A0A077ZDN6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZDN6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 90 aa.

						>A0A077ZDN6_TRITR|A0A077ZDN6
MENAFSINAQLDVKVSKSQEVLMVVPWVEEEVGPSQDVWDAWVDEEVHEFQDVVLVGGSDCRVVDAAASLLLCALLAAYGVHHRLNQVFY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.5	Very low	32	Very low	240 Å²	240	121.1 Å²	121.1	100%	1.182	65%	0.645	S	S	*	*				0	27.8	0	-85	-178.1	-178.2	0	0	111.7
2	E	36.2	Very low	31.8	Very low	173 Å²	173	121.2 Å²	121.2	81%	0.808	65%	0.646	S	S	*	*			trans	-90.6	-12.7	-168.9	-75.2	169.9	113.2	0	0	115.4
3	N	36.7	Very low	32.1	Very low	135 Å²	135	119 Å²	119	72%	0.722	64%	0.64	S	S	*	*	H	α-helix	trans	-82.6	-22.5	-168.6	-73.4	-0.7	0	0	0	115.5	I7	N3-I7 WeakPolarHBondContact O-CG1 3.36Å
4	A	30.7	Very low	32.1	Very low	71 Å²	71	115.2 Å²	115.2	59%	0.587	62%	0.615	S	S	*	*	H	α-helix	trans	-75.9	-33.3	-177.1	0	0	0	0	0	112.7	N8	A4-N8 PolarHBondContact O-N 3.31Å
5	F	30.2	Very low	32.1	Very low	180 Å²	180	111.2 Å²	111.2	79%	0.789	60%	0.596	S	S	*	*	H	α-helix	trans	-71.6	-33.3	-177.1	-154.8	-93.3	0	0	0	112	A9	F5-A9 PolarHBondContact O-N 2.91Å
6	S	33.3	Very low	32.1	Very low	70 Å²	70	108.2 Å²	108.2	49%	0.49	59%	0.586	S	S	.	*	H	α-helix	trans	-68.8	-39.3	178.4	-173	0	0	0	0	112.8	N8 A9 Q10	S6-N8 PolarHBondContact O-N 3.29Å; S6-A9 PolarHBondContact O-N 3.15Å; S6-Q10 PolarHBondContact O-N 3.16Å
7	I	30.3	Very low	32.2	Very low	88 Å²	88	109.5 Å²	109.5	45%	0.451	59%	0.585	S	S	.	*	H	α-helix	trans	-65.5	-42.9	-179.9	-63.9	169.4	0	0	0	110.6	N3 A9 Q10 L11	N3-I7 WeakPolarHBondContact O-CG1 3.36Å; I7-A9 PolarHBondContact O-N 3.33Å; I7-Q10 PolarHBondContact O-N 3.48Å; I7-L11 HydrophobicContact CG2-CD1 4.14Å; I7-L11 WeakPolarHBondContact O-CB 3.11Å; I7-L11 PolarHBondContact O-N 3.05Å
8	N	27.4	Very low	32.2	Very low	112 Å²	112	105.2 Å²	105.2	60%	0.599	57%	0.565	S	S	*	*	H	α-helix	trans	-63.3	-41.8	178.8	-77.9	-13.8	0	0	0	112	A4 S6 Q10 L11 D12	A4-N8 PolarHBondContact O-N 3.31Å; S6-N8 PolarHBondContact O-N 3.29Å; N8-Q10 PolarHBondContact O-N 3Å; N8-L11 PolarHBondContact O-N 2.87Å; N8-D12 PolarHBondContact O-N 3.43Å
9	A	32.8	Very low	32.1	Very low	54 Å²	54	106.3 Å²	106.3	45%	0.446	57%	0.566	S	S	.	*	H	α-helix	trans	-64.4	-39.6	176.7	0	0	0	0	0	112.1	F5 S6 I7 L11 D12 V13	F5-A9 PolarHBondContact O-N 2.91Å; S6-A9 PolarHBondContact O-N 3.15Å; I7-A9 PolarHBondContact O-N 3.33Å; A9-L11 VanDerWaalsContact C-N 3.32Å; A9-D12 PolarHBondContact O-N 3.16Å; A9-V13 WeakPolarHBondContact O-CG2 3.23Å; A9-V13 PolarHBondContact O-N 3.28Å; A9-V13 VanDerWaalsContact O-N 3.09Å
10	Q	31.4	Very low	32.1	Very low	122 Å²	122	106.7 Å²	106.7	57%	0.57	57%	0.565	S	S	*	*	H	α-helix	trans	-66.3	-35.5	174.1	-76.3	-173.6	-30.3	0	0	112.4	S6 I7 N8 K14	S6-Q10 PolarHBondContact O-N 3.16Å; I7-Q10 PolarHBondContact O-N 3.48Å; N8-Q10 PolarHBondContact O-N 3Å; Q10-K14 VanDerWaalsContact O-CB 3.31Å; Q10-K14 WeakPolarHBondContact O-CB 3.41Å; Q10-K14 WeakPolarHBondContact O-CG 3.49Å; Q10-K14 PolarHBondContact O-N 2.88Å
11	L	27.2	Very low	32.1	Very low	87 Å²	87	106 Å²	106	46%	0.455	56%	0.564	S	S	.	*	H	α-helix	trans	-68	-42	174.9	-121	125.7	0	0	0	111.3	I7 N8 A9 V13 K14 V15	I7-L11 HydrophobicContact CG2-CD1 4.14Å; I7-L11 WeakPolarHBondContact O-CB 3.11Å; I7-L11 PolarHBondContact O-N 3.05Å; N8-L11 PolarHBondContact O-N 2.87Å; A9-L11 VanDerWaalsContact C-N 3.32Å; L11-V13 PolarHBondContact O-N 3.09Å; L11-K14 CarbonylContact O-C 3.54Å; L11-K14 PolarHBondContact O-N 3.37Å; L11-V15 HydrophobicContact CD2-CG2 4.32Å; L11-V15 WeakPolarHBondContact O-CB 3.36Å; L11-V15 WeakPolarHBondContact O-CG2 3.49Å; L11-V15 PolarHBondContact O-N 3.21Å
12	D	30.2	Very low	31.8	Very low	122 Å²	122	99 Å²	99	65%	0.652	53%	0.531	S	S	*	.	H	α-helix	trans	-63.3	-42.9	178.6	-139.3	-27.6	0	0	0	111.4	N8 A9 K14 V15 S16	N8-D12 PolarHBondContact O-N 3.43Å; A9-D12 PolarHBondContact O-N 3.16Å; D12-K14 VanDerWaalsContact C-N 3.35Å; D12-K14 PolarHBondContact O-N 3.45Å; D12-V15 PolarHBondContact O-N 2.85Å; D12-S16 WeakPolarHBondContact O-CB 3.22Å; D12-S16 PolarHBondContact O-N 2.81Å
13	V	35.9	Very low	31.5	Very low	93 Å²	93	97.9 Å²	97.9	56%	0.564	53%	0.528	S	S	*	.	H	α-helix	trans	-66.3	-37.1	174	177.1	0	0	0	0	111.5	A9 L11 K17	A9-V13 WeakPolarHBondContact O-CG2 3.23Å; A9-V13 PolarHBondContact O-N 3.28Å; A9-V13 VanDerWaalsContact O-N 3.09Å; L11-V13 PolarHBondContact O-N 3.09Å; V13-K17 PolarHBondContact O-N 3.35Å; V13-K17 VanDerWaalsContact O-N 3.07Å
14	K	31	Very low	31.4	Very low	66 Å²	66	96.6 Å²	96.6	29%	0.287	53%	0.525	S	S	.	.	H	α-helix	trans	-70.1	-40.5	175.6	-86.2	-174.3	168.1	-164.9	0	112.2	Q10 L11 D12 S16 K17 S18 V63	Q10-K14 VanDerWaalsContact O-CB 3.31Å; Q10-K14 WeakPolarHBondContact O-CB 3.41Å; Q10-K14 WeakPolarHBondContact O-CG 3.49Å; Q10-K14 PolarHBondContact O-N 2.88Å; L11-K14 CarbonylContact O-C 3.54Å; L11-K14 PolarHBondContact O-N 3.37Å; D12-K14 VanDerWaalsContact C-N 3.35Å; D12-K14 PolarHBondContact O-N 3.45Å; K14-S16 VanDerWaalsContact C-N 3.32Å; K14-K17 CarbonylContact O-C 3.54Å; K14-K17 PolarHBondContact O-N 3.49Å; K14-S18 WeakPolarHBondContact O-CB 3.4Å; K14-S18 PolarHBondContact O-N 2.82Å; K14-S18 PolarHBondContact O-OG 3.46Å; K14-V63 PolarHBondContact NZ-O 2.79Å; K14-V63 VanDerWaalsContact NZ-O 3.11Å
