A0A077ZDZ1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZDZ1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 123 aa.

						>A0A077ZDZ1_TRITR|A0A077ZDZ1
MDETKKEKPPTDPDTVKTAKEFVDKKLKDEEKAVTWALQSTDITVLKGSNLTGQLIIHFNAIIRECPSETQKKMSKMLKFAVKDPMDNCKPNVINMKAEHPCSLLYSKYTGNSNLNCNMIRGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.4	Very low	55.5	Low	245 Å²	245	148 Å²	148	100%	1.207	74%	0.741	S	S	*	*				0	116.8	0	-81.1	175	170	0	0	106.6
2	D	35.3	Very low	58.3	Low	152 Å²	152	141.8 Å²	141.8	81%	0.813	71%	0.713	S	S	*	*			trans	42.1	85.6	-167.2	-76.7	-43.7	0	0	0	118	T4	D2-T4 PolarHBondContact O-N 3.36Å
3	E	37.1	Very low	60.6	Low	197 Å²	197	138.2 Å²	138.2	92%	0.921	71%	0.705	S	S	*	*			trans	-59.3	89.9	150.2	-69	-174.7	137.8	0	0	107.9	K5	E3-K5 PolarHBondContact O-N 3.25Å
4	T	42.8	Very low	62.9	Low	124 Å²	124	136.7 Å²	136.7	76%	0.761	70%	0.7	S	S	*	*			trans	-52	109.5	169	32.3	0	0	0	0	107.3	D2 K6	D2-T4 PolarHBondContact O-N 3.36Å; T4-K6 PolarHBondContact O-N 2.87Å
5	K	44.6	Very low	64.7	Low	193 Å²	193	131.4 Å²	131.4	84%	0.839	68%	0.676	S	S	*	*			trans	-47	108.7	169.3	-83	179.6	177.7	175.9	0	106.3	E3 E7	E3-K5 PolarHBondContact O-N 3.25Å; K5-E7 VanDerWaalsContact C-N 3.34Å; K5-E7 PolarHBondContact O-N 3.2Å
6	K	48.9	Very low	66.3	Low	199 Å²	199	125.5 Å²	125.5	87%	0.865	65%	0.648	S	S	*	*			trans	-57.7	105.5	172.2	-78.5	-175.6	178.6	178.5	0	106	T4 K8	T4-K6 PolarHBondContact O-N 2.87Å; K6-K8 PolarHBondContact O-N 3.47Å; K6-K8 VanDerWaalsContact O-N 3.16Å
7	E	63.1	Low	67.9	Low	95 Å²	95	125.5 Å²	125.5	44%	0.444	64%	0.642	S	S	.	*	P	Polyproline II helix	trans	-59.2	120.4	171.7	-82.8	155.4	-167.9	0	0	107.3	K5 V45 K47	K5-E7 VanDerWaalsContact C-N 3.34Å; K5-E7 PolarHBondContact O-N 3.2Å; E7-V45 HydrophobicContact CB-CG2 4.25Å; E7-K47 WeakPolarHBondContact OE1-CE 3.42Å; E7-K47 IonicContact OE1-NZ 2.56Å; E7-K47 PolarHBondContact OE1-NZ 3.15Å; E7-K47 WeakPolarHBondContact OE2-CE 3.47Å; E7-K47 IonicContact OE2-NZ 2.76Å; E7-K47 PolarHBondContact OE2-NZ 2.9Å
8	K	65	Low	69.3	Low	183 Å²	183	123.6 Å²	123.6	80%	0.796	64%	0.637	S	S	*	*	P	Polyproline II helix	trans	-71.1	141.5	179.5	-68.3	-177	179.5	-180	0	107.8	K6	K6-K8 PolarHBondContact O-N 3.47Å; K6-K8 VanDerWaalsContact O-N 3.16Å
9	P	76.2	Confident	70.5	Confident	74 Å²	74	117.5 Å²	117.5	48%	0.481	61%	0.607	S	S	.	*	P	Polyproline II helix	trans	-57.3	148.9	172.8	24.8	-33.4	0	0	0	110.2	T11 T44	P9-T11 PolarHBondContact O-N 3.27Å; P9-T44 WeakPolarHBondContact CA-O 3.31Å
10	P	79.4	Confident	71.7	Confident	32 Å²	32	114.6 Å²	114.6	21%	0.208	59%	0.59	C	S	.	*	P	Polyproline II helix	trans	-57.9	130.6	173.6	25.1	-32.8	0	0	0	109.6	V16 I43 L46	P10-V16 HydrophobicContact CB-CG2 3.94Å; P10-V16 HydrophobicContact CG-CG2 3.76Å; P10-V16 WeakPolarHBondContact O-CG2 3.35Å; P10-I43 HydrophobicContact CG-CG2 3.99Å; P10-L46 HydrophobicContact CB-CB 4.44Å; P10-L46 HydrophobicContact CG-CB 4.2Å
11	T	83.5	Confident	72.9	Confident	134 Å²	134	114.5 Å²	114.5	82%	0.822	59%	0.587	S	S	*	*			trans	-96.6	-15.6	-176.3	54.1	0	0	0	0	113.4	P9 P13	P9-T11 PolarHBondContact O-N 3.27Å; T11-P13 WeakPolarHBondContact O-CD 3.35Å
12	D	89.2	Confident	75.7	Confident	74 Å²	74	105.5 Å²	105.5	40%	0.396	54%	0.541	S	S	.	.			trans	-79.7	113.8	-177.6	177.9	60.3	0	0	0	111.2	D14 T15 V16	D12-D14 VanDerWaalsContact C-N 3.33Å; D12-D14 PolarHBondContact O-N 2.85Å; D12-T15 PolarHBondContact O-N 3.45Å; D12-T15 WeakPolarHBondContact OD2-CB 3.21Å; D12-T15 PolarHBondContact OD2-N 3.47Å; D12-T15 PolarHBondContact OD2-OG1 2.78Å; D12-V16 VanDerWaalsContact O-CG2 3.32Å; D12-V16 WeakPolarHBondContact O-CG2 3.3Å; D12-V16 PolarHBondContact O-N 2.91Å
13	P	89	Confident	78.5	Confident	95 Å²	95	98.3 Å²	98.3	62%	0.617	50%	0.502	S	S	*	.	H	α-helix	trans	-60.9	-37.2	-172.9	-24.4	34.9	0	0	0	114	T11 V16 K17	T11-P13 WeakPolarHBondContact O-CD 3.35Å; P13-V16 PolarHBondContact O-N 2.58Å; P13-K17 VanDerWaalsContact O-CB 3.31Å; P13-K17 WeakPolarHBondContact O-CB 3.43Å; P13-K17 PolarHBondContact O-N 2.85Å
14	D	91.7	Very high	81.3	Confident	117 Å²	117	90.9 Å²	90.9	63%	0.626	47%	0.469	S	S	*	.	H	α-helix	trans	-69.4	-40.3	179.7	-73.9	-25.2	0	0	0	111.3	D12 K17 T18	D12-D14 VanDerWaalsContact C-N 3.33Å; D12-D14 PolarHBondContact O-N 2.85Å; D14-K17 PolarHBondContact O-N 3.22Å; D14-T18 WeakPolarHBondContact O-CB 3.14Å; D14-T18 PolarHBondContact O-N 3.45Å; D14-T18 PolarHBondContact O-OG1 2.84Å
15	T	89.8	Confident	83.7	Confident	57 Å²	57	91.5 Å²	91.5	35%	0.35	46%	0.461	S	S	.	.	H	α-helix	trans	-62.8	-45.4	172.2	-63.2	0	0	0	0	111.5	D12 T18 A19 L46	D12-T15 PolarHBondContact O-N 3.45Å; D12-T15 WeakPolarHBondContact OD2-CB 3.21Å; D12-T15 PolarHBondContact OD2-N 3.47Å; D12-T15 PolarHBondContact OD2-OG1 2.78Å; T15-T18 PolarHBondContact O-N 3.46Å; T15-A19 VanDerWaalsContact O-CB 3.28Å; T15-A19 WeakPolarHBondContact O-CB 3.42Å; T15-A19 PolarHBondContact O-N 2.85Å; T15-L46 HydrophobicContact CG2-CD2 3.3Å
16	V	91	Very high	86	Confident	37 Å²	37	83.7 Å²	83.7	22%	0.224	43%	0.427	C	S	.	.	H	α-helix	trans	-62	-45.8	177.7	176.5	0	0	0	0	110.8	P10 D12 P13 A19 K20 I43	P10-V16 HydrophobicContact CB-CG2 3.94Å; P10-V16 HydrophobicContact CG-CG2 3.76Å; P10-V16 WeakPolarHBondContact O-CG2 3.35Å; D12-V16 VanDerWaalsContact O-CG2 3.32Å; D12-V16 WeakPolarHBondContact O-CG2 3.3Å; D12-V16 PolarHBondContact O-N 2.91Å; P13-V16 PolarHBondContact O-N 2.58Å; V16-A19 PolarHBondContact O-N 3.23Å; V16-K20 VanDerWaalsContact O-CB 3.28Å; V16-K20 WeakPolarHBondContact O-CB 3.38Å; V16-K20 PolarHBondContact O-N 2.96Å; V16-I43 HydrophobicContact CG1-CB 4.38Å; V16-I43 HydrophobicContact CG1-CG1 4.32Å
17	K	93.1	Very high	88.1	Confident	126 Å²	126	74.4 Å²	74.4	55%	0.548	39%	0.387	S	S	.	.	H	α-helix	trans	-60.3	-47.8	177.5	-176.6	-178	173.6	-171.8	0	111.7	P13 D14 A19 K20 E21	P13-K17 VanDerWaalsContact O-CB 3.31Å; P13-K17 WeakPolarHBondContact O-CB 3.43Å; P13-K17 PolarHBondContact O-N 2.85Å; D14-K17 PolarHBondContact O-N 3.22Å; K17-A19 PolarHBondContact O-N 2.8Å; K17-K20 WeakPolarHBondContact O-CB 3.36Å; K17-K20 PolarHBondContact O-N 3.38Å; K17-E21 WeakPolarHBondContact CE-OE1 3.32Å; K17-E21 WeakPolarHBondContact O-CG 3.33Å; K17-E21 PolarHBondContact O-N 2.93Å
