A0A077ZDJ7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZDJ7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 80 aa.

						>A0A077ZDJ7_TRITR|A0A077ZDJ7
MRIIVLRRYLIDHLETFIEKMAKSKIGIIYQASHLAQFVGEKKSLKQRIHVASSALILQTNMASVFLAVPPKRSTNKTGT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62	Low	77.9	Confident	196 Å²	196	143 Å²	143	97%	0.966	65%	0.651	S	S	*	*				0	-49.5	0	-162.4	171.6	178.2	0	0	113.8	I3 I4 V5	M1-I3 VanDerWaalsContact C-N 3.28Å; M1-I3 PolarHBondContact O-N 2.98Å; M1-I3 VanDerWaalsContact O-N 3.13Å; M1-I4 PolarHBondContact O-N 3.36Å; M1-V5 PolarHBondContact O-N 2.85Å
2	R	70.6	Confident	78.5	Confident	229 Å²	229	139 Å²	139	86%	0.864	64%	0.639	S	S	*	*	H	α-helix	trans	-52.9	-35.2	-174.8	-65.3	-177.5	178.5	173.2	-1.2	115.5	I4 V5 L6	R2-I4 PolarHBondContact O-N 2.95Å; R2-V5 PolarHBondContact O-N 2.84Å; R2-L6 PolarHBondContact O-N 2.97Å; R2-L6 VanDerWaalsContact O-N 3.11Å
3	I	74.6	Confident	78.8	Confident	149 Å²	149	136.4 Å²	136.4	76%	0.764	63%	0.627	S	S	*	*	H	α-helix	trans	-66.1	-35.1	178.7	-61.3	171.1	0	0	0	112.3	M1 R7	M1-I3 VanDerWaalsContact C-N 3.28Å; M1-I3 PolarHBondContact O-N 2.98Å; M1-I3 VanDerWaalsContact O-N 3.13Å; I3-R7 PolarHBondContact O-N 3.44Å; I3-R7 VanDerWaalsContact O-N 3.07Å
4	I	80.4	Confident	78.9	Confident	111 Å²	111	134 Å²	134	57%	0.569	62%	0.621	S	S	*	*	H	α-helix	trans	-71.2	-38.7	179.3	-61.1	172.1	0	0	0	110.5	M1 R2 R7 R8	M1-I4 PolarHBondContact O-N 3.36Å; R2-I4 PolarHBondContact O-N 2.95Å; I4-R7 PolarHBondContact O-N 3.47Å; I4-R8 PolarHBondContact O-N 2.78Å; I4-R8 VanDerWaalsContact O-N 3.14Å
5	V	77.1	Confident	78.9	Confident	87 Å²	87	133.7 Å²	133.7	53%	0.527	62%	0.62	S	S	.	*	H	α-helix	trans	-64.3	-45.3	176.5	-179	0	0	0	0	110.4	M1 R2 R7 R8 Y9	M1-V5 PolarHBondContact O-N 2.85Å; R2-V5 PolarHBondContact O-N 2.84Å; V5-R7 VanDerWaalsContact C-N 3.32Å; V5-R7 PolarHBondContact O-N 3.26Å; V5-R8 PolarHBondContact O-N 2.66Å; V5-Y9 WeakPolarHBondContact O-CB 3.27Å; V5-Y9 PolarHBondContact O-N 3.36Å
6	L	80.7	Confident	78.8	Confident	105 Å²	105	129.6 Å²	129.6	55%	0.55	61%	0.607	S	S	.	*	H	α-helix	trans	-63.2	-38.3	178.3	-170.9	65.9	0	0	0	112.1	R2 Y9 L10	R2-L6 PolarHBondContact O-N 2.97Å; R2-L6 VanDerWaalsContact O-N 3.11Å; L6-Y9 PolarHBondContact O-N 3.13Å; L6-L10 WeakPolarHBondContact O-CG 3.41Å; L6-L10 PolarHBondContact O-N 2.97Å
7	R	77.7	Confident	78.7	Confident	186 Å²	186	128.7 Å²	128.7	70%	0.702	60%	0.601	S	S	*	*	H	α-helix	trans	-63.4	-43.2	176.4	-164.1	-172.9	-154.9	178.2	7.5	112.2	I3 I4 V5 L10 I11	I3-R7 PolarHBondContact O-N 3.44Å; I3-R7 VanDerWaalsContact O-N 3.07Å; I4-R7 PolarHBondContact O-N 3.47Å; V5-R7 VanDerWaalsContact C-N 3.32Å; V5-R7 PolarHBondContact O-N 3.26Å; R7-L10 PolarHBondContact O-N 3.4Å; R7-I11 HydrophobicContact CG-CD1 4.38Å; R7-I11 WeakPolarHBondContact O-CG1 3.35Å; R7-I11 PolarHBondContact O-N 3.45Å; R7-I11 VanDerWaalsContact O-N 3.17Å
8	R	83.7	Confident	78.5	Confident	175 Å²	175	127.6 Å²	127.6	66%	0.66	60%	0.599	S	S	*	*	H	α-helix	trans	-64.8	-44	176.4	-71.9	-175.6	-179.1	-127.6	2.1	111.3	I4 V5 L10 I11 D12	I4-R8 PolarHBondContact O-N 2.78Å; I4-R8 VanDerWaalsContact O-N 3.14Å; V5-R8 PolarHBondContact O-N 2.66Å; R8-L10 VanDerWaalsContact C-N 3.3Å; R8-L10 PolarHBondContact O-N 3.38Å; R8-I11 PolarHBondContact O-N 3.22Å; R8-I11 VanDerWaalsContact O-N 3.11Å; R8-D12 PolarHBondContact O-N 3.41Å
9	Y	82.8	Confident	78.3	Confident	141 Å²	141	126.2 Å²	126.2	55%	0.553	59%	0.592	S	S	*	*	H	α-helix	trans	-57.3	-42	175.8	-178.7	-98.1	0	0	0	112.7	V5 L6 H13	V5-Y9 WeakPolarHBondContact O-CB 3.27Å; V5-Y9 PolarHBondContact O-N 3.36Å; L6-Y9 PolarHBondContact O-N 3.13Å; Y9-H13 VanDerWaalsContact O-CB 3.23Å; Y9-H13 WeakPolarHBondContact O-CB 3.33Å; Y9-H13 PolarHBondContact O-N 2.85Å
10	L	83.8	Confident	78.1	Confident	97 Å²	97	127.1 Å²	127.1	51%	0.508	59%	0.594	S	S	.	*	H	α-helix	trans	-66.7	-36	176.7	-71.6	172.5	0	0	0	112.8	L6 R7 R8 L14	L6-L10 WeakPolarHBondContact O-CG 3.41Å; L6-L10 PolarHBondContact O-N 2.97Å; R7-L10 PolarHBondContact O-N 3.4Å; R8-L10 VanDerWaalsContact C-N 3.3Å; R8-L10 PolarHBondContact O-N 3.38Å; L10-L14 WeakPolarHBondContact O-CB 3.48Å; L10-L14 VanDerWaalsContact O-CG 3.22Å; L10-L14 WeakPolarHBondContact O-CG 3.28Å; L10-L14 PolarHBondContact O-N 3.06Å
11	I	83.9	Confident	77.4	Confident	97 Å²	97	124.8 Å²	124.8	50%	0.497	58%	0.584	S	S	.	*	H	α-helix	trans	-68.6	-49.5	177	-67.2	166.1	0	0	0	110.2	R7 R8 H13 L14 E15	R7-I11 HydrophobicContact CG-CD1 4.38Å; R7-I11 WeakPolarHBondContact O-CG1 3.35Å; R7-I11 PolarHBondContact O-N 3.45Å; R7-I11 VanDerWaalsContact O-N 3.17Å; R8-I11 PolarHBondContact O-N 3.22Å; R8-I11 VanDerWaalsContact O-N 3.11Å; I11-H13 VanDerWaalsContact C-N 3.26Å; I11-H13 PolarHBondContact O-N 3.23Å; I11-L14 PolarHBondContact O-N 3.36Å; I11-L14 VanDerWaalsContact O-N 3.13Å; I11-E15 PolarHBondContact O-N 3.47Å
