.604	S	S	.	*	H	α-helix	trans	-58.5	-46.1	175	-178.3	-175.1	172.6	-165.9	0	110.9	Y50 E51 G57 Q58	Y50-K54 VanDerWaalsContact O-CB 3.28Å; Y50-K54 WeakPolarHBondContact O-CB 3.44Å; Y50-K54 PolarHBondContact O-N 2.86Å; E51-K54 PolarHBondContact O-N 3.37Å; K54-G57 PolarHBondContact O-N 3.35Å; K54-Q58 WeakPolarHBondContact O-CG 3.45Å
55	N	69.9	Low	73.6	Confident	91 Å²	91	111.7 Å²	111.7	49%	0.487	60%	0.599	S	S	.	*	H	α-helix	trans	-69.9	-33.4	179.8	-70.3	6.8	0	0	0	111.9	E51 E52 E53 G57 Q58	E51-N55 VanDerWaalsContact O-CB 3.23Å; E51-N55 WeakPolarHBondContact O-CB 3.5Å; E51-N55 PolarHBondContact O-N 3.27Å; E51-N55 PolarHBondContact O-OD1 3.36Å; E52-N55 PolarHBondContact O-N 3Å; E53-N55 VanDerWaalsContact C-N 3.33Å; E53-N55 PolarHBondContact O-N 3.44Å; N55-G57 VanDerWaalsContact C-N 3.28Å; N55-G57 PolarHBondContact O-N 3.49Å; N55-Q58 PolarHBondContact O-N 3.05Å
56	C	68.6	Low	73.7	Confident	100 Å²	100	112.5 Å²	112.5	68%	0.676	61%	0.613	S	S	*	*	H	α-helix	trans	-59	-41	176.2	-171.2	0	0	0	0	111	E52 E53 Q58	E52-C56 WeakPolarHBondContact O-CB 3.47Å; E52-C56 PolarHBondContact O-N 3.43Å; E53-C56 WeakPolarHBondContact O-CB 3.49Å; E53-C56 PolarHBondContact O-N 3.29Å; C56-Q58 VanDerWaalsContact C-N 3.3Å; C56-Q58 PolarHBondContact O-N 3.04Å
57	G	69.1	Low	74	Confident	56 Å²	56	108 Å²	108	58%	0.577	61%	0.608	S	S	*	*	H	α-helix	trans	-69	-23.3	175.8	0	0	0	0	0	114.6	E53 K54 N55 N59	E53-G57 PolarHBondContact O-N 2.91Å; K54-G57 PolarHBondContact O-N 3.35Å; N55-G57 VanDerWaalsContact C-N 3.28Å; N55-G57 PolarHBondContact O-N 3.49Å; G57-N59 PolarHBondContact O-N 3.49Å; G57-N59 PolarHBondContact O-ND2 3.5Å
58	Q	70.2	Confident	73.8	Confident	111 Å²	111	108.8 Å²	108.8	52%	0.519	62%	0.621	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.3	-4.7	-175.5	-64.7	-171.3	-77.9	0	0	113.7	K54 N55 C56 L60	K54-Q58 WeakPolarHBondContact O-CG 3.45Å; N55-Q58 PolarHBondContact O-N 3.05Å; C56-Q58 VanDerWaalsContact C-N 3.3Å; C56-Q58 PolarHBondContact O-N 3.04Å; Q58-L60 HydrophobicContact CB-CD1 3.21Å; Q58-L60 HydrophobicContact CG-CD1 4.31Å; Q58-L60 PolarHBondContact O-N 3.01Å
59	N	69.7	Low	73.5	Confident	142 Å²	142	114.2 Å²	114.2	76%	0.759	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	42	41	175.9	-71.6	-83.3	0	0	0	112.6	G57	G57-N59 PolarHBondContact O-N 3.49Å; G57-N59 PolarHBondContact O-ND2 3.5Å
60	L	71.7	Confident	72.8	Confident	103 Å²	103	113.9 Å²	113.9	54%	0.539	65%	0.645	S	S	.	*	P	Polyproline II helix	trans	-64.9	138.2	-179.4	-85.1	86.1	0	0	0	108.4	Q58	Q58-L60 HydrophobicContact CB-CD1 3.21Å; Q58-L60 HydrophobicContact CG-CD1 4.31Å; Q58-L60 PolarHBondContact O-N 3.01Å
61	P	73.8	Confident	71.9	Confident	104 Å²	104	113.6 Å²	113.6	68%	0.675	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-56	150.9	165.9	25.2	-32	0	0	0	109	L63	P61-L63 PolarHBondContact O-N 3.41Å; P61-L63 VanDerWaalsContact O-N 3.09Å