18	T	93.1	Very high	89.4	Confident	90 Å²	90	77.8 Å²	77.8	55%	0.552	40%	0.4	S	S	*	.	H	α-helix	trans	-62.3	-43.7	178.5	-56.8	0	0	0	0	111.5	D14 T15 K20 E21 F22	D14-T18 WeakPolarHBondContact O-CB 3.14Å; D14-T18 PolarHBondContact O-N 3.45Å; D14-T18 PolarHBondContact O-OG1 2.84Å; T15-T18 PolarHBondContact O-N 3.46Å; T18-K20 VanDerWaalsContact C-N 3.34Å; T18-K20 PolarHBondContact O-N 3.21Å; T18-E21 PolarHBondContact O-N 3.23Å; T18-F22 WeakPolarHBondContact O-CB 3.18Å; T18-F22 PolarHBondContact O-N 2.95Å
19	A	92.8	Very high	90.6	Very high	8 Å²	8	73.6 Å²	73.6	7%	0.066	39%	0.387	C	S	.	.	H	α-helix	trans	-63.4	-41.4	176.8	0	0	0	0	0	111.4	T15 V16 K17 F22 V23 I43 L46	T15-A19 VanDerWaalsContact O-CB 3.28Å; T15-A19 WeakPolarHBondContact O-CB 3.42Å; T15-A19 PolarHBondContact O-N 2.85Å; V16-A19 PolarHBondContact O-N 3.23Å; K17-A19 PolarHBondContact O-N 2.8Å; A19-F22 PolarHBondContact O-N 3.45Å; A19-V23 WeakPolarHBondContact O-CB 3.31Å; A19-V23 VanDerWaalsContact O-CG2 3.28Å; A19-V23 WeakPolarHBondContact O-CG2 3.14Å; A19-V23 PolarHBondContact O-N 2.92Å; A19-I43 HydrophobicContact CB-CG1 4.36Å; A19-L46 HydrophobicContact CB-CD1 4.18Å; A19-L46 HydrophobicContact CB-CD2 4.1Å
20	K	94.7	Very high	91	Very high	60 Å²	60	71.9 Å²	71.9	26%	0.261	37%	0.372	S	S	.	.	H	α-helix	trans	-61.5	-49.9	176	-171.3	-176.1	177.8	62.9	0	111.9	V16 K17 T18 F22 V23 D24 S40 T41 I43	V16-K20 VanDerWaalsContact O-CB 3.28Å; V16-K20 WeakPolarHBondContact O-CB 3.38Å; V16-K20 PolarHBondContact O-N 2.96Å; K17-K20 WeakPolarHBondContact O-CB 3.36Å; K17-K20 PolarHBondContact O-N 3.38Å; T18-K20 VanDerWaalsContact C-N 3.34Å; T18-K20 PolarHBondContact O-N 3.21Å; K20-F22 VanDerWaalsContact C-N 3.29Å; K20-F22 PolarHBondContact O-N 3.31Å; K20-V23 PolarHBondContact O-N 2.88Å; K20-D24 WeakPolarHBondContact O-CB 3.31Å; K20-D24 PolarHBondContact O-N 3.4Å; K20-S40 WeakPolarHBondContact CG-OG 3.34Å; K20-S40 PolarHBondContact NZ-O 3.22Å; K20-S40 PolarHBondContact NZ-OG 3.39Å; K20-S40 VanDerWaalsContact NZ-OG 3.1Å; K20-T41 PolarHBondContact NZ-O 3.13Å; K20-I43 HydrophobicContact CB-CG1 4.39Å
21	E	95.4	Very high	91.3	Very high	112 Å²	112	72.1 Å²	72.1	52%	0.523	37%	0.37	S	S	.	.	H	α-helix	trans	-59.9	-40.6	177.1	-72.6	174.3	-176.9	0	0	111.7	K17 T18 K25	K17-E21 WeakPolarHBondContact CE-OE1 3.32Å; K17-E21 WeakPolarHBondContact O-CG 3.33Å; K17-E21 PolarHBondContact O-N 2.93Å; T18-E21 PolarHBondContact O-N 3.23Å; E21-K25 WeakPolarHBondContact O-CB 3.28Å; E21-K25 PolarHBondContact O-N 3.48Å
22	F	94.4	Very high	91.1	Very high	57 Å²	57	74.1 Å²	74.1	25%	0.25	37%	0.368	C	S	.	.	H	α-helix	trans	-62.8	-47.3	174.6	175.4	-101.5	0	0	0	112.3	T18 A19 K20 K25 K26 L55 I57 L104 Y106	T18-F22 WeakPolarHBondContact O-CB 3.18Å; T18-F22 PolarHBondContact O-N 2.95Å; A19-F22 PolarHBondContact O-N 3.45Å; K20-F22 VanDerWaalsContact C-N 3.29Å; K20-F22 PolarHBondContact O-N 3.31Å; F22-K25 PolarHBondContact O-N 3.37Å; F22-K26 HydrophobicContact CE1-CG 4.17Å; F22-K26 HydrophobicContact CE2-CG 4.2Å; F22-K26 HydrophobicContact CZ-CG 3.96Å; F22-K26 WeakPolarHBondContact O-CG 3.4Å; F22-K26 PolarHBondContact O-N 2.97Å; F22-L55 HydrophobicContact CD1-CD2 4.38Å; F22-L55 HydrophobicContact CE1-CD2 3.97Å; F22-I57 HydrophobicContact CD1-CD1 3.75Å; F22-I57 HydrophobicContact CE1-CD1 4.04Å; F22-L104 HydrophobicContact CD1-CD2 4.24Å; F22-L104 HydrophobicContact CE1-CD2 3.62Å; F22-Y106 HydrophobicContact CE1-CG 4.31Å; F22-Y106 AromaticContact CZ-CD1 3.9Å; F22-Y106 HydrophobicContact CZ-CD1 3.9Å; F22-Y106 AromaticContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CE1 4.19Å; F22-Y106 HydrophobicContact CZ-CE2 4.12Å; F22-Y106 AromaticContact CZ-CG 3.71Å; F22-Y106 HydrophobicContact CZ-CG 3.71Å
23	V	94.8	Very high	90.3	Very high	0 Å²	0	74.7 Å²	74.7	0%	0	38%	0.383	C	S	.	.	H	α-helix	trans	-62	-49.4	177.2	169.6	0	0	0	0	110.7	A19 K20 K25 K26 L27 I43 I57 F59 L104	A19-V23 WeakPolarHBondContact O-CB 3.31Å; A19-V23 VanDerWaalsContact O-CG2 3.28Å; A19-V23 WeakPolarHBondContact O-CG2 3.14Å; A19-V23 PolarHBondContact O-N 2.92Å; K20-V23 PolarHBondContact O-N 2.88Å; V23-K25 VanDerWaalsContact C-N 3.28Å; V23-K25 PolarHBondContact O-N 2.88Å; V23-K26 CarbonylContact O-C 3.58Å; V23-K26 WeakPolarHBondContact O-CA 3.35Å; V23-K26 PolarHBondContact O-N 3.04Å; V23-L27 HydrophobicContact CG1-CD1 3.94Å; V23-L27 HydrophobicContact CG1-CG 4.1Å; V23-L27 WeakPolarHBondContact O-CG 3.45Å; V23-L27 PolarHBondContact O-N 3.5Å; V23-I43 HydrophobicContact CG2-CD1 4.21Å; V23-I57 HydrophobicContact CG2-CB 4.35Å; V23-I57 HydrophobicContact CG2-CD1 3.68Å; V23-I57 HydrophobicContact CG2-CG2 3.91Å; V23-F59 HydrophobicContact CG1-CD1 4.1Å; V23-F59 HydrophobicContact CG1-CD2 3.82Å; V23-F59 HydrophobicContact CG1-CE1 3.86Å; V23-F59 HydrophobicContact CG1-CE2 3.54Å; V23-F59 HydrophobicContact CG1-CG 4.09Å; V23-F59 HydrophobicContact CG1-CZ 3.56Å; V23-F59 HydrophobicContact CG2-CD1 4.39Å; V23-L104 HydrophobicContact CG2-CD2 4.42Å
24	D	94.6	Very high	89.6	Confident	42 Å²	42	71.3 Å²	71.3	23%	0.225	36%	0.36	C	S	.	.	H	α-helix	trans	-61.3	-37.8	-179.3	-76.3	-16.4	0	0	0	111.8	K20 K28 S40	K20-D24 WeakPolarHBondContact O-CB 3.31Å; K20-D24 PolarHBondContact O-N 3.4Å; D24-K28 PolarHBondContact O-N 3.25Å; D24-K28 VanDerWaalsContact O-N 3.13Å; D24-S40 VanDerWaalsContact CG-OG 3.26Å; D24-S40 VanDerWaalsContact OD1-CB 3.23Å; D24-S40 WeakPolarHBondContact OD1-CB 3.28Å; D24-S40 PolarHBondContact OD1-N 2.86Å; D24-S40 PolarHBondContact OD1-OG 2.84Å; D24-S40 PolarHBondContact OD2-OG 2.96Å
25	K	93.7	Very high	89.1	Confident	137 Å²	137	68.4 Å²	68.4	60%	0.596	35%	0.347	S	S	*	.	H	α-helix	trans	-62.5	-47	171.8	-176.5	177.6	179.1	-179.5	0	111.3	E21 F22 V23 K28 D29	E21-K25 WeakPolarHBondContact O-CB 3.28Å; E21-K25 PolarHBondContact O-N 3.48Å; F22-K25 PolarHBondContact O-N 3.37Å; V23-K25 VanDerWaalsContact C-N 3.28Å; V23-K25 PolarHBondContact O-N 2.88Å; K25-K28 PolarHBondContact O-N 3.41Å; K25-D29 WeakPolarHBondContact O-CB 3.49Å; K25-D29 VanDerWaalsContact O-CG 3.28Å; K25-D29 PolarHBondContact O-N 3.33Å