12	D	85.3	Confident	77.5	Confident	95 Å²	95	117.6 Å²	117.6	51%	0.508	56%	0.556	S	S	.	*	H	α-helix	trans	-60.3	-38.7	178.4	-68.6	-2.1	0	0	0	111.4	R8 E15 T16	R8-D12 PolarHBondContact O-N 3.41Å; D12-E15 PolarHBondContact O-N 2.89Å; D12-T16 WeakPolarHBondContact O-CB 3.36Å; D12-T16 PolarHBondContact O-N 2.75Å; D12-T16 PolarHBondContact O-OG1 2.96Å
13	H	82.2	Confident	77.2	Confident	105 Å²	105	113.3 Å²	113.3	49%	0.486	54%	0.543	S	S	.	.	H	α-helix	trans	-70.8	-36.4	177.9	-164.2	-67.3	0	0	0	112.2	Y9 I11 F17	Y9-H13 VanDerWaalsContact O-CB 3.23Å; Y9-H13 WeakPolarHBondContact O-CB 3.33Å; Y9-H13 PolarHBondContact O-N 2.85Å; I11-H13 VanDerWaalsContact C-N 3.26Å; I11-H13 PolarHBondContact O-N 3.23Å; H13-F17 VanDerWaalsContact O-CB 3.3Å; H13-F17 WeakPolarHBondContact O-CB 3.49Å; H13-F17 PolarHBondContact O-N 3.42Å
14	L	79.9	Confident	76.6	Confident	103 Å²	103	110 Å²	110	54%	0.539	53%	0.533	S	S	.	.	H	α-helix	trans	-68.3	-40.2	173.9	-77.4	170.3	0	0	0	111.6	L10 I11 F17 I18	L10-L14 WeakPolarHBondContact O-CB 3.48Å; L10-L14 VanDerWaalsContact O-CG 3.22Å; L10-L14 WeakPolarHBondContact O-CG 3.28Å; L10-L14 PolarHBondContact O-N 3.06Å; I11-L14 PolarHBondContact O-N 3.36Å; I11-L14 VanDerWaalsContact O-N 3.13Å; L14-F17 PolarHBondContact O-N 3.4Å; L14-I18 WeakPolarHBondContact O-CB 3.27Å; L14-I18 VanDerWaalsContact O-CG1 3.24Å; L14-I18 WeakPolarHBondContact O-CG1 3.12Å; L14-I18 PolarHBondContact O-N 2.92Å
15	E	79.2	Confident	75.4	Confident	129 Å²	129	108.9 Å²	108.9	60%	0.603	53%	0.525	S	S	*	.	H	α-helix	trans	-61.5	-48.2	175.7	-173.8	170.4	-161.6	0	0	111	I11 D12 F17 I18 E19	I11-E15 PolarHBondContact O-N 3.47Å; D12-E15 PolarHBondContact O-N 2.89Å; E15-F17 VanDerWaalsContact C-N 3.31Å; E15-F17 PolarHBondContact O-N 3.37Å; E15-I18 PolarHBondContact O-N 2.88Å; E15-E19 WeakPolarHBondContact O-CB 3.25Å; E15-E19 PolarHBondContact O-N 3.39Å
16	T	77.8	Confident	74.4	Confident	68 Å²	68	110.1 Å²	110.1	42%	0.417	53%	0.527	S	S	.	.	H	α-helix	trans	-60.9	-39.7	175.1	-55.9	0	0	0	0	112	D12 E19 K20	D12-T16 WeakPolarHBondContact O-CB 3.36Å; D12-T16 PolarHBondContact O-N 2.75Å; D12-T16 PolarHBondContact O-OG1 2.96Å; T16-E19 PolarHBondContact O-N 2.86Å; T16-K20 HydrophobicContact CG2-CD 4.39Å; T16-K20 WeakPolarHBondContact O-CB 3.37Å; T16-K20 WeakPolarHBondContact O-CG 3.36Å; T16-K20 PolarHBondContact O-N 3.07Å
17	F	77.1	Confident	73.3	Confident	115 Å²	115	106.8 Å²	106.8	50%	0.504	52%	0.518	S	S	.	.	H	α-helix	trans	-65.4	-43.7	177	-176.4	-96.7	0	0	0	111.3	H13 L14 E15 M21	H13-F17 VanDerWaalsContact O-CB 3.3Å; H13-F17 WeakPolarHBondContact O-CB 3.49Å; H13-F17 PolarHBondContact O-N 3.42Å; L14-F17 PolarHBondContact O-N 3.4Å; E15-F17 VanDerWaalsContact C-N 3.31Å; E15-F17 PolarHBondContact O-N 3.37Å; F17-M21 HydrophobicContact CE1-SD 4.01Å; F17-M21 HydrophobicContact CZ-SD 4.5Å; F17-M21 WeakPolarHBondContact O-CB 3.42Å; F17-M21 PolarHBondContact O-N 2.89Å
18	I	73.9	Confident	72.3	Confident	109 Å²	109	102.4 Å²	102.4	56%	0.559	51%	0.507	S	S	*	.	H	α-helix	trans	-65.7	-41	176.6	-68.7	165.2	0	0	0	110.5	L14 E15 M21 A22	L14-I18 WeakPolarHBondContact O-CB 3.27Å; L14-I18 VanDerWaalsContact O-CG1 3.24Å; L14-I18 WeakPolarHBondContact O-CG1 3.12Å; L14-I18 PolarHBondContact O-N 2.92Å; E15-I18 PolarHBondContact O-N 2.88Å; I18-M21 CarbonylContact O-C 3.43Å; I18-M21 PolarHBondContact O-N 2.99Å; I18-A22 WeakPolarHBondContact O-CA 3.41Å; I18-A22 WeakPolarHBondContact O-CB 3.3Å; I18-A22 PolarHBondContact O-N 3.29Å
19	E	75.1	Confident	71.2	Confident	100 Å²	100	99 Å²	99	47%	0.467	50%	0.501	S	S	.	.	H	α-helix	trans	-66.3	-42.6	179.4	-162.3	-166.8	162.5	0	0	111.5	E15 T16 A22 K23	E15-E19 WeakPolarHBondContact O-CB 3.25Å; E15-E19 PolarHBondContact O-N 3.39Å; T16-E19 PolarHBondContact O-N 2.86Å; E19-A22 PolarHBondContact O-N 3.45Å; E19-K23 WeakPolarHBondContact O-CB 3.27Å; E19-K23 WeakPolarHBondContact O-CG 3.18Å; E19-K23 PolarHBondContact O-N 2.84Å; E19-K23 VanDerWaalsContact OE1-CE 3.24Å; E19-K23 WeakPolarHBondContact OE1-CE 3.27Å; E19-K23 IonicContact OE1-NZ 2.66Å; E19-K23 PolarHBondContact OE1-NZ 3.47Å