15	V	32.9	Very low	31.5	Very low	55 Å²	55	97.9 Å²	97.9	33%	0.333	53%	0.525	S	S	.	.	H	α-helix	trans	-65.2	-39.3	176.1	172.4	0	0	0	0	110	L11 D12 K17 S18 Q19	L11-V15 HydrophobicContact CD2-CG2 4.32Å; L11-V15 WeakPolarHBondContact O-CB 3.36Å; L11-V15 WeakPolarHBondContact O-CG2 3.49Å; L11-V15 PolarHBondContact O-N 3.21Å; D12-V15 PolarHBondContact O-N 2.85Å; V15-K17 PolarHBondContact O-N 2.83Å; V15-S18 PolarHBondContact O-N 3.33Å; V15-Q19 WeakPolarHBondContact O-CB 3.49Å; V15-Q19 WeakPolarHBondContact O-CG 3.3Å; V15-Q19 PolarHBondContact O-N 3.23Å
16	S	32.3	Very low	31.7	Very low	63 Å²	63	94.8 Å²	94.8	44%	0.441	52%	0.523	S	S	.	.	H	α-helix	trans	-60	-43.7	172.3	174	0	0	0	0	111.8	D12 K14 Q19 E20	D12-S16 WeakPolarHBondContact O-CB 3.22Å; D12-S16 PolarHBondContact O-N 2.81Å; K14-S16 VanDerWaalsContact C-N 3.32Å; S16-Q19 WeakPolarHBondContact O-CB 3.5Å; S16-Q19 PolarHBondContact O-N 3.3Å; S16-E20 PolarHBondContact O-N 2.85Å; S16-E20 VanDerWaalsContact O-N 3.12Å
17	K	33.5	Very low	31.9	Very low	131 Å²	131	98.2 Å²	98.2	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-71.3	-33.5	174.1	-76.5	-170.7	174.8	-172.9	0	113.3	V13 K14 V15 Q19 E20 V21	V13-K17 PolarHBondContact O-N 3.35Å; V13-K17 VanDerWaalsContact O-N 3.07Å; K14-K17 CarbonylContact O-C 3.54Å; K14-K17 PolarHBondContact O-N 3.49Å; V15-K17 PolarHBondContact O-N 2.83Å; K17-Q19 VanDerWaalsContact C-N 3.29Å; K17-E20 CarbonylContact O-C 3.53Å; K17-E20 WeakPolarHBondContact O-CA 3.28Å; K17-E20 WeakPolarHBondContact O-CB 3.28Å; K17-E20 PolarHBondContact O-N 2.83Å; K17-E20 VanDerWaalsContact O-N 3.1Å; K17-V21 WeakPolarHBondContact O-CG2 3.33Å; K17-V21 PolarHBondContact O-N 3.3Å
18	S	32.9	Very low	32	Very low	32 Å²	32	100.7 Å²	100.7	22%	0.224	54%	0.544	C	S	.	.	H	α-helix	trans	-68.3	-31.7	174.7	-62.6	0	0	0	0	111.4	K14 V15 E20 V21 L22	K14-S18 WeakPolarHBondContact O-CB 3.4Å; K14-S18 PolarHBondContact O-N 2.82Å; K14-S18 PolarHBondContact O-OG 3.46Å; V15-S18 PolarHBondContact O-N 3.33Å; S18-E20 VanDerWaalsContact C-N 3.34Å; S18-V21 PolarHBondContact O-N 3.34Å; S18-L22 PolarHBondContact O-N 2.84Å
19	Q	29.9	Very low	32.2	Very low	126 Å²	126	103.2 Å²	103.2	59%	0.589	55%	0.552	S	S	*	*	H	α-helix	trans	-65.8	-37.4	167.6	-79.4	-174.7	-13.8	0	0	111.5	V15 S16 K17 L22 M23	V15-Q19 WeakPolarHBondContact O-CB 3.49Å; V15-Q19 WeakPolarHBondContact O-CG 3.3Å; V15-Q19 PolarHBondContact O-N 3.23Å; S16-Q19 WeakPolarHBondContact O-CB 3.5Å; S16-Q19 PolarHBondContact O-N 3.3Å; K17-Q19 VanDerWaalsContact C-N 3.29Å; Q19-L22 WeakPolarHBondContact O-CB 3.36Å; Q19-L22 PolarHBondContact O-N 2.86Å; Q19-M23 PolarHBondContact O-N 2.82Å
20	E	31.1	Very low	32.5	Very low	114 Å²	114	109 Å²	109	53%	0.533	57%	0.57	S	S	.	*	H	α-helix	trans	-64.8	-38.7	170.1	-69.9	-175.1	147.1	0	0	112.2	S16 K17 S18 L22 M23	S16-E20 PolarHBondContact O-N 2.85Å; S16-E20 VanDerWaalsContact O-N 3.12Å; K17-E20 CarbonylContact O-C 3.53Å; K17-E20 WeakPolarHBondContact O-CA 3.28Å; K17-E20 WeakPolarHBondContact O-CB 3.28Å; K17-E20 PolarHBondContact O-N 2.83Å; K17-E20 VanDerWaalsContact O-N 3.1Å; S18-E20 VanDerWaalsContact C-N 3.34Å; E20-L22 VanDerWaalsContact C-N 3.3Å; E20-L22 PolarHBondContact O-N 3.44Å; E20-M23 HydrophobicContact CG-CE 4.28Å; E20-M23 WeakPolarHBondContact O-CB 3.4Å; E20-M23 PolarHBondContact O-N 3.01Å
21	V	32.3	Very low	32.7	Very low	91 Å²	91	112.2 Å²	112.2	55%	0.552	59%	0.585	S	S	*	*	H	α-helix	trans	-65.9	-35.4	175.3	176	0	0	0	0	111.1	K17 S18 M23 V24	K17-V21 WeakPolarHBondContact O-CG2 3.33Å; K17-V21 PolarHBondContact O-N 3.3Å; S18-V21 PolarHBondContact O-N 3.34Å; V21-M23 PolarHBondContact O-N 3.03Å; V21-M23 VanDerWaalsContact O-N 3.15Å; V21-V24 PolarHBondContact O-N 3.15Å
22	L	30.3	Very low	33.4	Very low	94 Å²	94	113.5 Å²	113.5	49%	0.492	60%	0.596	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.1	-15.1	171.2	-96.5	151	0	0	0	113.4	S18 Q19 E20 A74	S18-L22 PolarHBondContact O-N 2.84Å; Q19-L22 WeakPolarHBondContact O-CB 3.36Å; Q19-L22 PolarHBondContact O-N 2.86Å; E20-L22 VanDerWaalsContact C-N 3.3Å; E20-L22 PolarHBondContact O-N 3.44Å; L22-A74 HydrophobicContact CG-CB 4.35Å
23	M	29.2	Very low	33.9	Very low	150 Å²	150	109 Å²	109	74%	0.739	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.7	-2.3	173.8	-63.3	-161	-63.7	0	0	113.9	Q19 E20 V21	Q19-M23 PolarHBondContact O-N 2.82Å; E20-M23 HydrophobicContact CG-CE 4.28Å; E20-M23 WeakPolarHBondContact O-CB 3.4Å; E20-M23 PolarHBondContact O-N 3.01Å; V21-M23 PolarHBondContact O-N 3.03Å; V21-M23 VanDerWaalsContact O-N 3.15Å
24	V	34.7	Very low	34.4	Very low	108 Å²	108	106.4 Å²	106.4	66%	0.655	56%	0.564	S	S	*	*			trans	-110.5	57.2	179.9	-163.2	0	0	0	0	110.5	V21 P26	V21-V24 PolarHBondContact O-N 3.15Å; V24-P26 VanDerWaalsContact C-CD 3.47Å; V24-P26 WeakPolarHBondContact O-CD 3.48Å