26	K	92.7	Very high	89.1	Confident	28 Å²	28	67.3 Å²	67.3	12%	0.122	34%	0.336	C	S	.	.	H	α-helix	trans	-63.2	-42.3	178.2	-76.7	-60.9	-161.5	157.6	0	112.8	F22 V23 K28 D29 E30 L104 G111 S113	F22-K26 HydrophobicContact CE1-CG 4.17Å; F22-K26 HydrophobicContact CE2-CG 4.2Å; F22-K26 HydrophobicContact CZ-CG 3.96Å; F22-K26 WeakPolarHBondContact O-CG 3.4Å; F22-K26 PolarHBondContact O-N 2.97Å; V23-K26 CarbonylContact O-C 3.58Å; V23-K26 WeakPolarHBondContact O-CA 3.35Å; V23-K26 PolarHBondContact O-N 3.04Å; K26-K28 VanDerWaalsContact C-N 3.26Å; K26-K28 PolarHBondContact O-N 3.43Å; K26-D29 PolarHBondContact O-N 3Å; K26-E30 IonicContact NZ-OE1 3.93Å; K26-E30 VanDerWaalsContact O-CB 3.28Å; K26-E30 WeakPolarHBondContact O-CB 3.33Å; K26-E30 WeakPolarHBondContact O-CG 3.45Å; K26-E30 PolarHBondContact O-N 3.33Å; K26-L104 HydrophobicContact CB-CD1 4.25Å; K26-L104 HydrophobicContact CG-CD2 4.48Å; K26-G111 PolarHBondContact NZ-O 2.89Å; K26-S113 WeakPolarHBondContact CD-OG 3.28Å; K26-S113 WeakPolarHBondContact CE-OG 3.49Å; K26-S113 PolarHBondContact NZ-OG 3.24Å
27	L	92.7	Very high	89.2	Confident	5 Å²	5	66.1 Å²	66.1	3%	0.026	33%	0.331	C	S	.	.	H	α-helix	trans	-58.6	-38.8	174.8	-69.7	177.5	0	0	0	111.9	V23 E31 L38 F59 L115	V23-L27 HydrophobicContact CG1-CD1 3.94Å; V23-L27 HydrophobicContact CG1-CG 4.1Å; V23-L27 WeakPolarHBondContact O-CG 3.45Å; V23-L27 PolarHBondContact O-N 3.5Å; L27-E31 PolarHBondContact O-N 3.37Å; L27-E31 VanDerWaalsContact O-N 3.14Å; L27-L38 HydrophobicContact CD1-CB 4.05Å; L27-L38 HydrophobicContact CD2-CB 4.13Å; L27-L38 HydrophobicContact CD2-CD1 4.42Å; L27-F59 HydrophobicContact CD1-CE2 4Å; L27-F59 HydrophobicContact CD1-CZ 4.48Å; L27-F59 HydrophobicContact CD2-CE2 4.34Å; L27-F59 HydrophobicContact CD2-CZ 4.12Å; L27-L115 HydrophobicContact CD2-CD1 3.84Å; L27-L115 HydrophobicContact CD2-CD2 3.45Å; L27-L115 VanDerWaalsContact CD2-CD2 3.45Å; L27-L115 HydrophobicContact CD2-CG 4.31Å
28	K	90.7	Very high	89.2	Confident	165 Å²	165	60.9 Å²	60.9	72%	0.717	31%	0.309	S	S	*	.	H	α-helix	trans	-72.1	-46.2	176.6	-173.2	-178.2	179.4	-175.2	0	112.3	D24 K25 K26 E30 E31	D24-K28 PolarHBondContact O-N 3.25Å; D24-K28 VanDerWaalsContact O-N 3.13Å; K25-K28 PolarHBondContact O-N 3.41Å; K26-K28 VanDerWaalsContact C-N 3.26Å; K26-K28 PolarHBondContact O-N 3.43Å; K28-E30 VanDerWaalsContact C-N 3.28Å; K28-E30 PolarHBondContact O-N 2.87Å; K28-E31 WeakPolarHBondContact O-CB 3.43Å; K28-E31 PolarHBondContact O-N 2.99Å
29	D	89.4	Confident	89.2	Confident	96 Å²	96	60.3 Å²	60.3	51%	0.513	30%	0.3	S	S	.	.	H	α-helix	trans	-65.2	-36	-179.3	-69.8	-15.4	0	0	0	111.2	K25 K26	K25-D29 WeakPolarHBondContact O-CB 3.49Å; K25-D29 VanDerWaalsContact O-CG 3.28Å; K25-D29 PolarHBondContact O-N 3.33Å; K26-D29 PolarHBondContact O-N 3Å
30	E	85.7	Confident	89.4	Confident	38 Å²	38	60 Å²	60	18%	0.178	30%	0.297	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.7	18.3	-180	-59.3	-174	174.5	0	0	113.1	K26 K28 K32 A33 S113	K26-E30 IonicContact NZ-OE1 3.93Å; K26-E30 VanDerWaalsContact O-CB 3.28Å; K26-E30 WeakPolarHBondContact O-CB 3.33Å; K26-E30 WeakPolarHBondContact O-CG 3.45Å; K26-E30 PolarHBondContact O-N 3.33Å; K28-E30 VanDerWaalsContact C-N 3.28Å; K28-E30 PolarHBondContact O-N 2.87Å; E30-K32 PolarHBondContact O-N 2.77Å; E30-A33 PolarHBondContact O-N 2.85Å; E30-S113 VanDerWaalsContact CD-OG 3.26Å; E30-S113 WeakPolarHBondContact OE1-CB 3.35Å; E30-S113 PolarHBondContact OE1-OG 3.14Å; E30-S113 PolarHBondContact OE2-OG 3.24Å
31	E	85.2	Confident	89.4	Confident	36 Å²	36	59.2 Å²	59.2	17%	0.168	30%	0.297	C	S	.	.	G	3₁₀ helix	trans	-51.4	-29.6	176.4	-166.6	-157.7	-147.1	0	0	111.3	L27 K28 A33 V34 S68 E69 T70	L27-E31 PolarHBondContact O-N 3.37Å; L27-E31 VanDerWaalsContact O-N 3.14Å; K28-E31 WeakPolarHBondContact O-CB 3.43Å; K28-E31 PolarHBondContact O-N 2.99Å; E31-A33 VanDerWaalsContact C-N 3.27Å; E31-A33 PolarHBondContact O-N 2.48Å; E31-V34 HydrophobicContact CG-CG2 4.42Å; E31-V34 WeakPolarHBondContact O-CG2 3.2Å; E31-V34 PolarHBondContact O-N 3.49Å; E31-S68 WeakPolarHBondContact OE1-CB 3.45Å; E31-E69 PolarHBondContact OE1-N 2.75Å; E31-T70 WeakPolarHBondContact OE2-CB 3.43Å; E31-T70 PolarHBondContact OE2-N 3.47Å; E31-T70 VanDerWaalsContact OE2-N 3.12Å; E31-T70 PolarHBondContact OE2-OG1 2.91Å
32	K	78.5	Confident	89.2	Confident	177 Å²	177	57.7 Å²	57.7	77%	0.77	29%	0.293	S	S	*	.	G	3₁₀ helix	trans	-64.6	-26.1	177.8	-56	-179.5	-179.7	170.1	0	114.9	E30 T70	E30-K32 PolarHBondContact O-N 2.77Å; K32-T70 HydrophobicContact CB-CG2 4.16Å; K32-T70 HydrophobicContact CG-CG2 4.06Å
33	A	73.8	Confident	89.2	Confident	86 Å²	86	55.2 Å²	55.2	71%	0.711	28%	0.282	S	S	*	.	G	3₁₀ helix	trans	-92.9	-7.1	179.6	0	0	0	0	0	112.4	E30 E31	E30-A33 PolarHBondContact O-N 2.85Å; E31-A33 VanDerWaalsContact C-N 3.27Å; E31-A33 PolarHBondContact O-N 2.48Å
34	V	74	Confident	89.1	Confident	23 Å²	23	57.3 Å²	57.3	14%	0.139	30%	0.295	C	S	.	.			trans	-111.9	142.9	-179.5	-68.5	0	0	0	0	112.1	E31 W36 L115	E31-V34 HydrophobicContact CG-CG2 4.42Å; E31-V34 WeakPolarHBondContact O-CG2 3.2Å; E31-V34 PolarHBondContact O-N 3.49Å; V34-W36 WeakPolarHBondContact CG2-O 3.3Å; V34-W36 PolarHBondContact O-N 2.81Å; V34-L115 HydrophobicContact CG1-CD2 3.4Å; V34-L115 HydrophobicContact CG1-CG 4.47Å
35	T	80.4	Confident	89	Confident	56 Å²	56	56 Å²	56	34%	0.344	29%	0.288	S	S	.	.	S	Bend	trans	-73.8	-13.7	174.9	-53.5	0	0	0	0	111.8	Q71 N88	T35-Q71 PolarHBondContact O-NE2 3.04Å; T35-Q71 PolarHBondContact O-OE1 2.66Å; T35-N88 HydrophobicContact CG2-CB 3.92Å