20	K	73.6	Confident	70.1	Confident	145 Å²	145	100.7 Å²	100.7	63%	0.63	51%	0.508	S	S	*	.	H	α-helix	trans	-63.7	-43	172.3	-75.4	-179.9	-179.6	179.2	0	111.4	T16 A22 K23 S24	T16-K20 HydrophobicContact CG2-CD 4.39Å; T16-K20 WeakPolarHBondContact O-CB 3.37Å; T16-K20 WeakPolarHBondContact O-CG 3.36Å; T16-K20 PolarHBondContact O-N 3.07Å; K20-A22 VanDerWaalsContact C-N 3.31Å; K20-A22 PolarHBondContact O-N 3.17Å; K20-K23 PolarHBondContact O-N 3.41Å; K20-S24 VanDerWaalsContact O-CB 3.24Å; K20-S24 WeakPolarHBondContact O-CB 3.31Å; K20-S24 PolarHBondContact O-N 3.4Å
21	M	64.2	Low	69	Low	78 Å²	78	102 Å²	102	38%	0.384	51%	0.512	S	S	.	.	H	α-helix	trans	-68.2	-33.2	177.8	-155.2	-177.8	-145.9	0	0	111	F17 I18 K25	F17-M21 HydrophobicContact CE1-SD 4.01Å; F17-M21 HydrophobicContact CZ-SD 4.5Å; F17-M21 WeakPolarHBondContact O-CB 3.42Å; F17-M21 PolarHBondContact O-N 2.89Å; I18-M21 CarbonylContact O-C 3.43Å; I18-M21 PolarHBondContact O-N 2.99Å; M21-K25 VanDerWaalsContact CE-CE 3.48Å; M21-K25 HydrophobicContact CG-CD 3.74Å; M21-K25 HydrophobicContact CG-CG 4.07Å; M21-K25 WeakPolarHBondContact O-CA 3.36Å; M21-K25 WeakPolarHBondContact O-CB 3.36Å; M21-K25 WeakPolarHBondContact O-CG 3.22Å; M21-K25 PolarHBondContact O-N 3.42Å; M21-K25 HydrophobicContact SD-CD 4.15Å; M21-K25 WeakPolarHBondContact SD-CE 3.36Å; M21-K25 PolarHBondContact SD-NZ 3.46Å
22	A	64.3	Low	67.8	Low	45 Å²	45	100 Å²	100	37%	0.372	51%	0.509	S	S	.	.	H	α-helix	trans	-70.5	-45.3	175.2	0	0	0	0	0	110.5	I18 E19 K20 S24 K25 I26	I18-A22 WeakPolarHBondContact O-CA 3.41Å; I18-A22 WeakPolarHBondContact O-CB 3.3Å; I18-A22 PolarHBondContact O-N 3.29Å; E19-A22 PolarHBondContact O-N 3.45Å; K20-A22 VanDerWaalsContact C-N 3.31Å; K20-A22 PolarHBondContact O-N 3.17Å; A22-S24 VanDerWaalsContact C-N 3.34Å; A22-S24 PolarHBondContact O-N 3.18Å; A22-K25 CarbonylContact O-C 3.42Å; A22-K25 PolarHBondContact O-N 2.74Å; A22-I26 WeakPolarHBondContact O-CB 3.37Å; A22-I26 VanDerWaalsContact O-CD1 3.32Å; A22-I26 WeakPolarHBondContact O-CD1 3.27Å; A22-I26 WeakPolarHBondContact O-CG1 3.44Å; A22-I26 PolarHBondContact O-N 3.27Å
23	K	64.6	Low	66.7	Low	139 Å²	139	98.7 Å²	98.7	60%	0.604	51%	0.508	S	S	*	.	H	α-helix	trans	-61.3	-41.5	173.6	-72.4	175.6	-174.3	168.7	0	112	E19 K20	E19-K23 WeakPolarHBondContact O-CB 3.27Å; E19-K23 WeakPolarHBondContact O-CG 3.18Å; E19-K23 PolarHBondContact O-N 2.84Å; E19-K23 VanDerWaalsContact OE1-CE 3.24Å; E19-K23 WeakPolarHBondContact OE1-CE 3.27Å; E19-K23 IonicContact OE1-NZ 2.66Å; E19-K23 PolarHBondContact OE1-NZ 3.47Å; K20-K23 PolarHBondContact O-N 3.41Å
24	S	61.5	Low	65.7	Low	80 Å²	80	98.4 Å²	98.4	56%	0.559	51%	0.506	S	S	*	.	H	α-helix	trans	-71.1	-39.1	175.6	-178.5	0	0	0	0	112.5	K20 A22 G27	K20-S24 VanDerWaalsContact O-CB 3.24Å; K20-S24 WeakPolarHBondContact O-CB 3.31Å; K20-S24 PolarHBondContact O-N 3.4Å; A22-S24 VanDerWaalsContact C-N 3.34Å; A22-S24 PolarHBondContact O-N 3.18Å; S24-G27 PolarHBondContact O-N 3.39Å
25	K	55.7	Low	64.8	Low	88 Å²	88	98.5 Å²	98.5	38%	0.383	51%	0.507	S	S	.	.	H	α-helix	trans	-81.2	-16.1	178.9	-74.7	178.3	174.2	177.3	0	113.6	M21 A22 G27 I28 I29	M21-K25 VanDerWaalsContact CE-CE 3.48Å; M21-K25 HydrophobicContact CG-CD 3.74Å; M21-K25 HydrophobicContact CG-CG 4.07Å; M21-K25 WeakPolarHBondContact O-CA 3.36Å; M21-K25 WeakPolarHBondContact O-CB 3.36Å; M21-K25 WeakPolarHBondContact O-CG 3.22Å; M21-K25 PolarHBondContact O-N 3.42Å; M21-K25 HydrophobicContact SD-CD 4.15Å; M21-K25 WeakPolarHBondContact SD-CE 3.36Å; M21-K25 PolarHBondContact SD-NZ 3.46Å; A22-K25 CarbonylContact O-C 3.42Å; A22-K25 PolarHBondContact O-N 2.74Å; K25-G27 PolarHBondContact O-N 2.74Å; K25-I28 HydrophobicContact CB-CB 4.41Å; K25-I28 HydrophobicContact CG-CB 4.46Å; K25-I28 HydrophobicContact CG-CD1 3.98Å; K25-I28 CarbonylContact O-C 3.5Å; K25-I28 WeakPolarHBondContact O-CA 3.46Å; K25-I28 PolarHBondContact O-N 2.85Å; K25-I29 HydrophobicContact CB-CD1 4.44Å; K25-I29 WeakPolarHBondContact O-CB 3.21Å; K25-I29 VanDerWaalsContact O-CG1 3.27Å; K25-I29 WeakPolarHBondContact O-CG1 3.45Å; K25-I29 PolarHBondContact O-N 3.08Å
26	I	54.6	Low	63.9	Low	113 Å²	113	94.9 Å²	94.9	58%	0.579	50%	0.499	S	S	*	.	H	α-helix	trans	-61.3	-35.2	169.5	-76.2	155.2	0	0	0	108.9	A22 Y30	A22-I26 WeakPolarHBondContact O-CB 3.37Å; A22-I26 VanDerWaalsContact O-CD1 3.32Å; A22-I26 WeakPolarHBondContact O-CD1 3.27Å; A22-I26 WeakPolarHBondContact O-CG1 3.44Å; A22-I26 PolarHBondContact O-N 3.27Å; I26-Y30 WeakPolarHBondContact O-CB 3.42Å; I26-Y30 PolarHBondContact O-N 2.91Å
27	G	57.5	Low	63	Low	35 Å²	35	98.7 Å²	98.7	36%	0.361	51%	0.512	S	S	.	.	H	α-helix	trans	-63.2	-39.8	167	0	0	0	0	0	113.4	S24 K25 Q31	S24-G27 PolarHBondContact O-N 3.39Å; K25-G27 PolarHBondContact O-N 2.74Å; G27-Q31 WeakPolarHBondContact O-CB 3.33Å; G27-Q31 VanDerWaalsContact O-CG 3.23Å; G27-Q31 WeakPolarHBondContact O-CG 3.33Å; G27-Q31 PolarHBondContact O-N 3Å