25	V	32.5	Very low	35.4	Very low	98 Å²	98	106.3 Å²	106.3	59%	0.594	57%	0.571	S	S	*	*			trans	-115.7	85.1	156.7	-171	0	0	0	0	106.6	W27	V25-W27 PolarHBondContact O-N 3Å
26	P	34.3	Very low	36.2	Very low	114 Å²	114	107.9 Å²	107.9	74%	0.74	58%	0.575	S	S	*	*			trans	-75.8	68.5	179	32.3	-33.4	0	0	0	109.1	V24	V24-P26 VanDerWaalsContact C-CD 3.47Å; V24-P26 WeakPolarHBondContact O-CD 3.48Å
27	W	38.1	Very low	37.3	Very low	143 Å²	143	110.7 Å²	110.7	54%	0.542	59%	0.585	S	S	.	*			trans	-156.6	68.7	172.1	-132.9	58.6	0	0	0	111.5	V25 V32	V25-W27 PolarHBondContact O-N 3Å; W27-V32 WeakPolarHBondContact CH2-O 3.36Å; W27-V32 VanDerWaalsContact CZ3-O 3.22Å; W27-V32 WeakPolarHBondContact CZ3-O 3.47Å
28	V	31.4	Very low	38.2	Very low	140 Å²	140	108.2 Å²	108.2	85%	0.848	58%	0.58	S	S	*	*			trans	-125.1	50.6	157.9	-176.5	0	0	0	0	107.3
29	E	33.2	Very low	39.2	Very low	165 Å²	165	108.7 Å²	108.7	77%	0.771	58%	0.578	S	S	*	*	S	Bend	trans	-132.6	120.9	163	-68.4	-167.4	155.9	0	0	106.1
30	E	37.6	Very low	40.4	Very low	176 Å²	176	106.6 Å²	106.6	82%	0.822	57%	0.57	S	S	*	*	S	Bend	trans	92	122.7	-178	-58.8	-174.7	140.4	0	0	117.1	V32	E30-V32 PolarHBondContact O-N 3.36Å
31	E	35.9	Very low	41.8	Very low	188 Å²	188	104 Å²	104	88%	0.879	57%	0.568	S	S	*	*	S	Bend	trans	-66.9	22.9	-163.9	-64.6	-168.9	137	0	0	117.2
32	V	41.9	Very low	42.8	Very low	114 Å²	114	104.6 Å²	104.6	69%	0.691	56%	0.561	S	S	*	*			trans	-140.8	93.8	-179.5	-165.3	0	0	0	0	106.8	W27 E30	W27-V32 WeakPolarHBondContact CH2-O 3.36Å; W27-V32 VanDerWaalsContact CZ3-O 3.22Å; W27-V32 WeakPolarHBondContact CZ3-O 3.47Å; E30-V32 PolarHBondContact O-N 3.36Å
33	G	41.7	Very low	43.9	Very low	27 Å²	27	102 Å²	102	28%	0.278	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-49.6	155.5	166.9	0	0	0	0	0	110.4	S35 H82	G33-S35 PolarHBondContact O-N 2.84Å; G33-H82 WeakPolarHBondContact CA-NE2 3.46Å
34	P	45.2	Very low	45.4	Very low	40 Å²	40	99.4 Å²	99.4	26%	0.26	54%	0.538	S	S	.	.	P	Polyproline II helix	trans	-48.8	140	177.4	21	-31.4	0	0	0	109.6	V38	P34-V38 HydrophobicContact CB-CB 3.61Å; P34-V38 HydrophobicContact CB-CG1 3.45Å; P34-V38 VanDerWaalsContact CB-CG1 3.45Å
35	S	51.5	Low	46.5	Very low	63 Å²	63	100.6 Å²	100.6	44%	0.441	54%	0.536	S	S	.	.	P	Polyproline II helix	trans	-53.2	153.4	169.7	62.6	0	0	0	0	108.9	G33 D37 V38 W39	G33-S35 PolarHBondContact O-N 2.84Å; S35-D37 PolarHBondContact O-N 3.38Å; S35-V38 WeakPolarHBondContact O-CA 3.49Å; S35-V38 PolarHBondContact O-N 2.91Å; S35-V38 WeakPolarHBondContact OG-CG2 3.41Å; S35-W39 PolarHBondContact O-N 3.1Å
36	Q	50.1	Low	47.3	Very low	88 Å²	88	99.1 Å²	99.1	41%	0.411	52%	0.523	S	S	.	.	H	α-helix	trans	-49.7	-36	179.3	-174.6	65.4	41.6	0	0	111.5	V38 W39 D40	Q36-V38 PolarHBondContact O-N 3.47Å; Q36-W39 PolarHBondContact O-N 3.34Å; Q36-D40 PolarHBondContact NE2-OD1 2.96Å; Q36-D40 WeakPolarHBondContact O-CB 3.48Å; Q36-D40 PolarHBondContact O-N 2.92Å
37	D	56.1	Low	48.2	Very low	123 Å²	123	95.7 Å²	95.7	66%	0.658	50%	0.5	S	S	*	.	H	α-helix	trans	-62.5	-38	176.4	-50.7	-46.1	0	0	0	113.4	S35 A41	S35-D37 PolarHBondContact O-N 3.38Å; D37-A41 VanDerWaalsContact O-CB 3.3Å; D37-A41 WeakPolarHBondContact O-CB 3.42Å; D37-A41 PolarHBondContact O-N 3.46Å
38	V	53.4	Low	48.7	Very low	78 Å²	78	93.4 Å²	93.4	47%	0.473	50%	0.495	S	S	.	.	H	α-helix	trans	-74.5	-37.5	177.7	174.4	0	0	0	0	110.5	P34 S35 Q36 W42	P34-V38 HydrophobicContact CB-CB 3.61Å; P34-V38 HydrophobicContact CB-CG1 3.45Å; P34-V38 VanDerWaalsContact CB-CG1 3.45Å; S35-V38 WeakPolarHBondContact O-CA 3.49Å; S35-V38 PolarHBondContact O-N 2.91Å; S35-V38 WeakPolarHBondContact OG-CG2 3.41Å; Q36-V38 PolarHBondContact O-N 3.47Å; V38-W42 WeakPolarHBondContact O-CB 3.49Å; V38-W42 PolarHBondContact O-N 2.85Å
39	W	52.7	Low	49.6	Very low	43 Å²	43	92.3 Å²	92.3	16%	0.163	48%	0.481	C	S	.	.	H	α-helix	trans	-61.7	-48.3	172	177.1	-93.4	0	0	0	111.3	S35 Q36 A41 W42 V43 L75 A78 Y79	S35-W39 PolarHBondContact O-N 3.1Å; Q36-W39 PolarHBondContact O-N 3.34Å; W39-A41 VanDerWaalsContact C-N 3.34Å; W39-A41 PolarHBondContact O-N 2.97Å; W39-W42 HydrophobicContact CE3-CE3 4.48Å; W39-W42 HydrophobicContact CH2-CZ3 4.14Å; W39-W42 HydrophobicContact CZ3-CE3 4.25Å; W39-W42 HydrophobicContact CZ3-CZ3 4.08Å; W39-W42 PolarHBondContact O-N 3.43Å; W39-V43 HydrophobicContact CD2-CG2 4.15Å; W39-V43 HydrophobicContact CG-CG2 4.41Å; W39-V43 HydrophobicContact CZ2-CG2 3.86Å; W39-V43 WeakPolarHBondContact O-CB 3.39Å; W39-V43 WeakPolarHBondContact O-CG2 3.49Å; W39-V43 PolarHBondContact O-N 3.12Å; W39-L75 HydrophobicContact CH2-CD2 4.31Å; W39-A78 HydrophobicContact CH2-CB 3.98Å; W39-Y79 HydrophobicContact CZ2-CD2 4.41Å; W39-Y79 AromaticContact NE1-CD2 3.71Å
40	D	55.6	Low	50.3	Low	81 Å²	81	87 Å²	87	43%	0.433	46%	0.455	S	S	.	.	H	α-helix	trans	-62.6	-42.2	179.5	-69.9	-12.6	0	0	0	110.8	Q36 D44	Q36-D40 PolarHBondContact NE2-OD1 2.96Å; Q36-D40 WeakPolarHBondContact O-CB 3.48Å; Q36-D40 PolarHBondContact O-N 2.92Å; D40-D44 VanDerWaalsContact O-CB 3.31Å; D40-D44 WeakPolarHBondContact O-CB 3.39Å; D40-D44 PolarHBondContact O-N 2.88Å