36	W	90.1	Very high	88.9	Confident	34 Å²	34	52 Å²	52	13%	0.129	27%	0.273	C	S	.	.	S	Bend	trans	-139	147.2	-177.7	-59.5	-83.7	0	0	0	110.3	V34 L38 I63 N88 I94 M119	V34-W36 WeakPolarHBondContact CG2-O 3.3Å; V34-W36 PolarHBondContact O-N 2.81Å; W36-L38 HydrophobicContact CB-CD2 4.35Å; W36-L38 PolarHBondContact O-N 3.46Å; W36-L38 VanDerWaalsContact O-N 3.11Å; W36-I63 HydrophobicContact CB-CD1 4.3Å; W36-I63 HydrophobicContact CB-CG1 3.97Å; W36-I63 HydrophobicContact CB-CG2 4.02Å; W36-I63 HydrophobicContact CD2-CD1 4.37Å; W36-I63 HydrophobicContact CG-CD1 3.92Å; W36-I63 HydrophobicContact CG-CG1 4.15Å; W36-I63 HydrophobicContact CG-CG2 4.39Å; W36-N88 PolarHBondContact NE1-O 2.86Å; W36-I94 HydrophobicContact CH2-CD1 4.4Å; W36-I94 HydrophobicContact CZ2-CB 4.17Å; W36-I94 HydrophobicContact CZ2-CD1 4.2Å; W36-I94 HydrophobicContact CZ2-CG1 4.16Å; W36-M119 HydrophobicContact CD2-CE 3.84Å; W36-M119 HydrophobicContact CE3-CE 3.39Å; W36-M119 HydrophobicContact CE3-CG 4.1Å; W36-M119 HydrophobicContact CE3-SD 4.02Å; W36-M119 HydrophobicContact CG-CE 4.45Å; W36-M119 HydrophobicContact CH2-CE 4.46Å; W36-M119 HydrophobicContact CH2-CG 4.17Å; W36-M119 HydrophobicContact CZ3-CB 4.34Å; W36-M119 HydrophobicContact CZ3-CE 3.77Å; W36-M119 HydrophobicContact CZ3-CG 3.53Å; W36-M119 HydrophobicContact CZ3-SD 4.09Å
37	A	92.4	Very high	88.8	Confident	13 Å²	13	54.8 Å²	54.8	11%	0.107	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.1	104.4	171	0	0	0	0	0	108.2	R64 E65	A37-R64 WeakPolarHBondContact O-CB 3.48Å; A37-R64 PolarHBondContact O-N 2.8Å; A37-E65 HydrophobicContact CB-CB 3.91Å; A37-E65 PolarHBondContact N-O 2.95Å; A37-E65 VanDerWaalsContact N-O 3.14Å; A37-E65 PolarHBondContact O-N 2.66Å
38	L	93.9	Very high	88.6	Confident	16 Å²	16	57.5 Å²	57.5	8%	0.084	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	151.7	-177.1	-65.5	174.2	0	0	0	111.4	L27 W36 A61 I62 I63 C117 M119	L27-L38 HydrophobicContact CD1-CB 4.05Å; L27-L38 HydrophobicContact CD2-CB 4.13Å; L27-L38 HydrophobicContact CD2-CD1 4.42Å; W36-L38 HydrophobicContact CB-CD2 4.35Å; W36-L38 PolarHBondContact O-N 3.46Å; W36-L38 VanDerWaalsContact O-N 3.11Å; L38-A61 HydrophobicContact CB-CB 4.33Å; L38-A61 HydrophobicContact CD2-CB 4.41Å; L38-I62 WeakPolarHBondContact CA-O 3.34Å; L38-I63 HydrophobicContact CD2-CG1 3.86Å; L38-C117 HydrophobicContact CD1-CB 4.35Å; L38-C117 WeakPolarHBondContact CD1-SG 3.46Å; L38-M119 HydrophobicContact CD2-CE 4.31Å
39	Q	94.2	Very high	88.4	Confident	78 Å²	78	51.7 Å²	51.7	36%	0.364	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	130.8	168.9	-178.2	174.3	18.3	0	0	108.5	A61 I62 R64	Q39-A61 CarbonylContact O-C 3.57Å; Q39-A61 WeakPolarHBondContact O-CA 3.42Å; Q39-A61 WeakPolarHBondContact O-CB 3.17Å; Q39-I62 HydrophobicContact CB-CG1 4.3Å; Q39-I62 PolarHBondContact N-O 3.1Å; Q39-I62 PolarHBondContact O-N 2.59Å; Q39-R64 HydrophobicContact CB-CB 4.17Å
40	S	95	Very high	88.1	Confident	2 Å²	2	54.7 Å²	54.7	1%	0.014	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.1	148.1	176.6	69.9	0	0	0	0	110.3	K20 D24 N60	K20-S40 WeakPolarHBondContact CG-OG 3.34Å; K20-S40 PolarHBondContact NZ-O 3.22Å; K20-S40 PolarHBondContact NZ-OG 3.39Å; K20-S40 VanDerWaalsContact NZ-OG 3.1Å; D24-S40 VanDerWaalsContact CG-OG 3.26Å; D24-S40 VanDerWaalsContact OD1-CB 3.23Å; D24-S40 WeakPolarHBondContact OD1-CB 3.28Å; D24-S40 PolarHBondContact OD1-N 2.86Å; D24-S40 PolarHBondContact OD1-OG 2.84Å; D24-S40 PolarHBondContact OD2-OG 2.96Å; S40-N60 CarbonylContact C-O 3.42Å; S40-N60 WeakPolarHBondContact CA-O 3.39Å
41	T	94.7	Very high	87.9	Confident	43 Å²	43	60.5 Å²	60.5	26%	0.264	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	-59.1	171.4	56.5	0	0	0	0	110.1	K20 N60 I62 E99	K20-T41 PolarHBondContact NZ-O 3.13Å; T41-N60 PolarHBondContact N-O 2.89Å; T41-N60 VanDerWaalsContact OG1-CB 3.31Å; T41-N60 WeakPolarHBondContact OG1-CB 3.34Å; T41-N60 PolarHBondContact OG1-O 2.8Å; T41-I62 HydrophobicContact CG2-CB 4.33Å; T41-I62 HydrophobicContact CG2-CD1 4.35Å; T41-I62 HydrophobicContact CG2-CG1 3.92Å; T41-I62 HydrophobicContact CG2-CG2 3.71Å; T41-E99 VanDerWaalsContact CB-OE1 3.27Å; T41-E99 WeakPolarHBondContact CB-OE1 3.23Å; T41-E99 VanDerWaalsContact OG1-CD 3.29Å; T41-E99 PolarHBondContact OG1-OE1 3.17Å
42	D	93.1	Very high	88.1	Confident	80 Å²	80	62 Å²	62	43%	0.428	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	140.1	-175.4	-176.6	37.1	0	0	0	112.7	F59 N60	D42-F59 CarbonylContact O-C 3.45Å; D42-F59 WeakPolarHBondContact O-CA 3.27Å; D42-F59 WeakPolarHBondContact O-CB 3.39Å; D42-N60 PolarHBondContact O-N 2.9Å
43	I	94	Very high	88.6	Confident	4 Å²	4	54 Å²	54	2%	0.021	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.8	110.3	175.1	-55.8	-57.7	0	0	0	108.6	P10 V16 A19 K20 V23 I57 F59	P10-I43 HydrophobicContact CG-CG2 3.99Å; V16-I43 HydrophobicContact CG1-CB 4.38Å; V16-I43 HydrophobicContact CG1-CG1 4.32Å; A19-I43 HydrophobicContact CB-CG1 4.36Å; K20-I43 HydrophobicContact CB-CG1 4.39Å; V23-I43 HydrophobicContact CG2-CD1 4.21Å; I43-I57 HydrophobicContact CD1-CG2 4.07Å; I43-I57 HydrophobicContact CG2-CG2 3.93Å; I43-F59 HydrophobicContact CD1-CB 3.68Å; I43-F59 HydrophobicContact CD1-CG 4.47Å
44	T	92.7	Very high	89.4	Confident	44 Å²	44	53.9 Å²	53.9	27%	0.27	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	-27.9	-175.5	57.5	0	0	0	0	113	P9 H58	P9-T44 WeakPolarHBondContact CA-O 3.31Å; T44-H58 PolarHBondContact N-O 2.56Å; T44-H58 VanDerWaalsContact OG1-C 3.29Å; T44-H58 WeakPolarHBondContact OG1-CB 3.49Å; T44-H58 PolarHBondContact OG1-O 2.85Å
45	V	92.7	Very high	90.3	Very high	14 Å²	14	55 Å²	55	9%	0.085	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145	138.3	176.8	-179.3	0	0	0	0	109.8	E7 K47 I57 H58	E7-V45 HydrophobicContact CB-CG2 4.25Å; V45-K47 HydrophobicContact CG1-CD 4.38Å; V45-K47 HydrophobicContact CG1-CG 4Å; V45-I57 CarbonylContact O-C 3.56Å; V45-I57 VanDerWaalsContact O-CA 3.31Å; V45-I57 WeakPolarHBondContact O-CA 3.31Å; V45-H58 HydrophobicContact CB-CB 3.78Å; V45-H58 HydrophobicContact CG2-CB 4.03Å; V45-H58 PolarHBondContact N-O 3.32Å; V45-H58 VanDerWaalsContact N-O 3.15Å; V45-H58 PolarHBondContact O-N 2.84Å
46	L	92.1	Very high	90.9	Very high	55 Å²	55	55 Å²	55	29%	0.288	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	116.7	170.4	-176.3	65.4	0	0	0	109.7	P10 T15 A19 L55 I57	P10-L46 HydrophobicContact CB-CB 4.44Å; P10-L46 HydrophobicContact CG-CB 4.2Å; T15-L46 HydrophobicContact CG2-CD2 3.3Å; A19-L46 HydrophobicContact CB-CD1 4.18Å; A19-L46 HydrophobicContact CB-CD2 4.1Å; L46-L55 HydrophobicContact CD1-CD1 3.78Å; L46-L55 HydrophobicContact CD1-CG 4.47Å; L46-I57 HydrophobicContact CD1-CD1 3.99Å; L46-I57 HydrophobicContact CD1-CG1 3.71Å; L46-I57 HydrophobicContact CD1-CG2 4.41Å