28	I	58	Low	62	Low	93 Å²	93	99 Å²	99	48%	0.477	51%	0.513	S	S	.	.	H	α-helix	trans	-76.2	-35.2	-179.2	-57.8	171.1	0	0	0	112.3	K25 Q31 A32	K25-I28 HydrophobicContact CB-CB 4.41Å; K25-I28 HydrophobicContact CG-CB 4.46Å; K25-I28 HydrophobicContact CG-CD1 3.98Å; K25-I28 CarbonylContact O-C 3.5Å; K25-I28 WeakPolarHBondContact O-CA 3.46Å; K25-I28 PolarHBondContact O-N 2.85Å; I28-Q31 CarbonylContact O-C 3.5Å; I28-Q31 PolarHBondContact O-N 3.42Å; I28-A32 WeakPolarHBondContact O-CB 3.38Å; I28-A32 PolarHBondContact O-N 2.85Å
29	I	59.4	Low	61.2	Low	104 Å²	104	97.5 Å²	97.5	53%	0.533	51%	0.509	S	S	.	.	H	α-helix	trans	-74.2	-39.2	176.2	-66.9	167.4	0	0	0	108.8	K25 Q31 A32 S33	K25-I29 HydrophobicContact CB-CD1 4.44Å; K25-I29 WeakPolarHBondContact O-CB 3.21Å; K25-I29 VanDerWaalsContact O-CG1 3.27Å; K25-I29 WeakPolarHBondContact O-CG1 3.45Å; K25-I29 PolarHBondContact O-N 3.08Å; I29-Q31 VanDerWaalsContact C-N 3.33Å; I29-A32 PolarHBondContact O-N 3.43Å; I29-S33 VanDerWaalsContact O-CB 3.27Å; I29-S33 WeakPolarHBondContact O-CB 3.36Å; I29-S33 PolarHBondContact O-N 2.78Å; I29-S33 PolarHBondContact O-OG 3.19Å; I29-S33 VanDerWaalsContact O-OG 3.08Å
30	Y	60.3	Low	60.4	Low	176 Å²	176	95.9 Å²	95.9	69%	0.69	52%	0.519	S	S	*	.	H	α-helix	trans	-61.6	-43.3	170.2	-173.7	-97.2	0	0	0	111.1	I26 S33 H34	I26-Y30 WeakPolarHBondContact O-CB 3.42Å; I26-Y30 PolarHBondContact O-N 2.91Å; Y30-S33 PolarHBondContact O-N 3.48Å; Y30-H34 WeakPolarHBondContact O-CB 3.35Å; Y30-H34 PolarHBondContact O-N 2.72Å
31	Q	59.8	Low	59.7	Low	126 Å²	126	94.2 Å²	94.2	59%	0.589	51%	0.514	S	S	*	.	H	α-helix	trans	-64.5	-39.5	173	-76.7	178.2	42	0	0	112.7	G27 I28 I29 H34 L35	G27-Q31 WeakPolarHBondContact O-CB 3.33Å; G27-Q31 VanDerWaalsContact O-CG 3.23Å; G27-Q31 WeakPolarHBondContact O-CG 3.33Å; G27-Q31 PolarHBondContact O-N 3Å; I28-Q31 CarbonylContact O-C 3.5Å; I28-Q31 PolarHBondContact O-N 3.42Å; I29-Q31 VanDerWaalsContact C-N 3.33Å; Q31-H34 PolarHBondContact O-N 2.71Å; Q31-L35 WeakPolarHBondContact O-CB 3.33Å; Q31-L35 PolarHBondContact O-N 3.43Å
32	A	60.1	Low	59.3	Low	53 Å²	53	101 Å²	101	44%	0.438	54%	0.541	S	S	.	.	H	α-helix	trans	-70	-37.2	177.7	0	0	0	0	0	112.1	I28 I29 L35 A36	I28-A32 WeakPolarHBondContact O-CB 3.38Å; I28-A32 PolarHBondContact O-N 2.85Å; I29-A32 PolarHBondContact O-N 3.43Å; A32-L35 CarbonylContact O-C 3.48Å; A32-L35 WeakPolarHBondContact O-CB 3.27Å; A32-L35 PolarHBondContact O-N 3.31Å; A32-A36 VanDerWaalsContact O-CB 3.25Å; A32-A36 WeakPolarHBondContact O-CB 3.47Å; A32-A36 PolarHBondContact O-N 2.85Å
33	S	61.1	Low	59	Low	69 Å²	69	104.9 Å²	104.9	48%	0.483	55%	0.55	S	S	.	.	H	α-helix	trans	-67.8	-38.6	173	-70.7	0	0	0	0	111.3	I29 Y30 A36 Q37	I29-S33 VanDerWaalsContact O-CB 3.27Å; I29-S33 WeakPolarHBondContact O-CB 3.36Å; I29-S33 PolarHBondContact O-N 2.78Å; I29-S33 PolarHBondContact O-OG 3.19Å; I29-S33 VanDerWaalsContact O-OG 3.08Å; Y30-S33 PolarHBondContact O-N 3.48Å; S33-A36 CarbonylContact O-C 3.55Å; S33-A36 PolarHBondContact O-N 2.91Å; S33-Q37 WeakPolarHBondContact O-CB 3.49Å; S33-Q37 PolarHBondContact O-N 2.9Å
34	H	61.7	Low	59.1	Low	98 Å²	98	101.6 Å²	101.6	45%	0.454	54%	0.544	S	S	.	.	H	α-helix	trans	-65.7	-43	172	-170.3	-99.9	0	0	0	111.3	Y30 Q31 A36 Q37 F38	Y30-H34 WeakPolarHBondContact O-CB 3.35Å; Y30-H34 PolarHBondContact O-N 2.72Å; Q31-H34 PolarHBondContact O-N 2.71Å; H34-A36 VanDerWaalsContact C-N 3.29Å; H34-A36 PolarHBondContact O-N 3.5Å; H34-Q37 PolarHBondContact O-N 3.43Å; H34-F38 AromaticContact CE1-CD2 3.91Å; H34-F38 AromaticContact CE1-CE2 3.43Å; H34-F38 VanDerWaalsContact CE1-CE2 3.43Å; H34-F38 WeakPolarHBondContact CE1-CE2 3.23Å; H34-F38 AromaticContact NE2-CE2 3.91Å; H34-F38 WeakPolarHBondContact O-CD2 3.24Å; H34-F38 PolarHBondContact O-N 3.03Å
35	L	60.1	Low	59.5	Low	106 Å²	106	103.4 Å²	103.4	56%	0.555	55%	0.547	S	S	*	.	H	α-helix	trans	-59.9	-37.4	169.9	-94	148.4	0	0	0	112.2	Q31 A32 F38 V39	Q31-L35 WeakPolarHBondContact O-CB 3.33Å; Q31-L35 PolarHBondContact O-N 3.43Å; A32-L35 CarbonylContact O-C 3.48Å; A32-L35 WeakPolarHBondContact O-CB 3.27Å; A32-L35 PolarHBondContact O-N 3.31Å; L35-F38 CarbonylContact O-C 3.59Å; L35-F38 WeakPolarHBondContact O-CB 3.3Å; L35-F38 PolarHBondContact O-N 3.45Å; L35-V39 WeakPolarHBondContact O-CG2 3.49Å; L35-V39 PolarHBondContact O-N 3.13Å