41	A	59.3	Low	50.7	Low	60 Å²	60	83.2 Å²	83.2	50%	0.496	44%	0.437	S	S	.	.	H	α-helix	trans	-62.9	-42.4	175.9	0	0	0	0	0	112.6	D37 W39 D44 E45	D37-A41 VanDerWaalsContact O-CB 3.3Å; D37-A41 WeakPolarHBondContact O-CB 3.42Å; D37-A41 PolarHBondContact O-N 3.46Å; W39-A41 VanDerWaalsContact C-N 3.34Å; W39-A41 PolarHBondContact O-N 2.97Å; A41-D44 PolarHBondContact O-N 3.47Å; A41-E45 WeakPolarHBondContact O-CB 3.3Å; A41-E45 PolarHBondContact O-N 3.1Å
42	W	55	Low	51.1	Low	103 Å²	103	79.3 Å²	79.3	39%	0.39	42%	0.422	S	S	.	.	H	α-helix	trans	-71.6	-42.1	179.2	-179.8	73.8	0	0	0	112.3	V38 W39 D44 E45 E46 L75	V38-W42 WeakPolarHBondContact O-CB 3.49Å; V38-W42 PolarHBondContact O-N 2.85Å; W39-W42 HydrophobicContact CE3-CE3 4.48Å; W39-W42 HydrophobicContact CH2-CZ3 4.14Å; W39-W42 HydrophobicContact CZ3-CE3 4.25Å; W39-W42 HydrophobicContact CZ3-CZ3 4.08Å; W39-W42 PolarHBondContact O-N 3.43Å; W42-D44 PolarHBondContact O-N 2.92Å; W42-E45 PolarHBondContact O-N 2.85Å; W42-E46 HydrophobicContact CD2-CG 3.83Å; W42-E46 HydrophobicContact CE3-CG 4.5Å; W42-E46 HydrophobicContact CG-CG 4.23Å; W42-E46 HydrophobicContact CH2-CG 4.21Å; W42-E46 HydrophobicContact CZ2-CG 3.46Å; W42-E46 VanDerWaalsContact CZ2-CG 3.46Å; W42-E46 PolarHBondContact NE1-OE1 3.35Å; W42-E46 WeakPolarHBondContact O-CB 3.41Å; W42-E46 WeakPolarHBondContact O-CG 3.33Å; W42-E46 PolarHBondContact O-N 3.28Å; W42-L75 HydrophobicContact CE3-CD2 4.2Å; W42-L75 HydrophobicContact CH2-CD2 3.5Å; W42-L75 HydrophobicContact CZ3-CD2 3.13Å
43	V	53.5	Low	51.3	Low	39 Å²	39	78.4 Å²	78.4	24%	0.236	42%	0.417	C	S	.	.	H	α-helix	trans	-58.9	-42	172.8	170.9	0	0	0	0	109.7	W39 V47	W39-V43 HydrophobicContact CD2-CG2 4.15Å; W39-V43 HydrophobicContact CG-CG2 4.41Å; W39-V43 HydrophobicContact CZ2-CG2 3.86Å; W39-V43 WeakPolarHBondContact O-CB 3.39Å; W39-V43 WeakPolarHBondContact O-CG2 3.49Å; W39-V43 PolarHBondContact O-N 3.12Å; V43-V47 HydrophobicContact CG1-CG2 3.93Å; V43-V47 WeakPolarHBondContact O-CB 3.47Å; V43-V47 WeakPolarHBondContact O-CG2 3.37Å; V43-V47 PolarHBondContact O-N 2.9Å
44	D	59.4	Low	51.2	Low	96 Å²	96	79 Å²	79	51%	0.513	42%	0.415	S	S	.	.	H	α-helix	trans	-63.7	-47.7	177.6	-155.4	42.5	0	0	0	111	D40 A41 W42 H48	D40-D44 VanDerWaalsContact O-CB 3.31Å; D40-D44 WeakPolarHBondContact O-CB 3.39Å; D40-D44 PolarHBondContact O-N 2.88Å; A41-D44 PolarHBondContact O-N 3.47Å; W42-D44 PolarHBondContact O-N 2.92Å; D44-H48 VanDerWaalsContact O-CB 3.27Å; D44-H48 WeakPolarHBondContact O-CB 3.43Å; D44-H48 PolarHBondContact O-N 2.88Å; D44-H48 PolarHBondContact O-ND1 2.79Å; D44-H48 IonicContact OD1-CE1 3.07Å; D44-H48 PolarHBondContact OD1-CE1 3.12Å; D44-H48 IonicContact OD1-ND1 3.28Å; D44-H48 PolarHBondContact OD1-ND1 3.24Å; D44-H48 IonicContact OD2-CE1 3.78Å
45	E	57.8	Low	51.1	Low	134 Å²	134	83.3 Å²	83.3	63%	0.626	44%	0.435	S	S	*	.	H	α-helix	trans	-63.2	-48.9	179.7	-170.5	169.7	-159.5	0	0	112.7	A41 W42 H48 E49	A41-E45 WeakPolarHBondContact O-CB 3.3Å; A41-E45 PolarHBondContact O-N 3.1Å; W42-E45 PolarHBondContact O-N 2.85Å; E45-H48 PolarHBondContact O-N 3.3Å; E45-E49 WeakPolarHBondContact O-CB 3.45Å; E45-E49 PolarHBondContact O-N 3.05Å
46	E	50.8	Low	51	Low	66 Å²	66	86.2 Å²	86.2	31%	0.308	45%	0.45	S	S	.	.	H	α-helix	trans	-69	-39.3	179.3	-71.7	-78.1	165.9	0	0	112.6	W42 H48 F50	W42-E46 HydrophobicContact CD2-CG 3.83Å; W42-E46 HydrophobicContact CE3-CG 4.5Å; W42-E46 HydrophobicContact CG-CG 4.23Å; W42-E46 HydrophobicContact CH2-CG 4.21Å; W42-E46 HydrophobicContact CZ2-CG 3.46Å; W42-E46 VanDerWaalsContact CZ2-CG 3.46Å; W42-E46 PolarHBondContact NE1-OE1 3.35Å; W42-E46 WeakPolarHBondContact O-CB 3.41Å; W42-E46 WeakPolarHBondContact O-CG 3.33Å; W42-E46 PolarHBondContact O-N 3.28Å; E46-H48 VanDerWaalsContact C-N 3.27Å; E46-H48 PolarHBondContact O-N 2.72Å; E46-F50 WeakPolarHBondContact O-CB 3.5Å; E46-F50 PolarHBondContact O-N 3.46Å
47	V	52	Low	50.7	Low	42 Å²	42	84 Å²	84	26%	0.255	45%	0.45	S	S	.	.	H	α-helix	trans	-64.2	-38.4	175.3	170.5	0	0	0	0	109.7	V43 Q51 L75	V43-V47 HydrophobicContact CG1-CG2 3.93Å; V43-V47 WeakPolarHBondContact O-CB 3.47Å; V43-V47 WeakPolarHBondContact O-CG2 3.37Å; V43-V47 PolarHBondContact O-N 2.9Å; V47-Q51 HydrophobicContact CG1-CG 4.5Å; V47-Q51 WeakPolarHBondContact O-CB 3.31Å; V47-Q51 WeakPolarHBondContact O-CG 3.3Å; V47-Q51 PolarHBondContact O-N 3.41Å; V47-L75 HydrophobicContact CG2-CD1 4.33Å
48	H	48.8	Very low	50.1	Low	96 Å²	96	81.9 Å²	81.9	44%	0.444	46%	0.458	S	S	.	.	H	α-helix	trans	-69.2	-48.9	175.9	-81.3	83.5	0	0	0	112.4	D44 E45 E46 F50 Q51 D52	D44-H48 VanDerWaalsContact O-CB 3.27Å; D44-H48 WeakPolarHBondContact O-CB 3.43Å; D44-H48 PolarHBondContact O-N 2.88Å; D44-H48 PolarHBondContact O-ND1 2.79Å; D44-H48 IonicContact OD1-CE1 3.07Å; D44-H48 PolarHBondContact OD1-CE1 3.12Å; D44-H48 IonicContact OD1-ND1 3.28Å; D44-H48 PolarHBondContact OD1-ND1 3.24Å; D44-H48 IonicContact OD2-CE1 3.78Å; E45-H48 PolarHBondContact O-N 3.3Å; E46-H48 VanDerWaalsContact C-N 3.27Å; E46-H48 PolarHBondContact O-N 2.72Å; H48-F50 VanDerWaalsContact C-N 3.25Å; H48-F50 PolarHBondContact O-N 2.83Å; H48-Q51 WeakPolarHBondContact O-CB 3.49Å; H48-Q51 PolarHBondContact O-N 2.93Å; H48-Q51 VanDerWaalsContact O-N 3.12Å; H48-D52 PolarHBondContact O-N 3.3Å