47	K	90.2	Very high	91.1	Very high	85 Å²	85	53.4 Å²	53.4	37%	0.37	30%	0.303	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	123.9	177.7	-67.4	-179.3	-174.4	162.5	0	111.7	E7 V45 L55 I56	E7-K47 WeakPolarHBondContact OE1-CE 3.42Å; E7-K47 IonicContact OE1-NZ 2.56Å; E7-K47 PolarHBondContact OE1-NZ 3.15Å; E7-K47 WeakPolarHBondContact OE2-CE 3.47Å; E7-K47 IonicContact OE2-NZ 2.76Å; E7-K47 PolarHBondContact OE2-NZ 2.9Å; V45-K47 HydrophobicContact CG1-CD 4.38Å; V45-K47 HydrophobicContact CG1-CG 4Å; K47-L55 CarbonylContact O-C 3.53Å; K47-L55 WeakPolarHBondContact O-CA 2.83Å; K47-I56 HydrophobicContact CB-CB 4.37Å; K47-I56 PolarHBondContact N-O 2.76Å; K47-I56 PolarHBondContact O-N 2.81Å
48	G	88.4	Confident	91.3	Very high	62 Å²	62	56.2 Å²	56.2	64%	0.639	31%	0.313	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112	144.4	170.8	0	0	0	0	0	111.8	Q54	G48-Q54 CarbonylContact C-O 3.55Å; G48-Q54 WeakPolarHBondContact CA-O 3.28Å
49	S	86.1	Confident	91.3	Very high	44 Å²	44	55.5 Å²	55.5	31%	0.308	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	113.7	166.5	169.2	0	0	0	0	109.1	L51 T52 G53 Q54	S49-L51 VanDerWaalsContact C-N 3.29Å; S49-L51 PolarHBondContact O-N 3.14Å; S49-T52 WeakPolarHBondContact CB-OG1 3.4Å; S49-T52 PolarHBondContact OG-N 3.45Å; S49-T52 PolarHBondContact OG-OG1 2.85Å; S49-G53 VanDerWaalsContact O-CA 3.3Å; S49-G53 WeakPolarHBondContact O-CA 3.33Å; S49-G53 PolarHBondContact O-N 3.35Å; S49-Q54 PolarHBondContact N-O 3.16Å; S49-Q54 PolarHBondContact O-N 3.33Å
50	N	82.4	Confident	91.4	Very high	159 Å²	159	53.6 Å²	53.6	85%	0.85	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-35.3	176	-72.8	-23.6	0	0	0	111.7
51	L	82.8	Confident	91.4	Very high	160 Å²	160	53.5 Å²	53.5	84%	0.838	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62	-51.9	178.7	-84.4	156.4	0	0	0	111.5	S49 Y109	S49-L51 VanDerWaalsContact C-N 3.29Å; S49-L51 PolarHBondContact O-N 3.14Å; L51-Y109 PolarHBondContact O-OH 3.49Å
52	T	87.6	Confident	91.4	Very high	66 Å²	66	54.2 Å²	54.2	41%	0.405	30%	0.303	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.9	-7.1	-177.6	62.2	0	0	0	0	113	S49 Q54 Y109	S49-T52 WeakPolarHBondContact CB-OG1 3.4Å; S49-T52 PolarHBondContact OG-N 3.45Å; S49-T52 PolarHBondContact OG-OG1 2.85Å; T52-Q54 PolarHBondContact O-N 2.88Å; T52-Q54 PolarHBondContact OG1-OE1 3.31Å; T52-Y109 VanDerWaalsContact C-CE2 3.45Å; T52-Y109 WeakPolarHBondContact O-CE2 3.43Å
53	G	89.2	Confident	91.4	Very high	9 Å²	9	51 Å²	51	9%	0.093	29%	0.286	C	S	.	.	T	Hydrogen-bonded Turn	trans	61.8	21.5	-175.2	0	0	0	0	0	113.1	S49 K108	S49-G53 VanDerWaalsContact O-CA 3.3Å; S49-G53 WeakPolarHBondContact O-CA 3.33Å; S49-G53 PolarHBondContact O-N 3.35Å; G53-K108 VanDerWaalsContact O-CB 3.31Å; G53-K108 WeakPolarHBondContact O-CB 3.28Å; G53-K108 PolarHBondContact O-N 3.43Å
54	Q	91.7	Very high	91.3	Very high	85 Å²	85	59.7 Å²	59.7	40%	0.397	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	139.5	-176.4	-70.7	174.1	-22.3	0	0	111.2	G48 S49 T52 L105 Y106	G48-Q54 CarbonylContact C-O 3.55Å; G48-Q54 WeakPolarHBondContact CA-O 3.28Å; S49-Q54 PolarHBondContact N-O 3.16Å; S49-Q54 PolarHBondContact O-N 3.33Å; T52-Q54 PolarHBondContact O-N 2.88Å; T52-Q54 PolarHBondContact OG1-OE1 3.31Å; Q54-L105 HydrophobicContact CB-CD1 4.22Å; Q54-L105 HydrophobicContact CG-CD1 4.37Å; Q54-Y106 CarbonylContact C-O 3.58Å; Q54-Y106 WeakPolarHBondContact CA-O 3.4Å
55	L	92.7	Very high	91.3	Very high	45 Å²	45	61 Å²	61	24%	0.236	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	119.7	172.3	-178.6	66.4	0	0	0	108.4	F22 L46 K47 I57 Y106	F22-L55 HydrophobicContact CD1-CD2 4.38Å; F22-L55 HydrophobicContact CE1-CD2 3.97Å; L46-L55 HydrophobicContact CD1-CD1 3.78Å; L46-L55 HydrophobicContact CD1-CG 4.47Å; K47-L55 CarbonylContact O-C 3.53Å; K47-L55 WeakPolarHBondContact O-CA 2.83Å; L55-I57 HydrophobicContact CD2-CD1 3.96Å; L55-I57 HydrophobicContact CD2-CG1 4.33Å; L55-I57 HydrophobicContact CG-CD1 4.21Å; L55-I57 HydrophobicContact CG-CG1 4.01Å; L55-Y106 HydrophobicContact CB-CD1 4.15Å; L55-Y106 HydrophobicContact CD2-CD1 4.49Å; L55-Y106 PolarHBondContact N-O 3.01Å; L55-Y106 PolarHBondContact O-N 3.38Å
56	I	93.2	Very high	91.2	Very high	58 Å²	58	61.5 Å²	61.5	30%	0.297	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	124	176	-59.2	167.5	0	0	0	107.7	K47 L104 L105	K47-I56 HydrophobicContact CB-CB 4.37Å; K47-I56 PolarHBondContact N-O 2.76Å; K47-I56 PolarHBondContact O-N 2.81Å; I56-L104 WeakPolarHBondContact CA-O 2.96Å; I56-L105 HydrophobicContact CD1-CD1 4.41Å; I56-L105 HydrophobicContact CG1-CD1 3.63Å
57	I	94.1	Very high	91.1	Very high	0 Å²	0	59 Å²	59	0%	0	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	125.6	176.6	-44.5	-175.1	0	0	0	108.2	F22 V23 I43 V45 L46 L55 F59 S103 L104	F22-I57 HydrophobicContact CD1-CD1 3.75Å; F22-I57 HydrophobicContact CE1-CD1 4.04Å; V23-I57 HydrophobicContact CG2-CB 4.35Å; V23-I57 HydrophobicContact CG2-CD1 3.68Å; V23-I57 HydrophobicContact CG2-CG2 3.91Å; I43-I57 HydrophobicContact CD1-CG2 4.07Å; I43-I57 HydrophobicContact CG2-CG2 3.93Å; V45-I57 CarbonylContact O-C 3.56Å; V45-I57 VanDerWaalsContact O-CA 3.31Å; V45-I57 WeakPolarHBondContact O-CA 3.31Å; L46-I57 HydrophobicContact CD1-CD1 3.99Å; L46-I57 HydrophobicContact CD1-CG1 3.71Å; L46-I57 HydrophobicContact CD1-CG2 4.41Å; L55-I57 HydrophobicContact CD2-CD1 3.96Å; L55-I57 HydrophobicContact CD2-CG1 4.33Å; L55-I57 HydrophobicContact CG-CD1 4.21Å; L55-I57 HydrophobicContact CG-CG1 4.01Å; I57-F59 HydrophobicContact CG2-CD1 4.3Å; I57-S103 CarbonylContact O-C 3.52Å; I57-S103 WeakPolarHBondContact O-CA 3.45Å; I57-L104 HydrophobicContact CB-CB 4.35Å; I57-L104 HydrophobicContact CD1-CD2 4.07Å; I57-L104 HydrophobicContact CG1-CD2 4.47Å; I57-L104 PolarHBondContact N-O 2.03Å; I57-L104 PolarHBondContact O-N 3.34Å