36	A	60.9	Low	60.2	Low	53 Å²	53	107.3 Å²	107.3	44%	0.438	56%	0.564	S	S	.	*	H	α-helix	trans	-73	-26.9	175.4	0	0	0	0	0	113.4	A32 S33 H34 V39 G40	A32-A36 VanDerWaalsContact O-CB 3.25Å; A32-A36 WeakPolarHBondContact O-CB 3.47Å; A32-A36 PolarHBondContact O-N 2.85Å; S33-A36 CarbonylContact O-C 3.55Å; S33-A36 PolarHBondContact O-N 2.91Å; H34-A36 VanDerWaalsContact C-N 3.29Å; H34-A36 PolarHBondContact O-N 3.5Å; A36-V39 VanDerWaalsContact C-N 3.32Å; A36-V39 VanDerWaalsContact CA-CG2 3.49Å; A36-V39 HydrophobicContact CB-CG2 4.36Å; A36-V39 VanDerWaalsContact O-CA 3.28Å; A36-V39 WeakPolarHBondContact O-CA 3.48Å; A36-V39 WeakPolarHBondContact O-CB 3.46Å; A36-V39 PolarHBondContact O-N 3.28Å; A36-G40 PolarHBondContact O-N 2.85Å
37	Q	58.6	Low	61	Low	148 Å²	148	107.1 Å²	107.1	69%	0.692	56%	0.561	S	S	*	*	H	α-helix	trans	-74	-38.4	171.7	-161.4	169.6	-4.1	0	0	110.5	S33 H34 V39 G40	S33-Q37 WeakPolarHBondContact O-CB 3.49Å; S33-Q37 PolarHBondContact O-N 2.9Å; H34-Q37 PolarHBondContact O-N 3.43Å; Q37-V39 PolarHBondContact O-N 3.48Å; Q37-G40 PolarHBondContact O-N 3.11Å
38	F	57.5	Low	61.4	Low	121 Å²	121	108.2 Å²	108.2	53%	0.531	55%	0.554	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64	-14.7	162.6	-87.1	-93.3	0	0	0	112.6	H34 L35	H34-F38 AromaticContact CE1-CD2 3.91Å; H34-F38 AromaticContact CE1-CE2 3.43Å; H34-F38 VanDerWaalsContact CE1-CE2 3.43Å; H34-F38 WeakPolarHBondContact CE1-CE2 3.23Å; H34-F38 AromaticContact NE2-CE2 3.91Å; H34-F38 WeakPolarHBondContact O-CD2 3.24Å; H34-F38 PolarHBondContact O-N 3.03Å; L35-F38 CarbonylContact O-C 3.59Å; L35-F38 WeakPolarHBondContact O-CB 3.3Å; L35-F38 PolarHBondContact O-N 3.45Å
39	V	56.3	Low	62.3	Low	77 Å²	77	108.7 Å²	108.7	47%	0.467	56%	0.556	S	S	.	*	T	Hydrogen-bonded Turn	trans	-71.7	-29.2	168.6	173.9	0	0	0	0	113.8	L35 A36 Q37 R48	L35-V39 WeakPolarHBondContact O-CG2 3.49Å; L35-V39 PolarHBondContact O-N 3.13Å; A36-V39 VanDerWaalsContact C-N 3.32Å; A36-V39 VanDerWaalsContact CA-CG2 3.49Å; A36-V39 HydrophobicContact CB-CG2 4.36Å; A36-V39 VanDerWaalsContact O-CA 3.28Å; A36-V39 WeakPolarHBondContact O-CA 3.48Å; A36-V39 WeakPolarHBondContact O-CB 3.46Å; A36-V39 PolarHBondContact O-N 3.28Å; Q37-V39 PolarHBondContact O-N 3.48Å; V39-R48 VanDerWaalsContact CB-CZ 3.46Å; V39-R48 VanDerWaalsContact CG2-CZ 3.48Å; V39-R48 PolarHBondContact O-NH1 3.49Å
40	G	57.8	Low	63.3	Low	67 Å²	67	109.7 Å²	109.7	69%	0.691	56%	0.558	S	S	*	*	S	Bend	trans	-79.1	-17.4	-174.4	0	0	0	0	0	115.5	A36 Q37	A36-G40 PolarHBondContact O-N 2.85Å; Q37-G40 PolarHBondContact O-N 3.11Å
41	E	58.9	Low	64.2	Low	109 Å²	109	106.1 Å²	106.1	51%	0.509	56%	0.555	S	S	.	*	S	Bend	trans	-73.9	131.5	175.6	-66.1	-168.7	163.4	0	0	110	K43	E41-K43 PolarHBondContact O-N 3.4Å
42	K	57.6	Low	65.1	Low	222 Å²	222	102.6 Å²	102.6	97%	0.965	55%	0.547	S	S	*	.	S	Bend	trans	-61.7	45.6	-175.7	-65.6	-178.9	176.7	179.1	0	115
43	K	56.7	Low	66.1	Low	126 Å²	126	102.9 Å²	102.9	55%	0.548	55%	0.546	S	S	.	.	S	Bend	trans	-102.9	130.5	172.9	-71.2	-179.8	-177.8	165.6	0	108.1	E41 L45 R48	E41-K43 PolarHBondContact O-N 3.4Å; K43-L45 PolarHBondContact O-N 3.14Å; K43-R48 WeakPolarHBondContact O-CD 3.11Å
44	S	67.1	Low	67	Low	70 Å²	70	101.6 Å²	101.6	49%	0.49	54%	0.537	S	S	.	.			trans	-46.4	133.1	-176.5	176.4	0	0	0	0	110.6	K46 Q47 R48	S44-K46 PolarHBondContact O-N 3Å; S44-Q47 WeakPolarHBondContact O-CA 3.18Å; S44-Q47 WeakPolarHBondContact O-CB 3.2Å; S44-Q47 PolarHBondContact O-N 3.28Å; S44-R48 PolarHBondContact O-N 2.97Å
45	L	69	Low	67.9	Low	117 Å²	117	98.8 Å²	98.8	61%	0.613	53%	0.531	S	S	*	.	H	α-helix	trans	-45.4	-37.3	176.4	179.4	62.6	0	0	0	111.8	K43 Q47 R48 I49	K43-L45 PolarHBondContact O-N 3.14Å; L45-Q47 PolarHBondContact O-N 2.97Å; L45-R48 PolarHBondContact O-N 3.4Å; L45-I49 HydrophobicContact CD1-CD1 4.16Å; L45-I49 HydrophobicContact CD1-CG1 4.38Å; L45-I49 HydrophobicContact CD2-CD1 4.49Å; L45-I49 HydrophobicContact CG-CD1 3.86Å; L45-I49 HydrophobicContact CG-CG1 4.47Å; L45-I49 WeakPolarHBondContact O-CG1 3.32Å; L45-I49 PolarHBondContact O-N 2.88Å
46	K	71.9	Confident	68.9	Low	171 Å²	171	98.9 Å²	98.9	74%	0.743	53%	0.531	S	S	*	.	H	α-helix	trans	-56.9	-44.6	174.6	-173	178.1	-178.8	179.7	0	113.1	S44 R48 H50	S44-K46 PolarHBondContact O-N 3Å; K46-R48 VanDerWaalsContact C-N 3.32Å; K46-R48 PolarHBondContact O-N 2.94Å; K46-H50 WeakPolarHBondContact O-CB 2.97Å; K46-H50 PolarHBondContact O-N 2.96Å
47	Q	71.6	Confident	69.8	Low	109 Å²	109	100.7 Å²	100.7	51%	0.509	53%	0.533	S	S	.	.	H	α-helix	trans	-64.4	-39.8	179.5	-70.4	176.5	-40.9	0	0	111.3	S44 L45 H50 V51	S44-Q47 WeakPolarHBondContact O-CA 3.18Å; S44-Q47 WeakPolarHBondContact O-CB 3.2Å; S44-Q47 PolarHBondContact O-N 3.28Å; L45-Q47 PolarHBondContact O-N 2.97Å; Q47-H50 WeakPolarHBondContact O-CB 3.11Å; Q47-H50 PolarHBondContact O-N 3.32Å; Q47-V51 VanDerWaalsContact O-CG2 3.27Å; Q47-V51 WeakPolarHBondContact O-CG2 3.35Å; Q47-V51 PolarHBondContact O-N 3.33Å