49	E	50.7	Low	49.6	Very low	117 Å²	117	83 Å²	83	55%	0.547	47%	0.47	S	S	.	.	H	α-helix	trans	-60.5	-39.8	177.8	-173.1	173.1	-176.4	0	0	110.7	E45 D52 V53	E45-E49 WeakPolarHBondContact O-CB 3.45Å; E45-E49 PolarHBondContact O-N 3.05Å; E49-D52 PolarHBondContact O-N 3.25Å; E49-V53 WeakPolarHBondContact O-CG2 3.38Å; E49-V53 PolarHBondContact O-N 3.46Å
50	F	47.3	Very low	49.1	Very low	54 Å²	54	85.6 Å²	85.6	24%	0.237	49%	0.487	C	S	.	.	H	α-helix	trans	-66.5	-42.5	174.9	-163.9	-93.1	0	0	0	111.8	E46 H48 D52 V53 V54 A67 A68 L71	E46-F50 WeakPolarHBondContact O-CB 3.5Å; E46-F50 PolarHBondContact O-N 3.46Å; H48-F50 VanDerWaalsContact C-N 3.25Å; H48-F50 PolarHBondContact O-N 2.83Å; F50-D52 VanDerWaalsContact C-N 3.26Å; F50-D52 PolarHBondContact O-N 2.97Å; F50-V53 PolarHBondContact O-N 2.9Å; F50-V54 HydrophobicContact CD1-CG2 3.57Å; F50-V54 HydrophobicContact CE1-CG2 3.35Å; F50-V54 HydrophobicContact CG-CG2 4.49Å; F50-V54 HydrophobicContact CZ-CG2 4.14Å; F50-V54 VanDerWaalsContact O-CB 3.26Å; F50-V54 WeakPolarHBondContact O-CB 3.14Å; F50-V54 WeakPolarHBondContact O-CG2 3.29Å; F50-V54 PolarHBondContact O-N 3.05Å; F50-A67 HydrophobicContact CZ-CB 3.83Å; F50-A68 HydrophobicContact CD1-CB 4.32Å; F50-A68 HydrophobicContact CE1-CB 3.74Å; F50-L71 HydrophobicContact CB-CD2 4.27Å; F50-L71 HydrophobicContact CD2-CD2 4.2Å; F50-L71 HydrophobicContact CG-CD2 4.09Å
51	Q	45.9	Very low	48.5	Very low	96 Å²	96	86.6 Å²	86.6	45%	0.449	50%	0.499	S	S	.	.	H	α-helix	trans	-58.5	-38.5	174	-80.9	178.3	29.6	0	0	112	V47 H48 V54 L55	V47-Q51 HydrophobicContact CG1-CG 4.5Å; V47-Q51 WeakPolarHBondContact O-CB 3.31Å; V47-Q51 WeakPolarHBondContact O-CG 3.3Å; V47-Q51 PolarHBondContact O-N 3.41Å; H48-Q51 WeakPolarHBondContact O-CB 3.49Å; H48-Q51 PolarHBondContact O-N 2.93Å; H48-Q51 VanDerWaalsContact O-N 3.12Å; Q51-V54 WeakPolarHBondContact O-CB 3.36Å; Q51-V54 PolarHBondContact O-N 2.84Å; Q51-L55 WeakPolarHBondContact O-CB 3.22Å; Q51-L55 VanDerWaalsContact O-CG 3.26Å; Q51-L55 WeakPolarHBondContact O-CG 3.42Å; Q51-L55 PolarHBondContact O-N 2.89Å
52	D	44	Very low	48	Very low	105 Å²	105	93.9 Å²	93.9	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-66.4	-45.7	175.4	-86.9	-11.4	0	0	0	111.6	H48 E49 F50 V54 L55 V56	H48-D52 PolarHBondContact O-N 3.3Å; E49-D52 PolarHBondContact O-N 3.25Å; F50-D52 VanDerWaalsContact C-N 3.26Å; F50-D52 PolarHBondContact O-N 2.97Å; D52-V54 PolarHBondContact O-N 3.27Å; D52-L55 PolarHBondContact O-N 3.39Å; D52-V56 VanDerWaalsContact O-CG2 3.23Å; D52-V56 WeakPolarHBondContact O-CG2 3.4Å; D52-V56 PolarHBondContact O-N 2.91Å
53	V	46.7	Very low	47.5	Very low	95 Å²	95	92.2 Å²	92.2	58%	0.576	51%	0.514	S	S	*	.	H	α-helix	trans	-59.6	-38.2	173.9	174.7	0	0	0	0	111.1	E49 F50 G57	E49-V53 WeakPolarHBondContact O-CG2 3.38Å; E49-V53 PolarHBondContact O-N 3.46Å; F50-V53 PolarHBondContact O-N 2.9Å; V53-G57 PolarHBondContact O-N 2.92Å
54	V	38.5	Very low	47.2	Very low	39 Å²	39	91.7 Å²	91.7	24%	0.236	51%	0.511	C	S	.	.	H	α-helix	trans	-65.4	-44	177.3	153.5	0	0	0	0	112.2	F50 Q51 D52 V64	F50-V54 HydrophobicContact CD1-CG2 3.57Å; F50-V54 HydrophobicContact CE1-CG2 3.35Å; F50-V54 HydrophobicContact CG-CG2 4.49Å; F50-V54 HydrophobicContact CZ-CG2 4.14Å; F50-V54 VanDerWaalsContact O-CB 3.26Å; F50-V54 WeakPolarHBondContact O-CB 3.14Å; F50-V54 WeakPolarHBondContact O-CG2 3.29Å; F50-V54 PolarHBondContact O-N 3.05Å; Q51-V54 WeakPolarHBondContact O-CB 3.36Å; Q51-V54 PolarHBondContact O-N 2.84Å; D52-V54 PolarHBondContact O-N 3.27Å; V54-V64 HydrophobicContact CB-CG1 3.77Å; V54-V64 HydrophobicContact CG1-CG1 3.3Å; V54-V64 HydrophobicContact CG2-CG1 3.35Å
55	L	44.1	Very low	46.6	Very low	131 Å²	131	92.3 Å²	92.3	69%	0.686	51%	0.514	S	S	*	.	H	α-helix	trans	-71.8	-33.3	179.8	-73.2	166.9	0	0	0	112	Q51 D52	Q51-L55 WeakPolarHBondContact O-CB 3.22Å; Q51-L55 VanDerWaalsContact O-CG 3.26Å; Q51-L55 WeakPolarHBondContact O-CG 3.42Å; Q51-L55 PolarHBondContact O-N 2.89Å; D52-L55 PolarHBondContact O-N 3.39Å
56	V	49.1	Very low	46.4	Very low	125 Å²	125	87.5 Å²	87.5	76%	0.758	50%	0.498	S	S	*	.	H	α-helix	trans	-78.1	-29.8	178.1	-179.4	0	0	0	0	111.6	D52 G58	D52-V56 VanDerWaalsContact O-CG2 3.23Å; D52-V56 WeakPolarHBondContact O-CG2 3.4Å; D52-V56 PolarHBondContact O-N 2.91Å; V56-G58 PolarHBondContact O-N 3.07Å
57	G	43.9	Very low	46.6	Very low	40 Å²	40	86 Å²	86	41%	0.412	50%	0.497	S	S	.	.			trans	-73	58.3	174.6	0	0	0	0	0	113.6	V53 S59	V53-G57 PolarHBondContact O-N 2.92Å; G57-S59 PolarHBondContact O-N 3.41Å
58	G	44.3	Very low	46.6	Very low	80 Å²	80	85.8 Å²	85.8	83%	0.825	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65	24.3	-173.1	0	0	0	0	0	117.7	V56	V56-G58 PolarHBondContact O-N 3.07Å