58	H	95.7	Very high	91.1	Very high	71 Å²	71	54.9 Å²	54.9	33%	0.329	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	139	164.6	-57.6	168	0	0	0	108.7	T44 V45 C102	T44-H58 PolarHBondContact N-O 2.56Å; T44-H58 VanDerWaalsContact OG1-C 3.29Å; T44-H58 WeakPolarHBondContact OG1-CB 3.49Å; T44-H58 PolarHBondContact OG1-O 2.85Å; V45-H58 HydrophobicContact CB-CB 3.78Å; V45-H58 HydrophobicContact CG2-CB 4.03Å; V45-H58 PolarHBondContact N-O 3.32Å; V45-H58 VanDerWaalsContact N-O 3.15Å; V45-H58 PolarHBondContact O-N 2.84Å; H58-C102 WeakPolarHBondContact CA-O 3.49Å
59	F	95.4	Very high	91.2	Very high	1 Å²	1	56.6 Å²	56.6	0%	0.004	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.6	157.1	-175.5	62.5	-79.4	0	0	0	110.9	V23 L27 D42 I43 I57 A61 C102 L104 L115	V23-F59 HydrophobicContact CG1-CD1 4.1Å; V23-F59 HydrophobicContact CG1-CD2 3.82Å; V23-F59 HydrophobicContact CG1-CE1 3.86Å; V23-F59 HydrophobicContact CG1-CE2 3.54Å; V23-F59 HydrophobicContact CG1-CG 4.09Å; V23-F59 HydrophobicContact CG1-CZ 3.56Å; V23-F59 HydrophobicContact CG2-CD1 4.39Å; L27-F59 HydrophobicContact CD1-CE2 4Å; L27-F59 HydrophobicContact CD1-CZ 4.48Å; L27-F59 HydrophobicContact CD2-CE2 4.34Å; L27-F59 HydrophobicContact CD2-CZ 4.12Å; D42-F59 CarbonylContact O-C 3.45Å; D42-F59 WeakPolarHBondContact O-CA 3.27Å; D42-F59 WeakPolarHBondContact O-CB 3.39Å; I43-F59 HydrophobicContact CD1-CB 3.68Å; I43-F59 HydrophobicContact CD1-CG 4.47Å; I57-F59 HydrophobicContact CG2-CD1 4.3Å; F59-A61 HydrophobicContact CD2-CB 4.19Å; F59-A61 HydrophobicContact CE2-CB 3.94Å; F59-C102 HydrophobicContact CD1-CB 4.14Å; F59-C102 HydrophobicContact CD2-CB 4.01Å; F59-C102 HydrophobicContact CE1-CB 3.69Å; F59-C102 HydrophobicContact CE2-CB 3.57Å; F59-C102 HydrophobicContact CG-CB 4.28Å; F59-C102 HydrophobicContact CZ-CB 3.4Å; F59-C102 PolarHBondContact N-O 2.93Å; F59-C102 WeakPolarHBondContact O-CA 3.42Å; F59-C102 PolarHBondContact O-N 2.91Å; F59-L104 HydrophobicContact CE1-CB 3.94Å; F59-L115 HydrophobicContact CE1-CD1 4.19Å; F59-L115 HydrophobicContact CZ-CD1 3.71Å
60	N	95.6	Very high	91.3	Very high	38 Å²	38	55.9 Å²	55.9	20%	0.203	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	146.9	166.1	-74.1	-10.1	0	0	0	109.5	S40 T41 D42 E99	S40-N60 CarbonylContact C-O 3.42Å; S40-N60 WeakPolarHBondContact CA-O 3.39Å; T41-N60 PolarHBondContact N-O 2.89Å; T41-N60 VanDerWaalsContact OG1-CB 3.31Å; T41-N60 WeakPolarHBondContact OG1-CB 3.34Å; T41-N60 PolarHBondContact OG1-O 2.8Å; D42-N60 PolarHBondContact O-N 2.9Å; N60-E99 HydrophobicContact CB-CB 4.16Å; N60-E99 PolarHBondContact ND2-OE2 2.86Å
61	A	95.5	Very high	91.5	Very high	0 Å²	0	49.5 Å²	49.5	0%	0	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	146.1	176.4	0	0	0	0	0	111.7	L38 Q39 F59 H100	L38-A61 HydrophobicContact CB-CB 4.33Å; L38-A61 HydrophobicContact CD2-CB 4.41Å; Q39-A61 CarbonylContact O-C 3.57Å; Q39-A61 WeakPolarHBondContact O-CA 3.42Å; Q39-A61 WeakPolarHBondContact O-CB 3.17Å; F59-A61 HydrophobicContact CD2-CB 4.19Å; F59-A61 HydrophobicContact CE2-CB 3.94Å; A61-H100 PolarHBondContact N-O 2.95Å; A61-H100 PolarHBondContact O-N 2.98Å
62	I	94.8	Very high	91.8	Very high	59 Å²	59	44.3 Å²	44.3	30%	0.303	22%	0.215	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	158.1	168.9	56.8	168.5	0	0	0	110	L38 Q39 T41 R64 E99	L38-I62 WeakPolarHBondContact CA-O 3.34Å; Q39-I62 HydrophobicContact CB-CG1 4.3Å; Q39-I62 PolarHBondContact N-O 3.1Å; Q39-I62 PolarHBondContact O-N 2.59Å; T41-I62 HydrophobicContact CG2-CB 4.33Å; T41-I62 HydrophobicContact CG2-CD1 4.35Å; T41-I62 HydrophobicContact CG2-CG1 3.92Å; T41-I62 HydrophobicContact CG2-CG2 3.71Å; I62-R64 PolarHBondContact O-N 2.78Å; I62-E99 HydrophobicContact CG2-CG 4.08Å
63	I	93.4	Very high	91.9	Very high	12 Å²	12	47.7 Å²	47.7	6%	0.062	22%	0.224	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-81	107.3	169	-62.8	165.2	0	0	0	107.9	W36 L38 E65 C66 I94 M96 M119	W36-I63 HydrophobicContact CB-CD1 4.3Å; W36-I63 HydrophobicContact CB-CG1 3.97Å; W36-I63 HydrophobicContact CB-CG2 4.02Å; W36-I63 HydrophobicContact CD2-CD1 4.37Å; W36-I63 HydrophobicContact CG-CD1 3.92Å; W36-I63 HydrophobicContact CG-CG1 4.15Å; W36-I63 HydrophobicContact CG-CG2 4.39Å; L38-I63 HydrophobicContact CD2-CG1 3.86Å; I63-E65 WeakPolarHBondContact CG2-O 3.14Å; I63-C66 HydrophobicContact CG2-CB 4.04Å; I63-I94 HydrophobicContact CD1-CB 4.47Å; I63-I94 HydrophobicContact CD1-CD1 4.18Å; I63-I94 HydrophobicContact CD1-CG1 3.32Å; I63-I94 HydrophobicContact CD1-CG2 4.33Å; I63-M96 HydrophobicContact CB-CE 4.04Å; I63-M96 HydrophobicContact CB-SD 4.1Å; I63-M96 HydrophobicContact CD1-SD 3.72Å; I63-M96 HydrophobicContact CG2-CE 3.44Å; I63-M96 VanDerWaalsContact CG2-CE 3.44Å; I63-M96 HydrophobicContact CG2-SD 3.77Å; I63-M119 HydrophobicContact CD1-CE 3.83Å; I63-M119 HydrophobicContact CG1-CE 4.12Å
64	R	91.7	Very high	91.8	Very high	186 Å²	186	51 Å²	51	70%	0.702	24%	0.238	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-70	-41.8	174.7	179.8	-178.2	170.8	-171	-1.4	111.1	A37 Q39 I62	A37-R64 WeakPolarHBondContact O-CB 3.48Å; A37-R64 PolarHBondContact O-N 2.8Å; Q39-R64 HydrophobicContact CB-CB 4.17Å; I62-R64 PolarHBondContact O-N 2.78Å
65	E	91.8	Very high	91.6	Very high	71 Å²	71	48 Å²	48	33%	0.332	23%	0.226	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.7	137.1	-178.5	-168.1	173.8	-179.6	0	0	111.6	A37 I63 K72	A37-E65 HydrophobicContact CB-CB 3.91Å; A37-E65 PolarHBondContact N-O 2.95Å; A37-E65 VanDerWaalsContact N-O 3.14Å; A37-E65 PolarHBondContact O-N 2.66Å; I63-E65 WeakPolarHBondContact CG2-O 3.14Å; E65-K72 IonicContact OE1-NZ 2.65Å; E65-K72 PolarHBondContact OE1-NZ 2.05Å
66	C	90.1	Very high	91.4	Very high	26 Å²	26	54 Å²	54	18%	0.176	25%	0.25	C	S	.	.	S	Bend	trans	-138.7	130.2	170.5	-168.3	0	0	0	0	110.2	I63 C89 M96	I63-C66 HydrophobicContact CG2-CB 4.04Å; C66-C89 HydrophobicContact CB-CB 3.85Å; C66-C89 WeakPolarHBondContact CB-SG 3.16Å; C66-C89 WeakPolarHBondContact SG-CA 3.03Å; C66-C89 WeakPolarHBondContact SG-CB 3.38Å; C66-C89 CovalentContact SG-SG 2.03Å; C66-C89 PolarHBondContact SG-SG 3.4Å; C66-M96 HydrophobicContact CB-CE 3.48Å; C66-M96 VanDerWaalsContact CB-CE 3.48Å; C66-M96 HydrophobicContact CB-SD 3.74Å