48	R	64.7	Low	70.8	Confident	57 Å²	57	99.3 Å²	99.3	22%	0.215	53%	0.529	C	S	.	.	H	α-helix	trans	-74.1	-38.6	-178.7	-64.2	149.7	36.5	119.7	67.1	112.7	V39 K43 S44 L45 K46 H50 V51 A52	V39-R48 VanDerWaalsContact CB-CZ 3.46Å; V39-R48 VanDerWaalsContact CG2-CZ 3.48Å; V39-R48 PolarHBondContact O-NH1 3.49Å; K43-R48 WeakPolarHBondContact O-CD 3.11Å; S44-R48 PolarHBondContact O-N 2.97Å; L45-R48 PolarHBondContact O-N 3.4Å; K46-R48 VanDerWaalsContact C-N 3.32Å; K46-R48 PolarHBondContact O-N 2.94Å; R48-H50 VanDerWaalsContact C-N 3.26Å; R48-V51 PolarHBondContact O-N 3.11Å; R48-A52 VanDerWaalsContact O-CB 3.3Å; R48-A52 WeakPolarHBondContact O-CB 3.44Å; R48-A52 PolarHBondContact O-N 2.99Å
49	I	78.1	Confident	71.8	Confident	103 Å²	103	99.7 Å²	99.7	53%	0.528	53%	0.533	S	S	.	.	H	α-helix	trans	-61.2	-42.6	171.4	-68.2	170.7	0	0	0	109.2	L45 A52 S53	L45-I49 HydrophobicContact CD1-CD1 4.16Å; L45-I49 HydrophobicContact CD1-CG1 4.38Å; L45-I49 HydrophobicContact CD2-CD1 4.49Å; L45-I49 HydrophobicContact CG-CD1 3.86Å; L45-I49 HydrophobicContact CG-CG1 4.47Å; L45-I49 WeakPolarHBondContact O-CG1 3.32Å; L45-I49 PolarHBondContact O-N 2.88Å; I49-A52 PolarHBondContact O-N 3.13Å; I49-S53 VanDerWaalsContact O-CB 3.27Å; I49-S53 WeakPolarHBondContact O-CB 3.42Å; I49-S53 PolarHBondContact O-N 2.99Å
50	H	80.3	Confident	73	Confident	125 Å²	125	99.5 Å²	99.5	58%	0.579	53%	0.532	S	S	*	.	H	α-helix	trans	-62.4	-47.3	175.8	-171.5	-50.5	0	0	0	112	K46 Q47 R48 A52 S53 S54	K46-H50 WeakPolarHBondContact O-CB 2.97Å; K46-H50 PolarHBondContact O-N 2.96Å; Q47-H50 WeakPolarHBondContact O-CB 3.11Å; Q47-H50 PolarHBondContact O-N 3.32Å; R48-H50 VanDerWaalsContact C-N 3.26Å; H50-A52 PolarHBondContact O-N 2.83Å; H50-S53 PolarHBondContact O-N 2.84Å; H50-S54 PolarHBondContact CE1-OG 2.82Å; H50-S54 VanDerWaalsContact CE1-OG 3.29Å; H50-S54 PolarHBondContact ND1-OG 2.88Å; H50-S54 VanDerWaalsContact ND1-OG 3.13Å; H50-S54 WeakPolarHBondContact O-CB 3.13Å; H50-S54 PolarHBondContact O-N 3.27Å; H50-S54 PolarHBondContact O-OG 2.67Å
51	V	78.3	Confident	74.1	Confident	101 Å²	101	100.8 Å²	100.8	61%	0.612	52%	0.523	S	S	*	.	H	α-helix	trans	-61.5	-44.1	178	170.9	0	0	0	0	111	Q47 R48 S54 A55	Q47-V51 VanDerWaalsContact O-CG2 3.27Å; Q47-V51 WeakPolarHBondContact O-CG2 3.35Å; Q47-V51 PolarHBondContact O-N 3.33Å; R48-V51 PolarHBondContact O-N 3.11Å; V51-S54 PolarHBondContact O-N 3.48Å; V51-A55 WeakPolarHBondContact O-CB 3.35Å; V51-A55 PolarHBondContact O-N 2.69Å
52	A	79	Confident	74.8	Confident	53 Å²	53	102.4 Å²	102.4	44%	0.438	53%	0.533	S	S	.	.	H	α-helix	trans	-64.3	-43.5	177.3	0	0	0	0	0	112.1	R48 I49 H50 A55 L56	R48-A52 VanDerWaalsContact O-CB 3.3Å; R48-A52 WeakPolarHBondContact O-CB 3.44Å; R48-A52 PolarHBondContact O-N 2.99Å; I49-A52 PolarHBondContact O-N 3.13Å; H50-A52 PolarHBondContact O-N 2.83Å; A52-A55 PolarHBondContact O-N 3.21Å; A52-L56 WeakPolarHBondContact O-CB 3.43Å; A52-L56 PolarHBondContact O-N 3.37Å
53	S	82	Confident	75.7	Confident	58 Å²	58	94.2 Å²	94.2	41%	0.406	51%	0.506	S	S	.	.	H	α-helix	trans	-65.7	-42.4	176.8	-172.4	0	0	0	0	111.8	I49 H50 L56 I57	I49-S53 VanDerWaalsContact O-CB 3.27Å; I49-S53 WeakPolarHBondContact O-CB 3.42Å; I49-S53 PolarHBondContact O-N 2.99Å; H50-S53 PolarHBondContact O-N 2.84Å; S53-L56 PolarHBondContact O-N 3.44Å; S53-I57 VanDerWaalsContact O-CG1 3.27Å; S53-I57 WeakPolarHBondContact O-CG1 3.34Å; S53-I57 PolarHBondContact O-N 2.93Å
54	S	79.6	Confident	76.9	Confident	42 Å²	42	91.3 Å²	91.3	29%	0.294	50%	0.502	S	S	.	.	H	α-helix	trans	-64	-42.1	175.8	-63	0	0	0	0	111.3	H50 V51 L56 I57 L58	H50-S54 PolarHBondContact CE1-OG 2.82Å; H50-S54 VanDerWaalsContact CE1-OG 3.29Å; H50-S54 PolarHBondContact ND1-OG 2.88Å; H50-S54 VanDerWaalsContact ND1-OG 3.13Å; H50-S54 WeakPolarHBondContact O-CB 3.13Å; H50-S54 PolarHBondContact O-N 3.27Å; H50-S54 PolarHBondContact O-OG 2.67Å; V51-S54 PolarHBondContact O-N 3.48Å; S54-L56 VanDerWaalsContact C-N 3.34Å; S54-L56 PolarHBondContact O-N 2.71Å; S54-I57 PolarHBondContact O-N 3.34Å; S54-L58 VanDerWaalsContact O-CB 3.31Å; S54-L58 WeakPolarHBondContact O-CB 3.23Å; S54-L58 WeakPolarHBondContact O-CG 3.38Å; S54-L58 PolarHBondContact O-N 3.28Å
55	A	79.9	Confident	77.2	Confident	40 Å²	40	92.6 Å²	92.6	33%	0.331	51%	0.506	S	S	.	.	H	α-helix	trans	-61.5	-42.4	174.4	0	0	0	0	0	111.5	V51 A52 L58 Q59	V51-A55 WeakPolarHBondContact O-CB 3.35Å; V51-A55 PolarHBondContact O-N 2.69Å; A52-A55 PolarHBondContact O-N 3.21Å; A55-L58 PolarHBondContact O-N 3.45Å; A55-Q59 WeakPolarHBondContact O-CB 3.22Å; A55-Q59 VanDerWaalsContact O-CG 3.25Å; A55-Q59 WeakPolarHBondContact O-CG 3.25Å; A55-Q59 PolarHBondContact O-N 2.9Å