59	S	42.4	Very low	46.5	Very low	102 Å²	102	84.5 Å²	84.5	71%	0.713	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-121	-13	-171.3	-160	0	0	0	0	117.4	G57	G57-S59 PolarHBondContact O-N 3.41Å
60	D	42.7	Very low	46.7	Very low	97 Å²	97	81.3 Å²	81.3	52%	0.519	49%	0.488	S	S	.	.			trans	-159.6	80.2	177.7	-94.6	-50.1	0	0	0	112.1	R62 V63 V64	D60-R62 PolarHBondContact O-N 3.28Å; D60-V63 HydrophobicContact CB-CB 3.98Å; D60-V63 HydrophobicContact CB-CG2 3.74Å; D60-V63 PolarHBondContact O-N 3.09Å; D60-V64 PolarHBondContact O-N 3.49Å
61	C	41.9	Very low	47.2	Very low	101 Å²	101	81.1 Å²	81.1	68%	0.682	49%	0.489	S	S	*	.	H	α-helix	trans	-52	-27.3	178.4	10.4	0	0	0	0	113.4	D65	C61-D65 PolarHBondContact O-N 3.41Å
62	R	48.9	Very low	47.4	Very low	213 Å²	213	81.2 Å²	81.2	80%	0.804	49%	0.492	S	S	*	.	H	α-helix	trans	-71.6	-36.1	176.4	-63.9	-175.6	176.9	-158.1	-1.5	114	D60 V64	D60-R62 PolarHBondContact O-N 3.28Å; R62-V64 VanDerWaalsContact C-N 3.3Å
63	V	44	Very low	47.8	Very low	68 Å²	68	80 Å²	80	41%	0.412	49%	0.49	S	S	.	.	H	α-helix	trans	-73.7	-34.1	179.9	176.5	0	0	0	0	109.5	K14 D60 A67	K14-V63 PolarHBondContact NZ-O 2.79Å; K14-V63 VanDerWaalsContact NZ-O 3.11Å; D60-V63 HydrophobicContact CB-CB 3.98Å; D60-V63 HydrophobicContact CB-CG2 3.74Å; D60-V63 PolarHBondContact O-N 3.09Å; V63-A67 PolarHBondContact O-N 3.17Å; V63-A67 VanDerWaalsContact O-N 3.15Å
64	V	47.7	Very low	48.3	Very low	28 Å²	28	76.8 Å²	76.8	17%	0.17	47%	0.474	C	S	.	.	H	α-helix	trans	-70.7	-50.4	178.7	166.9	0	0	0	0	112.2	V54 D60 R62 A66 A67 A68	V54-V64 HydrophobicContact CB-CG1 3.77Å; V54-V64 HydrophobicContact CG1-CG1 3.3Å; V54-V64 HydrophobicContact CG2-CG1 3.35Å; D60-V64 PolarHBondContact O-N 3.49Å; R62-V64 VanDerWaalsContact C-N 3.3Å; V64-A66 PolarHBondContact O-N 3.47Å; V64-A67 PolarHBondContact O-N 2.95Å; V64-A68 WeakPolarHBondContact O-CB 3.43Å; V64-A68 PolarHBondContact O-N 3.39Å
65	D	47.1	Very low	49.1	Very low	109 Å²	109	75.7 Å²	75.7	58%	0.583	47%	0.467	S	S	*	.	H	α-helix	trans	-56.9	-39.4	177.5	-81.8	-15.7	0	0	0	111.5	C61 S69	C61-D65 PolarHBondContact O-N 3.41Å; D65-S69 VanDerWaalsContact O-CB 3.22Å; D65-S69 WeakPolarHBondContact O-CB 3.45Å; D65-S69 PolarHBondContact O-N 3.21Å; D65-S69 PolarHBondContact O-OG 3.39Å
66	A	53.7	Low	49.5	Very low	34 Å²	34	74.6 Å²	74.6	28%	0.281	46%	0.461	S	S	.	.	H	α-helix	trans	-66.8	-41.2	176.3	0	0	0	0	0	112.2	V64 L70	V64-A66 PolarHBondContact O-N 3.47Å; A66-L70 WeakPolarHBondContact O-CB 3.02Å; A66-L70 WeakPolarHBondContact O-CD1 3.42Å; A66-L70 WeakPolarHBondContact O-CG 3.06Å; A66-L70 PolarHBondContact O-N 3.34Å
67	A	53.9	Low	49.7	Very low	35 Å²	35	70.9 Å²	70.9	29%	0.289	44%	0.443	S	S	.	.	H	α-helix	trans	-69.3	-43.8	179.1	0	0	0	0	0	111.8	F50 V63 V64 S69 L70 L71	F50-A67 HydrophobicContact CZ-CB 3.83Å; V63-A67 PolarHBondContact O-N 3.17Å; V63-A67 VanDerWaalsContact O-N 3.15Å; V64-A67 PolarHBondContact O-N 2.95Å; A67-S69 VanDerWaalsContact C-N 3.34Å; A67-S69 PolarHBondContact O-N 3.07Å; A67-L70 PolarHBondContact O-N 3.47Å; A67-L71 PolarHBondContact O-N 3.48Å
68	A	52.8	Low	50.2	Low	37 Å²	37	70.4 Å²	70.4	31%	0.306	44%	0.436	S	S	.	.	H	α-helix	trans	-59.5	-45.4	174.4	0	0	0	0	0	111.3	F50 V64 L70 L71 L72	F50-A68 HydrophobicContact CD1-CB 4.32Å; F50-A68 HydrophobicContact CE1-CB 3.74Å; V64-A68 WeakPolarHBondContact O-CB 3.43Å; V64-A68 PolarHBondContact O-N 3.39Å; A68-L70 VanDerWaalsContact C-N 3.34Å; A68-L70 PolarHBondContact O-N 3.5Å; A68-L71 PolarHBondContact O-N 2.87Å; A68-L72 WeakPolarHBondContact O-CB 3.22Å; A68-L72 PolarHBondContact O-N 3.21Å
69	S	47.1	Very low	50.4	Low	68 Å²	68	70.2 Å²	70.2	48%	0.476	41%	0.411	S	S	.	.	H	α-helix	trans	-64.4	-38.2	178	-60.2	0	0	0	0	112.1	D65 A67 C73	D65-S69 VanDerWaalsContact O-CB 3.22Å; D65-S69 WeakPolarHBondContact O-CB 3.45Å; D65-S69 PolarHBondContact O-N 3.21Å; D65-S69 PolarHBondContact O-OG 3.39Å; A67-S69 VanDerWaalsContact C-N 3.34Å; A67-S69 PolarHBondContact O-N 3.07Å; S69-C73 WeakPolarHBondContact O-CB 3.39Å; S69-C73 PolarHBondContact O-N 2.88Å; S69-C73 PolarHBondContact O-SG 2.84Å
70	L	55.1	Low	50.7	Low	51 Å²	51	67 Å²	67	27%	0.267	39%	0.394	S	S	.	.	H	α-helix	trans	-68.2	-40.4	175.8	-74.2	164.8	0	0	0	111.7	A66 A67 A68 C73 A74	A66-L70 WeakPolarHBondContact O-CB 3.02Å; A66-L70 WeakPolarHBondContact O-CD1 3.42Å; A66-L70 WeakPolarHBondContact O-CG 3.06Å; A66-L70 PolarHBondContact O-N 3.34Å; A67-L70 PolarHBondContact O-N 3.47Å; A68-L70 VanDerWaalsContact C-N 3.34Å; A68-L70 PolarHBondContact O-N 3.5Å; L70-C73 PolarHBondContact O-N 3.48Å; L70-A74 WeakPolarHBondContact O-CB 3.48Å; L70-A74 PolarHBondContact O-N 3.47Å
71	L	56.3	Low	51	Low	49 Å²	49	66.7 Å²	66.7	26%	0.257	40%	0.395	S	S	.	.	H	α-helix	trans	-61.8	-48.1	174.6	-158.7	94.5	0	0	0	110.2	F50 A67 A68 C73 A74 L75	F50-L71 HydrophobicContact CB-CD2 4.27Å; F50-L71 HydrophobicContact CD2-CD2 4.2Å; F50-L71 HydrophobicContact CG-CD2 4.09Å; A67-L71 PolarHBondContact O-N 3.48Å; A68-L71 PolarHBondContact O-N 2.87Å; L71-C73 VanDerWaalsContact C-N 3.32Å; L71-C73 PolarHBondContact O-N 3.28Å; L71-A74 WeakPolarHBondContact O-CB 3.42Å; L71-A74 PolarHBondContact O-N 3.15Å; L71-A74 VanDerWaalsContact O-N 3.12Å; L71-L75 HydrophobicContact CD2-CD1 4.29Å; L71-L75 WeakPolarHBondContact O-CB 3.31Å; L71-L75 VanDerWaalsContact O-CG 3.29Å; L71-L75 WeakPolarHBondContact O-CG 3.34Å; L71-L75 PolarHBondContact O-N 3.01Å