67	P	90.7	Very high	91.2	Very high	1 Å²	1	57.2 Å²	57.2	1%	0.006	27%	0.266	C	S	.	.	S	Bend	cis	-71.6	158.6	-6.7	28.1	-32.5	0	0	0	111.2	Q71 K72 P85 M86 C89	P67-Q71 HydrophobicContact CB-CB 3.95Å; P67-K72 HydrophobicContact CB-CG 4.39Å; P67-K72 HydrophobicContact CG-CD 4.39Å; P67-K72 HydrophobicContact CG-CG 3.74Å; P67-K72 VanDerWaalsContact O-CE 3.25Å; P67-K72 WeakPolarHBondContact O-CE 3.45Å; P67-P85 HydrophobicContact CB-CB 3.6Å; P67-P85 HydrophobicContact CB-CG 4.3Å; P67-P85 HydrophobicContact CG-CB 3.94Å; P67-P85 HydrophobicContact CG-CG 4.1Å; P67-M86 WeakPolarHBondContact CD-SD 3.48Å; P67-M86 HydrophobicContact CG-CE 3.51Å; P67-M86 HydrophobicContact CG-SD 4.07Å; P67-C89 VanDerWaalsContact CD-SG 3.52Å
68	S	91.3	Very high	90.9	Very high	0 Å²	0	60.3 Å²	60.3	0%	0	28%	0.282	C	S	.	.			trans	-63.9	159	175.7	78	0	0	0	0	111.4	E31 T70 Q71 K72	E31-S68 WeakPolarHBondContact OE1-CB 3.45Å; S68-T70 PolarHBondContact O-N 3.12Å; S68-Q71 WeakPolarHBondContact O-CB 3.33Å; S68-Q71 PolarHBondContact O-N 3.11Å; S68-Q71 VanDerWaalsContact O-N 3.07Å; S68-Q71 WeakPolarHBondContact OG-CG 3.44Å; S68-Q71 PolarHBondContact OG-N 2.85Å; S68-Q71 VanDerWaalsContact OG-N 3.12Å; S68-K72 WeakPolarHBondContact O-CG 3.21Å; S68-K72 PolarHBondContact O-N 2.89Å
69	E	89.7	Confident	90.2	Very high	98 Å²	98	65.4 Å²	65.4	46%	0.458	30%	0.303	S	S	.	.	H	α-helix	trans	-63.1	-37.1	178.4	-77.6	-59.1	125.6	0	0	110.9	E31 Q71 K72 K73	E31-E69 PolarHBondContact OE1-N 2.75Å; E69-Q71 PolarHBondContact O-N 2.98Å; E69-K72 PolarHBondContact O-N 3.33Å; E69-K72 WeakPolarHBondContact OE1-CD 3.39Å; E69-K72 IonicContact OE1-NZ 2.7Å; E69-K72 PolarHBondContact OE1-NZ 2.77Å; E69-K73 WeakPolarHBondContact O-CB 3.36Å; E69-K73 PolarHBondContact O-N 2.93Å
70	T	87.9	Confident	89.7	Confident	29 Å²	29	74.2 Å²	74.2	18%	0.178	34%	0.342	C	S	.	.	H	α-helix	trans	-57.6	-46.3	170.6	-67	0	0	0	0	112.2	E31 K32 S68 K72 K73 M74	E31-T70 WeakPolarHBondContact OE2-CB 3.43Å; E31-T70 PolarHBondContact OE2-N 3.47Å; E31-T70 VanDerWaalsContact OE2-N 3.12Å; E31-T70 PolarHBondContact OE2-OG1 2.91Å; K32-T70 HydrophobicContact CB-CG2 4.16Å; K32-T70 HydrophobicContact CG-CG2 4.06Å; S68-T70 PolarHBondContact O-N 3.12Å; T70-K72 PolarHBondContact O-N 3.35Å; T70-K73 PolarHBondContact O-N 3.45Å; T70-M74 HydrophobicContact CG2-CG 4.11Å; T70-M74 WeakPolarHBondContact O-CB 3.33Å; T70-M74 VanDerWaalsContact O-CG 3.29Å; T70-M74 WeakPolarHBondContact O-CG 3.13Å; T70-M74 PolarHBondContact O-N 3.35Å
71	Q	86.3	Confident	89.1	Confident	24 Å²	24	75.9 Å²	75.9	11%	0.112	36%	0.361	C	S	.	.	H	α-helix	trans	-62.1	-43.7	177.5	-77.4	178.9	-41.7	0	0	112.7	T35 P67 S68 E69 K73 M74 S75 P85 N88	T35-Q71 PolarHBondContact O-NE2 3.04Å; T35-Q71 PolarHBondContact O-OE1 2.66Å; P67-Q71 HydrophobicContact CB-CB 3.95Å; S68-Q71 WeakPolarHBondContact O-CB 3.33Å; S68-Q71 PolarHBondContact O-N 3.11Å; S68-Q71 VanDerWaalsContact O-N 3.07Å; S68-Q71 WeakPolarHBondContact OG-CG 3.44Å; S68-Q71 PolarHBondContact OG-N 2.85Å; S68-Q71 VanDerWaalsContact OG-N 3.12Å; E69-Q71 PolarHBondContact O-N 2.98Å; Q71-K73 VanDerWaalsContact C-N 3.27Å; Q71-K73 PolarHBondContact O-N 2.85Å; Q71-M74 PolarHBondContact O-N 2.84Å; Q71-S75 WeakPolarHBondContact O-CB 3.04Å; Q71-S75 PolarHBondContact O-N 3.28Å; Q71-S75 PolarHBondContact O-OG 2.99Å; Q71-P85 HydrophobicContact CB-CB 3.87Å; Q71-N88 PolarHBondContact NE2-ND2 3.12Å
72	K	89.7	Confident	88.4	Confident	52 Å²	52	78.4 Å²	78.4	23%	0.226	38%	0.376	C	S	.	.	H	α-helix	trans	-60.8	-38.1	175.8	-65	176.3	-163.3	164.4	0	111.4	E65 P67 S68 E69 T70 S75 K76	E65-K72 IonicContact OE1-NZ 2.65Å; E65-K72 PolarHBondContact OE1-NZ 2.05Å; P67-K72 HydrophobicContact CB-CG 4.39Å; P67-K72 HydrophobicContact CG-CD 4.39Å; P67-K72 HydrophobicContact CG-CG 3.74Å; P67-K72 VanDerWaalsContact O-CE 3.25Å; P67-K72 WeakPolarHBondContact O-CE 3.45Å; S68-K72 WeakPolarHBondContact O-CG 3.21Å; S68-K72 PolarHBondContact O-N 2.89Å; E69-K72 PolarHBondContact O-N 3.33Å; E69-K72 WeakPolarHBondContact OE1-CD 3.39Å; E69-K72 IonicContact OE1-NZ 2.7Å; E69-K72 PolarHBondContact OE1-NZ 2.77Å; T70-K72 PolarHBondContact O-N 3.35Å; K72-S75 PolarHBondContact O-OG 3.4Å; K72-S75 VanDerWaalsContact O-OG 3.09Å; K72-K76 VanDerWaalsContact O-CG 3.27Å; K72-K76 WeakPolarHBondContact O-CG 3.43Å; K72-K76 PolarHBondContact O-N 3.21Å
73	K	89.1	Confident	87.7	Confident	136 Å²	136	83.9 Å²	83.9	59%	0.591	40%	0.398	S	S	*	.	H	α-helix	trans	-69.4	-47	176.7	-175.8	177	178.1	177.2	0	111.7	E69 T70 Q71 K76 M77	E69-K73 WeakPolarHBondContact O-CB 3.36Å; E69-K73 PolarHBondContact O-N 2.93Å; T70-K73 PolarHBondContact O-N 3.45Å; Q71-K73 VanDerWaalsContact C-N 3.27Å; Q71-K73 PolarHBondContact O-N 2.85Å; K73-K76 PolarHBondContact O-N 2.82Å; K73-M77 HydrophobicContact CG-SD 4.07Å; K73-M77 WeakPolarHBondContact O-CG 3.07Å; K73-M77 PolarHBondContact O-N 2.93Å
74	M	86.7	Confident	87.4	Confident	80 Å²	80	87.7 Å²	87.7	39%	0.394	42%	0.418	S	S	.	.	H	α-helix	trans	-64.9	-40.4	-179.4	-71.6	-62.1	-70.2	0	0	112	T70 Q71 K76 M77 L78	T70-M74 HydrophobicContact CG2-CG 4.11Å; T70-M74 WeakPolarHBondContact O-CB 3.33Å; T70-M74 VanDerWaalsContact O-CG 3.29Å; T70-M74 WeakPolarHBondContact O-CG 3.13Å; T70-M74 PolarHBondContact O-N 3.35Å; Q71-M74 PolarHBondContact O-N 2.84Å; M74-K76 VanDerWaalsContact C-N 3.29Å; M74-K76 PolarHBondContact O-N 3.47Å; M74-M77 PolarHBondContact O-N 3.22Å; M74-L78 HydrophobicContact CE-CD1 3.66Å; M74-L78 WeakPolarHBondContact O-CB 3.29Å; M74-L78 PolarHBondContact O-N 2.85Å
75	S	87.7	Confident	87.3	Confident	20 Å²	20	79.4 Å²	79.4	14%	0.14	39%	0.388	C	S	.	.	H	α-helix	trans	-65.6	-31.9	176.5	71.7	0	0	0	0	112.9	Q71 K72 K79 P85	Q71-S75 WeakPolarHBondContact O-CB 3.04Å; Q71-S75 PolarHBondContact O-N 3.28Å; Q71-S75 PolarHBondContact O-OG 2.99Å; K72-S75 PolarHBondContact O-OG 3.4Å; K72-S75 VanDerWaalsContact O-OG 3.09Å; S75-K79 WeakPolarHBondContact O-CA 3.42Å; S75-K79 WeakPolarHBondContact O-CB 3.19Å; S75-K79 PolarHBondContact O-N 2.89Å; S75-P85 VanDerWaalsContact CB-CD 3.48Å