62	P	71.7	Confident	71.6	Confident	129 Å²	129	120.7 Å²	120.7	84%	0.838	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-48.5	123	179.4	-24	31.5	0	0	0	110.2
63	L	70.7	Confident	71.5	Confident	144 Å²	144	120.2 Å²	120.2	75%	0.754	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-63.2	134.6	173.6	-76.6	162.9	0	0	0	108.1	P61	P61-L63 PolarHBondContact O-N 3.41Å; P61-L63 VanDerWaalsContact O-N 3.09Å
64	P	76.7	Confident	71.1	Confident	104 Å²	104	118.9 Å²	118.9	68%	0.675	70%	0.695	S	S	*	*	P	Polyproline II helix	trans	-59	148.4	171.1	26.3	-32.7	0	0	0	109.1
65	P	77.7	Confident	70.8	Confident	114 Å²	114	118.5 Å²	118.5	74%	0.74	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-54.2	144.1	176.2	23.6	-33	0	0	0	109.8	A67	P65-A67 PolarHBondContact O-N 3.16Å
66	P	73	Confident	70.9	Confident	114 Å²	114	120.1 Å²	120.1	74%	0.74	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-55.1	134.4	177.7	23.3	-32.5	0	0	0	109.5	I68	P66-I68 PolarHBondContact O-N 2.87Å
67	A	75.9	Confident	71	Confident	63 Å²	63	121.4 Å²	121.4	52%	0.521	72%	0.719	S	S	.	*	P	Polyproline II helix	trans	-59.9	131.3	176.4	0	0	0	0	0	109.3	P65 E69 G70	P65-A67 PolarHBondContact O-N 3.16Å; A67-E69 HydrophobicContact CB-CB 4.43Å; A67-E69 PolarHBondContact O-N 3.27Å; A67-G70 PolarHBondContact O-N 3.05Å; A67-G70 VanDerWaalsContact O-N 3.16Å
68	I	73.8	Confident	71.1	Confident	152 Å²	152	125.7 Å²	125.7	78%	0.779	73%	0.728	S	S	*	*	G	3₁₀ helix	trans	-54.2	-24.4	175.4	-102.1	154.3	0	0	0	112.1	P66 G70 L71	P66-I68 PolarHBondContact O-N 2.87Å; I68-G70 PolarHBondContact O-N 3.08Å; I68-G70 VanDerWaalsContact O-N 3.08Å; I68-L71 PolarHBondContact O-N 3.02Å; I68-L71 VanDerWaalsContact O-N 3.11Å
69	E	71.4	Confident	71.2	Confident	174 Å²	174	126.8 Å²	126.8	81%	0.813	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-58.3	-18.7	178.5	-63.9	176.5	166.1	0	0	114.3	A67	A67-E69 HydrophobicContact CB-CB 4.43Å; A67-E69 PolarHBondContact O-N 3.27Å
70	G	64.1	Low	71.3	Confident	66 Å²	66	125.6 Å²	125.6	68%	0.68	74%	0.742	S	S	*	*	G	3₁₀ helix	trans	-102.2	3.5	177.8	0	0	0	0	0	115.8	A67 I68	A67-G70 PolarHBondContact O-N 3.05Å; A67-G70 VanDerWaalsContact O-N 3.16Å; I68-G70 PolarHBondContact O-N 3.08Å; I68-G70 VanDerWaalsContact O-N 3.08Å
71	L	60.4	Low	71.3	Confident	144 Å²	144	127.5 Å²	127.5	75%	0.754	76%	0.759	S	S	*	*			trans	-97.9	10.8	-176	-128.5	79.3	0	0	0	114.2	I68	I68-L71 PolarHBondContact O-N 3.02Å; I68-L71 VanDerWaalsContact O-N 3.11Å
72	I	66.1	Low	71.1	Confident	222 Å²	222	129.6 Å²	129.6	100%	1.138	77%	0.767	S	S	*	*			trans	-113.4	0	177.5	55.9	163.3	0	0	0	112.2

Retrieved 72 of 72 residues in 113.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).