72	L	52	Low	50.8	Low	99 Å²	99	64.2 Å²	64.2	52%	0.518	37%	0.373	S	S	.	.	H	α-helix	trans	-60.6	-40.3	176.5	-174.9	64.9	0	0	0	112.1	A68 L75 L76	A68-L72 WeakPolarHBondContact O-CB 3.22Å; A68-L72 PolarHBondContact O-N 3.21Å; L72-L75 PolarHBondContact O-N 3.22Å; L72-L76 HydrophobicContact CG-CD1 4.2Å; L72-L76 WeakPolarHBondContact O-CB 3.35Å; L72-L76 VanDerWaalsContact O-CG 3.3Å; L72-L76 WeakPolarHBondContact O-CG 3.13Å; L72-L76 PolarHBondContact O-N 2.71Å
73	C	51.4	Low	50.2	Low	78 Å²	78	58.1 Å²	58.1	53%	0.527	35%	0.354	S	S	.	.	H	α-helix	trans	-64.5	-40.8	174.5	-70.6	0	0	0	0	112	S69 L70 L71 L76 A77	S69-C73 WeakPolarHBondContact O-CB 3.39Å; S69-C73 PolarHBondContact O-N 2.88Å; S69-C73 PolarHBondContact O-SG 2.84Å; L70-C73 PolarHBondContact O-N 3.48Å; L71-C73 VanDerWaalsContact C-N 3.32Å; L71-C73 PolarHBondContact O-N 3.28Å; C73-L76 PolarHBondContact O-N 2.73Å; C73-A77 VanDerWaalsContact O-CB 3.28Å; C73-A77 WeakPolarHBondContact O-CB 3.48Å; C73-A77 PolarHBondContact O-N 2.95Å
74	A	57.3	Low	50	Low	28 Å²	28	64.1 Å²	64.1	23%	0.231	37%	0.369	C	S	.	.	H	α-helix	trans	-65.2	-41.5	176.8	0	0	0	0	0	111.4	L22 L70 L71 A77 A78	L22-A74 HydrophobicContact CG-CB 4.35Å; L70-A74 WeakPolarHBondContact O-CB 3.48Å; L70-A74 PolarHBondContact O-N 3.47Å; L71-A74 WeakPolarHBondContact O-CB 3.42Å; L71-A74 PolarHBondContact O-N 3.15Å; L71-A74 VanDerWaalsContact O-N 3.12Å; A74-A77 PolarHBondContact O-N 2.87Å; A74-A78 WeakPolarHBondContact O-CB 3.48Å; A74-A78 PolarHBondContact O-N 3.47Å
75	L	55.5	Low	49.4	Very low	17 Å²	17	66.9 Å²	66.9	9%	0.089	38%	0.383	C	S	.	.	H	α-helix	trans	-62.6	-46.1	174.5	-71.1	173.2	0	0	0	111.9	W39 W42 V47 L71 L72 A77 A78 Y79	W39-L75 HydrophobicContact CH2-CD2 4.31Å; W42-L75 HydrophobicContact CE3-CD2 4.2Å; W42-L75 HydrophobicContact CH2-CD2 3.5Å; W42-L75 HydrophobicContact CZ3-CD2 3.13Å; V47-L75 HydrophobicContact CG2-CD1 4.33Å; L71-L75 HydrophobicContact CD2-CD1 4.29Å; L71-L75 WeakPolarHBondContact O-CB 3.31Å; L71-L75 VanDerWaalsContact O-CG 3.29Å; L71-L75 WeakPolarHBondContact O-CG 3.34Å; L71-L75 PolarHBondContact O-N 3.01Å; L72-L75 PolarHBondContact O-N 3.22Å; L75-A77 VanDerWaalsContact C-N 3.32Å; L75-A77 PolarHBondContact O-N 3.34Å; L75-A78 PolarHBondContact O-N 3.29Å; L75-Y79 WeakPolarHBondContact O-CB 3.34Å; L75-Y79 PolarHBondContact O-N 2.92Å
76	L	51.6	Low	48.9	Very low	107 Å²	107	65.5 Å²	65.5	56%	0.56	38%	0.375	S	S	*	.	H	α-helix	trans	-65.6	-34.8	175.7	-73	170.9	0	0	0	112.2	L72 C73 G80	L72-L76 HydrophobicContact CG-CD1 4.2Å; L72-L76 WeakPolarHBondContact O-CB 3.35Å; L72-L76 VanDerWaalsContact O-CG 3.3Å; L72-L76 WeakPolarHBondContact O-CG 3.13Å; L72-L76 PolarHBondContact O-N 2.71Å; C73-L76 PolarHBondContact O-N 2.73Å; L76-G80 PolarHBondContact O-N 2.82Å
77	A	53.2	Low	48	Very low	47 Å²	47	70.2 Å²	70.2	39%	0.388	39%	0.391	S	S	.	.	H	α-helix	trans	-67.5	-45.3	174.1	0	0	0	0	0	111.2	C73 A74 L75 Y79 G80 V81	C73-A77 VanDerWaalsContact O-CB 3.28Å; C73-A77 WeakPolarHBondContact O-CB 3.48Å; C73-A77 PolarHBondContact O-N 2.95Å; A74-A77 PolarHBondContact O-N 2.87Å; L75-A77 VanDerWaalsContact C-N 3.32Å; L75-A77 PolarHBondContact O-N 3.34Å; A77-Y79 VanDerWaalsContact C-N 3.34Å; A77-Y79 PolarHBondContact O-N 2.9Å; A77-G80 PolarHBondContact O-N 2.71Å; A77-V81 VanDerWaalsContact O-CG2 3.28Å; A77-V81 WeakPolarHBondContact O-CG2 3.27Å; A77-V81 PolarHBondContact O-N 3.05Å
78	A	54.3	Low	47	Very low	31 Å²	31	74 Å²	74	26%	0.256	41%	0.41	S	S	.	.	H	α-helix	trans	-60.1	-44.1	174	0	0	0	0	0	111.1	W39 A74 L75 V81 H82	W39-A78 HydrophobicContact CH2-CB 3.98Å; A74-A78 WeakPolarHBondContact O-CB 3.48Å; A74-A78 PolarHBondContact O-N 3.47Å; L75-A78 PolarHBondContact O-N 3.29Å; A78-V81 PolarHBondContact O-N 3.11Å; A78-H82 VanDerWaalsContact O-CB 3.3Å; A78-H82 WeakPolarHBondContact O-CB 3.48Å; A78-H82 PolarHBondContact O-N 2.98Å
79	Y	49.3	Very low	46.5	Very low	76 Å²	76	79.5 Å²	79.5	30%	0.298	43%	0.428	S	S	.	.	H	α-helix	trans	-61.4	-44.8	173.5	-177.6	-95.9	0	0	0	112.3	W39 L75 A77 V81 H82 H83	W39-Y79 HydrophobicContact CZ2-CD2 4.41Å; W39-Y79 AromaticContact NE1-CD2 3.71Å; L75-Y79 WeakPolarHBondContact O-CB 3.34Å; L75-Y79 PolarHBondContact O-N 2.92Å; A77-Y79 VanDerWaalsContact C-N 3.34Å; A77-Y79 PolarHBondContact O-N 2.9Å; Y79-V81 VanDerWaalsContact C-N 3.34Å; Y79-V81 PolarHBondContact O-N 2.94Å; Y79-H82 WeakPolarHBondContact O-CB 3.39Å; Y79-H82 PolarHBondContact O-N 3.23Å; Y79-H83 HydrophobicContact CE1-CB 4.44Å; Y79-H83 WeakPolarHBondContact O-CB 3.17Å; Y79-H83 PolarHBondContact O-N 3.31Å