56	L	81.2	Confident	77.5	Confident	107 Å²	107	95.1 Å²	95.1	56%	0.56	51%	0.513	S	S	*	.	H	α-helix	trans	-65.7	-42.4	177.3	-172.4	67.6	0	0	0	112.2	A52 S53 S54 Q59 T60	A52-L56 WeakPolarHBondContact O-CB 3.43Å; A52-L56 PolarHBondContact O-N 3.37Å; S53-L56 PolarHBondContact O-N 3.44Å; S54-L56 VanDerWaalsContact C-N 3.34Å; S54-L56 PolarHBondContact O-N 2.71Å; L56-Q59 PolarHBondContact O-N 3.29Å; L56-T60 WeakPolarHBondContact O-CB 3.19Å; L56-T60 PolarHBondContact O-N 3.5Å; L56-T60 PolarHBondContact O-OG1 3.39Å
57	I	79.6	Confident	77.6	Confident	91 Å²	91	93.8 Å²	93.8	47%	0.467	51%	0.513	S	S	.	.	H	α-helix	trans	-65.5	-43.2	175.9	-68.2	165.3	0	0	0	110.6	S53 S54 T60 N61	S53-I57 VanDerWaalsContact O-CG1 3.27Å; S53-I57 WeakPolarHBondContact O-CG1 3.34Å; S53-I57 PolarHBondContact O-N 2.93Å; S54-I57 PolarHBondContact O-N 3.34Å; I57-T60 PolarHBondContact O-N 2.98Å; I57-N61 WeakPolarHBondContact O-CB 3.39Å; I57-N61 VanDerWaalsContact O-CG 3.3Å; I57-N61 PolarHBondContact O-N 3.04Å
58	L	80.6	Confident	77.6	Confident	119 Å²	119	92.4 Å²	92.4	62%	0.623	52%	0.52	S	S	*	.	H	α-helix	trans	-62.5	-44.3	175.7	-72.7	168.6	0	0	0	111.4	S54 A55 T60 N61 M62	S54-L58 VanDerWaalsContact O-CB 3.31Å; S54-L58 WeakPolarHBondContact O-CB 3.23Å; S54-L58 WeakPolarHBondContact O-CG 3.38Å; S54-L58 PolarHBondContact O-N 3.28Å; A55-L58 PolarHBondContact O-N 3.45Å; L58-T60 VanDerWaalsContact C-N 3.35Å; L58-T60 PolarHBondContact O-N 2.91Å; L58-N61 PolarHBondContact O-N 3.45Å; L58-M62 VanDerWaalsContact O-CB 3.27Å; L58-M62 WeakPolarHBondContact O-CB 3.49Å; L58-M62 PolarHBondContact O-N 2.63Å
59	Q	78.1	Confident	77.8	Confident	129 Å²	129	94.2 Å²	94.2	60%	0.603	54%	0.537	S	S	*	.	H	α-helix	trans	-62.5	-40.4	174.4	-76.7	178.5	-13.1	0	0	111.9	A55 L56 M62 A63	A55-Q59 WeakPolarHBondContact O-CB 3.22Å; A55-Q59 VanDerWaalsContact O-CG 3.25Å; A55-Q59 WeakPolarHBondContact O-CG 3.25Å; A55-Q59 PolarHBondContact O-N 2.9Å; L56-Q59 PolarHBondContact O-N 3.29Å; Q59-M62 PolarHBondContact O-N 2.93Å; Q59-A63 WeakPolarHBondContact O-CB 3.39Å; Q59-A63 PolarHBondContact O-N 3.37Å
60	T	81.7	Confident	77.2	Confident	73 Å²	73	94.2 Å²	94.2	45%	0.448	54%	0.544	S	S	.	.	H	α-helix	trans	-66.8	-44.7	177.9	-56.1	0	0	0	0	111.4	L56 I57 L58 M62 S64	L56-T60 WeakPolarHBondContact O-CB 3.19Å; L56-T60 PolarHBondContact O-N 3.5Å; L56-T60 PolarHBondContact O-OG1 3.39Å; I57-T60 PolarHBondContact O-N 2.98Å; L58-T60 VanDerWaalsContact C-N 3.35Å; L58-T60 PolarHBondContact O-N 2.91Å; T60-M62 VanDerWaalsContact C-N 3.34Å; T60-S64 WeakPolarHBondContact O-CB 3.49Å; T60-S64 PolarHBondContact O-N 3.31Å; T60-S64 PolarHBondContact O-OG 2.86Å
61	N	79.7	Confident	76.7	Confident	94 Å²	94	94 Å²	94	50%	0.503	55%	0.554	S	S	.	*	H	α-helix	trans	-64.2	-41.1	176.4	-73.9	-13.5	0	0	0	111	I57 L58 S64 V65	I57-N61 WeakPolarHBondContact O-CB 3.39Å; I57-N61 VanDerWaalsContact O-CG 3.3Å; I57-N61 PolarHBondContact O-N 3.04Å; L58-N61 PolarHBondContact O-N 3.45Å; N61-S64 PolarHBondContact O-N 3.44Å; N61-V65 WeakPolarHBondContact O-CG2 3.39Å; N61-V65 PolarHBondContact O-N 3.33Å
62	M	74.6	Confident	76.1	Confident	144 Å²	144	99 Å²	99	71%	0.709	57%	0.567	S	S	*	*	H	α-helix	trans	-71.9	-38.6	-179.8	-156.4	160.5	77.9	0	0	112.3	L58 Q59 T60 S64 V65 F66	L58-M62 VanDerWaalsContact O-CB 3.27Å; L58-M62 WeakPolarHBondContact O-CB 3.49Å; L58-M62 PolarHBondContact O-N 2.63Å; Q59-M62 PolarHBondContact O-N 2.93Å; T60-M62 VanDerWaalsContact C-N 3.34Å; M62-S64 VanDerWaalsContact C-N 3.33Å; M62-V65 PolarHBondContact O-N 2.66Å; M62-F66 PolarHBondContact O-N 3.27Å
63	A	77.3	Confident	75.4	Confident	49 Å²	49	107.6 Å²	107.6	41%	0.405	59%	0.588	S	S	.	*	H	α-helix	trans	-64.4	-38.5	172.2	0	0	0	0	0	111.8	Q59 F66 L67	Q59-A63 WeakPolarHBondContact O-CB 3.39Å; Q59-A63 PolarHBondContact O-N 3.37Å; A63-F66 PolarHBondContact O-N 2.85Å; A63-L67 WeakPolarHBondContact O-CB 3.24Å; A63-L67 WeakPolarHBondContact O-CG 3.24Å; A63-L67 PolarHBondContact O-N 3.03Å
64	S	81.1	Confident	74.6	Confident	66 Å²	66	110.4 Å²	110.4	46%	0.462	61%	0.608	S	S	.	*	H	α-helix	trans	-64.1	-41.3	176.3	-59.4	0	0	0	0	111.8	T60 N61 M62 L67 A68	T60-S64 WeakPolarHBondContact O-CB 3.49Å; T60-S64 PolarHBondContact O-N 3.31Å; T60-S64 PolarHBondContact O-OG 2.86Å; N61-S64 PolarHBondContact O-N 3.44Å; M62-S64 VanDerWaalsContact C-N 3.33Å; S64-L67 PolarHBondContact O-N 2.99Å; S64-A68 WeakPolarHBondContact O-CB 3.37Å; S64-A68 PolarHBondContact O-N 3.45Å