80	G	48.2	Very low	46.1	Very low	34 Å²	34	88.2 Å²	88.2	35%	0.351	45%	0.452	S	S	.	.	H	α-helix	trans	-63.2	-39.6	178.5	0	0	0	0	0	112.5	L76 A77 R84	L76-G80 PolarHBondContact O-N 2.82Å; A77-G80 PolarHBondContact O-N 2.71Å; G80-R84 WeakPolarHBondContact O-CB 3.39Å; G80-R84 VanDerWaalsContact O-CG 3.23Å; G80-R84 WeakPolarHBondContact O-CG 3.26Å; G80-R84 PolarHBondContact O-N 3.31Å; G80-R84 VanDerWaalsContact O-N 3.09Å
81	V	49	Very low	45.6	Very low	91 Å²	91	90.1 Å²	90.1	55%	0.552	46%	0.461	S	S	*	.	H	α-helix	trans	-65.8	-44.9	172.8	173.1	0	0	0	0	110.2	A77 A78 Y79 R84 L85	A77-V81 VanDerWaalsContact O-CG2 3.28Å; A77-V81 WeakPolarHBondContact O-CG2 3.27Å; A77-V81 PolarHBondContact O-N 3.05Å; A78-V81 PolarHBondContact O-N 3.11Å; Y79-V81 VanDerWaalsContact C-N 3.34Å; Y79-V81 PolarHBondContact O-N 2.94Å; V81-R84 WeakPolarHBondContact O-CB 3.19Å; V81-R84 PolarHBondContact O-N 2.97Å; V81-L85 HydrophobicContact CG1-CD1 4.08Å; V81-L85 HydrophobicContact CG1-CG 4.49Å; V81-L85 WeakPolarHBondContact O-CG 3.43Å; V81-L85 PolarHBondContact O-N 3.37Å
82	H	38.4	Very low	45.1	Very low	49 Å²	49	92.3 Å²	92.3	23%	0.227	47%	0.472	C	S	.	.	H	α-helix	trans	-61.2	-48	178	-175.5	-100	0	0	0	112.3	G33 A78 Y79 R84 L85 N86	G33-H82 WeakPolarHBondContact CA-NE2 3.46Å; A78-H82 VanDerWaalsContact O-CB 3.3Å; A78-H82 WeakPolarHBondContact O-CB 3.48Å; A78-H82 PolarHBondContact O-N 2.98Å; Y79-H82 WeakPolarHBondContact O-CB 3.39Å; Y79-H82 PolarHBondContact O-N 3.23Å; H82-R84 VanDerWaalsContact C-N 3.28Å; H82-R84 PolarHBondContact O-N 2.83Å; H82-L85 PolarHBondContact O-N 3.3Å; H82-L85 VanDerWaalsContact O-N 3.15Å; H82-N86 PolarHBondContact O-N 3.12Å
83	H	37.2	Very low	44.7	Very low	85 Å²	85	91.9 Å²	91.9	39%	0.394	47%	0.47	S	S	.	.	H	α-helix	trans	-64.7	-33.2	178.5	-164.6	-58.1	0	0	0	112	Y79 Q87	Y79-H83 HydrophobicContact CE1-CB 4.44Å; Y79-H83 WeakPolarHBondContact O-CB 3.17Å; Y79-H83 PolarHBondContact O-N 3.31Å; H83-Q87 PolarHBondContact CE1-NE2 2.98Å; H83-Q87 WeakPolarHBondContact O-CG 3.46Å; H83-Q87 PolarHBondContact O-N 2.77Å
84	R	38.2	Very low	44.3	Very low	193 Å²	193	92.7 Å²	92.7	73%	0.728	47%	0.466	S	S	*	.	H	α-helix	trans	-67.8	-43.1	172	-78.1	-112.4	-164.6	168.2	4.6	111.9	G80 V81 H82 N86 Q87 V88	G80-R84 WeakPolarHBondContact O-CB 3.39Å; G80-R84 VanDerWaalsContact O-CG 3.23Å; G80-R84 WeakPolarHBondContact O-CG 3.26Å; G80-R84 PolarHBondContact O-N 3.31Å; G80-R84 VanDerWaalsContact O-N 3.09Å; V81-R84 WeakPolarHBondContact O-CB 3.19Å; V81-R84 PolarHBondContact O-N 2.97Å; H82-R84 VanDerWaalsContact C-N 3.28Å; H82-R84 PolarHBondContact O-N 2.83Å; R84-N86 VanDerWaalsContact C-N 3.34Å; R84-Q87 PolarHBondContact O-N 3.23Å; R84-V88 WeakPolarHBondContact O-CG2 3.23Å; R84-V88 PolarHBondContact O-N 2.98Å; R84-V88 VanDerWaalsContact O-N 3.16Å
85	L	36.4	Very low	43.5	Very low	87 Å²	87	96.8 Å²	96.8	46%	0.455	48%	0.481	S	S	.	.	H	α-helix	trans	-60.8	-46.8	175.2	-70.4	169.9	0	0	0	109.9	V81 H82 Q87 V88 F89	V81-L85 HydrophobicContact CG1-CD1 4.08Å; V81-L85 HydrophobicContact CG1-CG 4.49Å; V81-L85 WeakPolarHBondContact O-CG 3.43Å; V81-L85 PolarHBondContact O-N 3.37Å; H82-L85 PolarHBondContact O-N 3.3Å; H82-L85 VanDerWaalsContact O-N 3.15Å; L85-Q87 VanDerWaalsContact C-N 3.3Å; L85-Q87 PolarHBondContact O-N 2.91Å; L85-V88 PolarHBondContact O-N 2.85Å; L85-F89 HydrophobicContact CD2-CE2 4.43Å; L85-F89 WeakPolarHBondContact O-CD2 3.26Å; L85-F89 PolarHBondContact O-N 3.25Å; L85-F89 VanDerWaalsContact O-N 3.16Å
86	N	35.9	Very low	42.7	Very low	80 Å²	80	102.1 Å²	102.1	43%	0.428	51%	0.507	S	S	.	.	H	α-helix	trans	-62.5	-33.6	178.6	-124	6	0	0	0	113.2	H82 R84 V88 F89 Y90	H82-N86 PolarHBondContact O-N 3.12Å; R84-N86 VanDerWaalsContact C-N 3.34Å; N86-V88 VanDerWaalsContact C-N 3.34Å; N86-F89 PolarHBondContact O-N 2.97Å; N86-Y90 PolarHBondContact O-N 2.85Å
87	Q	35.5	Very low	42.1	Very low	132 Å²	132	101.7 Å²	101.7	62%	0.617	50%	0.503	S	S	*	.	H	α-helix	trans	-73.3	-20.7	173.4	-81	-168.3	-7.4	0	0	114.4	H83 R84 L85	H83-Q87 PolarHBondContact CE1-NE2 2.98Å; H83-Q87 WeakPolarHBondContact O-CG 3.46Å; H83-Q87 PolarHBondContact O-N 2.77Å; R84-Q87 PolarHBondContact O-N 3.23Å; L85-Q87 VanDerWaalsContact C-N 3.3Å; L85-Q87 PolarHBondContact O-N 2.91Å
88	V	32.6	Very low	41.2	Very low	114 Å²	114	105.9 Å²	105.9	69%	0.691	51%	0.512	S	S	*	.	H	α-helix	trans	-82.9	-26.5	175.1	174.2	0	0	0	0	111	R84 L85 N86	R84-V88 WeakPolarHBondContact O-CG2 3.23Å; R84-V88 PolarHBondContact O-N 2.98Å; R84-V88 VanDerWaalsContact O-N 3.16Å; L85-V88 PolarHBondContact O-N 2.85Å; N86-V88 VanDerWaalsContact C-N 3.34Å
89	F	42.5	Very low	40.1	Very low	153 Å²	153	112.2 Å²	112.2	67%	0.671	53%	0.533	S	S	*	.	H	α-helix	trans	-95.6	-1.1	-178.9	-69.2	-71.7	0	0	0	115.1	L85 N86	L85-F89 HydrophobicContact CD2-CE2 4.43Å; L85-F89 WeakPolarHBondContact O-CD2 3.26Å; L85-F89 PolarHBondContact O-N 3.25Å; L85-F89 VanDerWaalsContact O-N 3.16Å; N86-F89 PolarHBondContact O-N 2.97Å
90	Y	38.1	Very low	39.3	Very low	252 Å²	252	115.5 Å²	115.5	99%	0.988	56%	0.555	S	S	*	*			trans	-112.6	0	172.7	-95	-85.8	0	0	0	112.1	N86	N86-Y90 PolarHBondContact O-N 2.85Å

Retrieved 90 of 90 residues in 110.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).