65	V	73.4	Confident	73.7	Confident	97 Å²	97	113.8 Å²	113.8	59%	0.588	63%	0.627	S	S	*	*	H	α-helix	trans	-63.1	-43.8	173.4	173.8	0	0	0	0	110.9	N61 M62 L67 A68 V69	N61-V65 WeakPolarHBondContact O-CG2 3.39Å; N61-V65 PolarHBondContact O-N 3.33Å; M62-V65 PolarHBondContact O-N 2.66Å; V65-L67 PolarHBondContact O-N 2.88Å; V65-A68 PolarHBondContact O-N 3.17Å; V65-V69 WeakPolarHBondContact O-CG2 3.44Å; V65-V69 PolarHBondContact O-N 3.44Å
66	F	75.3	Confident	73.1	Confident	170 Å²	170	118.1 Å²	118.1	75%	0.746	64%	0.644	S	S	*	*	H	α-helix	trans	-62.7	-40.6	178.6	-175.5	-97.9	0	0	0	112.7	M62 A63	M62-F66 PolarHBondContact O-N 3.27Å; A63-F66 PolarHBondContact O-N 2.85Å
67	L	72.9	Confident	72.3	Confident	143 Å²	143	122.5 Å²	122.5	75%	0.749	66%	0.659	S	S	*	*	H	α-helix	trans	-74.8	-29.1	177.9	-68.8	172.4	0	0	0	113.1	A63 S64 V65 V69	A63-L67 WeakPolarHBondContact O-CB 3.24Å; A63-L67 WeakPolarHBondContact O-CG 3.24Å; A63-L67 PolarHBondContact O-N 3.03Å; S64-L67 PolarHBondContact O-N 2.99Å; V65-L67 PolarHBondContact O-N 2.88Å; L67-V69 VanDerWaalsContact C-N 3.32Å
68	A	73.3	Confident	71.8	Confident	79 Å²	79	123.7 Å²	123.7	65%	0.653	67%	0.671	S	S	*	*	H	α-helix	trans	-78.3	-14.9	177.4	0	0	0	0	0	113.3	S64 V65 P70	S64-A68 WeakPolarHBondContact O-CB 3.37Å; S64-A68 PolarHBondContact O-N 3.45Å; V65-A68 PolarHBondContact O-N 3.17Å; A68-P70 WeakPolarHBondContact O-CD 3.15Å
69	V	68.4	Low	71.2	Confident	95 Å²	95	121.5 Å²	121.5	58%	0.576	68%	0.677	S	S	*	*	S	Bend	trans	-81.6	106.2	171.1	176.1	0	0	0	0	108.2	V65 L67	V65-V69 WeakPolarHBondContact O-CG2 3.44Å; V65-V69 PolarHBondContact O-N 3.44Å; L67-V69 VanDerWaalsContact C-N 3.32Å
70	P	64.4	Low	69.7	Low	103 Å²	103	125.8 Å²	125.8	67%	0.669	71%	0.712	S	S	*	*			trans	-59.9	132.7	176.5	25.1	-33	0	0	0	108.7	A68 K72	A68-P70 WeakPolarHBondContact O-CD 3.15Å; P70-K72 PolarHBondContact O-N 2.9Å; P70-K72 VanDerWaalsContact O-N 3.09Å
71	P	69.6	Low	69.1	Low	121 Å²	121	128.5 Å²	128.5	79%	0.786	73%	0.725	S	S	*	*			trans	-58.8	122.1	179.3	23.6	-32.5	0	0	0	108.4	R73	P71-R73 PolarHBondContact O-N 3.09Å
72	K	65.9	Low	68.5	Low	207 Å²	207	130.3 Å²	130.3	90%	0.9	74%	0.737	S	S	*	*			trans	-58	107.1	168.2	-76.4	-174.8	178	179.8	0	106.7	P70 S74	P70-K72 PolarHBondContact O-N 2.9Å; P70-K72 VanDerWaalsContact O-N 3.09Å; K72-S74 PolarHBondContact O-N 2.86Å
73	R	65.1	Low	68.2	Low	233 Å²	233	129.5 Å²	129.5	88%	0.879	74%	0.739	S	S	*	*			trans	-57.8	102.3	170.3	-90.3	-174.2	174.7	-175.2	-1	107.2	P71 T75	P71-R73 PolarHBondContact O-N 3.09Å; R73-T75 VanDerWaalsContact C-N 3.32Å; R73-T75 PolarHBondContact O-N 3Å
74	S	64.7	Low	67.7	Low	116 Å²	116	134.2 Å²	134.2	81%	0.811	76%	0.758	S	S	*	*			trans	-66.7	97.8	165.1	-176.4	0	0	0	0	106.7	K72 N76	K72-S74 PolarHBondContact O-N 2.86Å; S74-N76 VanDerWaalsContact C-N 3.35Å; S74-N76 PolarHBondContact O-N 2.99Å
75	T	61.6	Low	66.8	Low	113 Å²	113	138.5 Å²	138.5	69%	0.693	78%	0.777	S	S	*	*			trans	-71.9	91.2	174.9	46.7	0	0	0	0	108.7	R73 K77	R73-T75 VanDerWaalsContact C-N 3.32Å; R73-T75 PolarHBondContact O-N 3Å; T75-K77 PolarHBondContact O-N 3.15Å; T75-K77 VanDerWaalsContact O-N 3.15Å
76	N	67.2	Low	66.4	Low	132 Å²	132	141.3 Å²	141.3	71%	0.706	79%	0.789	S	S	*	*			trans	-74.6	93.3	159.8	-170.3	15.3	0	0	0	108	S74 T78	S74-N76 VanDerWaalsContact C-N 3.35Å; S74-N76 PolarHBondContact O-N 2.99Å; N76-T78 VanDerWaalsContact C-N 3.34Å; N76-T78 VanDerWaalsContact CG-OG1 3.28Å; N76-T78 PolarHBondContact ND2-OG1 3.08Å; N76-T78 VanDerWaalsContact ND2-OG1 3.16Å; N76-T78 PolarHBondContact O-N 3.12Å; N76-T78 VanDerWaalsContact O-N 3.12Å; N76-T78 PolarHBondContact OD1-OG1 3.16Å; N76-T78 VanDerWaalsContact OD1-OG1 3.08Å
77	K	63.4	Low	65.8	Low	199 Å²	199	139.2 Å²	139.2	87%	0.865	79%	0.792	S	S	*	*			trans	-76.1	88.2	168.3	-76.2	-172.4	177.2	-177.6	0	108	T75	T75-K77 PolarHBondContact O-N 3.15Å; T75-K77 VanDerWaalsContact O-N 3.15Å
78	T	69.3	Low	65.2	Low	116 Å²	116	138.9 Å²	138.9	71%	0.712	80%	0.796	S	S	*	*			trans	-102.5	120.6	166.7	-45.9	0	0	0	0	108.1	N76	N76-T78 VanDerWaalsContact C-N 3.34Å; N76-T78 VanDerWaalsContact CG-OG1 3.28Å; N76-T78 PolarHBondContact ND2-OG1 3.08Å; N76-T78 VanDerWaalsContact ND2-OG1 3.16Å; N76-T78 PolarHBondContact O-N 3.12Å; N76-T78 VanDerWaalsContact O-N 3.12Å; N76-T78 PolarHBondContact OD1-OG1 3.16Å; N76-T78 VanDerWaalsContact OD1-OG1 3.08Å
79	G	68.9	Low	64.5	Low	73 Å²	73	143.9 Å²	143.9	75%	0.753	81%	0.808	S	S	*	*			trans	124.7	72	166.3	0	0	0	0	0	116.4
80	T	46	Very low	64.2	Low	219 Å²	219	148.4 Å²	148.4	100%	1.344	83%	0.829	S	S	*	*			trans	-143.2	0	131.2	46.9	0	0	0	0	107.1

Retrieved 80 of 80 residues in 148.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).