76	K	88.4	Confident	87.2	Confident	171 Å²	171	80.7 Å²	80.7	74%	0.743	40%	0.396	S	S	*	.	H	α-helix	trans	-70.9	-45.2	172.2	-72.6	173.4	-176.7	178.4	0	112	K72 K73 M74	K72-K76 VanDerWaalsContact O-CG 3.27Å; K72-K76 WeakPolarHBondContact O-CG 3.43Å; K72-K76 PolarHBondContact O-N 3.21Å; K73-K76 PolarHBondContact O-N 2.82Å; M74-K76 VanDerWaalsContact C-N 3.29Å; M74-K76 PolarHBondContact O-N 3.47Å
77	M	89.1	Confident	87.1	Confident	127 Å²	127	82.2 Å²	82.2	63%	0.626	40%	0.402	S	S	*	.	H	α-helix	trans	-71	-35.7	-177.9	-71.4	-178.4	67	0	0	113	K73 M74	K73-M77 HydrophobicContact CG-SD 4.07Å; K73-M77 WeakPolarHBondContact O-CG 3.07Å; K73-M77 PolarHBondContact O-N 2.93Å; M74-M77 PolarHBondContact O-N 3.22Å
78	L	88.3	Confident	87	Confident	65 Å²	65	84.8 Å²	84.8	34%	0.34	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-124.2	42.3	-172.8	-61.5	178.5	0	0	0	111.3	M74 F80 A81 V82	M74-L78 HydrophobicContact CE-CD1 3.66Å; M74-L78 WeakPolarHBondContact O-CB 3.29Å; M74-L78 PolarHBondContact O-N 2.85Å; L78-F80 HydrophobicContact CD2-CE1 4.33Å; L78-F80 HydrophobicContact CD2-CZ 4.22Å; L78-F80 PolarHBondContact O-N 3.29Å; L78-A81 PolarHBondContact O-N 3.31Å; L78-V82 HydrophobicContact CB-CB 4.43Å; L78-V82 HydrophobicContact CB-CG2 3.63Å; L78-V82 HydrophobicContact CD1-CG2 4.26Å; L78-V82 PolarHBondContact O-N 2.79Å
79	K	80.2	Confident	87	Confident	177 Å²	177	86 Å²	86	77%	0.77	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	-28.9	-175.1	-170.4	179.1	177.5	-176.7	0	114.3	S75	S75-K79 WeakPolarHBondContact O-CA 3.42Å; S75-K79 WeakPolarHBondContact O-CB 3.19Å; S75-K79 PolarHBondContact O-N 2.89Å
80	F	85.6	Confident	87	Confident	186 Å²	186	86 Å²	86	82%	0.816	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.1	-19.3	178.6	63.5	-91.3	0	0	0	114.1	L78	L78-F80 HydrophobicContact CD2-CE1 4.33Å; L78-F80 HydrophobicContact CD2-CZ 4.22Å; L78-F80 PolarHBondContact O-N 3.29Å
81	A	84	Confident	87.1	Confident	73 Å²	73	89.4 Å²	89.4	60%	0.603	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-117.9	-20.2	-174.6	0	0	0	0	0	113.5	L78	L78-A81 PolarHBondContact O-N 3.31Å
82	V	79.4	Confident	87.3	Confident	53 Å²	53	92.9 Å²	92.9	32%	0.321	47%	0.465	S	S	.	.	S	Bend	trans	-108.7	124.7	-176.9	179.9	0	0	0	0	109	L78	L78-V82 HydrophobicContact CB-CB 4.43Å; L78-V82 HydrophobicContact CB-CG2 3.63Å; L78-V82 HydrophobicContact CD1-CG2 4.26Å; L78-V82 PolarHBondContact O-N 2.79Å
83	K	81.6	Confident	87.4	Confident	174 Å²	174	92.5 Å²	92.5	76%	0.757	47%	0.466	S	S	*	.			trans	-58.6	163.1	174.8	-67.7	-175.2	179.9	-179.1	0	111.3	P85	K83-P85 WeakPolarHBondContact O-CD 3.41Å; K83-P85 VanDerWaalsContact O-N 3.11Å
84	D	86.8	Confident	87.5	Confident	93 Å²	93	86.1 Å²	86.1	50%	0.497	44%	0.439	S	S	.	.			trans	-56	119.8	172.5	-171	-26.8	0	0	0	109	M86 D87	D84-M86 PolarHBondContact O-N 2.8Å; D84-M86 VanDerWaalsContact O-N 3.12Å; D84-M86 VanDerWaalsContact OD1-CB 3.29Å; D84-M86 WeakPolarHBondContact OD1-CB 3.46Å; D84-M86 WeakPolarHBondContact OD1-CG 3.25Å; D84-M86 PolarHBondContact OD1-N 2.65Å; D84-D87 VanDerWaalsContact O-CB 3.28Å; D84-D87 WeakPolarHBondContact O-CB 3.31Å; D84-D87 PolarHBondContact O-N 2.7Å
85	P	88.8	Confident	87.8	Confident	11 Å²	11	85 Å²	85	7%	0.071	44%	0.435	C	S	.	.	G	3₁₀ helix	trans	-63.7	-20	-176.7	30.3	-39.6	0	0	0	112.3	P67 Q71 S75 K83 D87 N88	P67-P85 HydrophobicContact CB-CB 3.6Å; P67-P85 HydrophobicContact CB-CG 4.3Å; P67-P85 HydrophobicContact CG-CB 3.94Å; P67-P85 HydrophobicContact CG-CG 4.1Å; Q71-P85 HydrophobicContact CB-CB 3.87Å; S75-P85 VanDerWaalsContact CB-CD 3.48Å; K83-P85 WeakPolarHBondContact O-CD 3.41Å; K83-P85 VanDerWaalsContact O-N 3.11Å; P85-D87 PolarHBondContact O-N 3.14Å; P85-N88 WeakPolarHBondContact O-CB 3.45Å; P85-N88 PolarHBondContact O-N 3.34Å; P85-N88 VanDerWaalsContact O-N 3.15Å
86	M	89.4	Confident	87.9	Confident	99 Å²	99	87.4 Å²	87.4	49%	0.488	44%	0.444	S	S	.	.	G	3₁₀ helix	trans	-63.6	-22.5	172.2	-66.1	-64.3	159.3	0	0	113.2	P67 D84 N88 C89	P67-M86 WeakPolarHBondContact CD-SD 3.48Å; P67-M86 HydrophobicContact CG-CE 3.51Å; P67-M86 HydrophobicContact CG-SD 4.07Å; D84-M86 PolarHBondContact O-N 2.8Å; D84-M86 VanDerWaalsContact O-N 3.12Å; D84-M86 VanDerWaalsContact OD1-CB 3.29Å; D84-M86 WeakPolarHBondContact OD1-CB 3.46Å; D84-M86 WeakPolarHBondContact OD1-CG 3.25Å; D84-M86 PolarHBondContact OD1-N 2.65Å; M86-N88 PolarHBondContact O-N 3.31Å; M86-C89 PolarHBondContact O-N 3.07Å
87	D	89.2	Confident	88	Confident	57 Å²	57	88.7 Å²	88.7	31%	0.305	45%	0.45	S	S	.	.	G	3₁₀ helix	trans	-61.3	-28.1	174.5	-74.1	-29.8	0	0	0	112.1	D84 P85 C89 K90 V93	D84-D87 VanDerWaalsContact O-CB 3.28Å; D84-D87 WeakPolarHBondContact O-CB 3.31Å; D84-D87 PolarHBondContact O-N 2.7Å; P85-D87 PolarHBondContact O-N 3.14Å; D87-C89 PolarHBondContact O-N 3.01Å; D87-K90 WeakPolarHBondContact OD1-CE 3.44Å; D87-K90 IonicContact OD1-NZ 2.64Å; D87-K90 PolarHBondContact OD1-NZ 2.75Å; D87-V93 WeakPolarHBondContact O-CG2 3.48Å
88	N	87.7	Confident	88.2	Confident	56 Å²	56	83.4 Å²	83.4	30%	0.299	43%	0.426	S	S	.	.	G	3₁₀ helix	trans	-77.8	-6.8	177.1	-62	-41.3	0	0	0	113.5	T35 W36 Q71 P85 M86 I94	T35-N88 HydrophobicContact CG2-CB 3.92Å; W36-N88 PolarHBondContact NE1-O 2.86Å; Q71-N88 PolarHBondContact NE2-ND2 3.12Å; P85-N88 WeakPolarHBondContact O-CB 3.45Å; P85-N88 PolarHBondContact O-N 3.34Å; P85-N88 VanDerWaalsContact O-N 3.15Å; M86-N88 PolarHBondContact O-N 3.31Å; N88-I94 VanDerWaalsContact O-CG2 3.29Å; N88-I94 WeakPolarHBondContact O-CG2 3.27Å
89	C	90.7	Very high	88.5	Confident	26 Å²	26	84.5 Å²	84.5	18%	0.176	43%	0.43	C	S	.	.	G	3₁₀ helix	trans	-109.7	1.4	-174.7	-48.6	0	0	0	0	113.1	C66 P67 M86 D87	C66-C89 HydrophobicContact CB-CB 3.85Å; C66-C89 WeakPolarHBondContact CB-SG 3.16Å; C66-C89 WeakPolarHBondContact SG-CA 3.03Å; C66-C89 WeakPolarHBondContact SG-CB 3.38Å; C66-C89 CovalentContact SG-SG 2.03Å; C66-C89 PolarHBondContact SG-SG 3.4Å; P67-C89 VanDerWaalsContact CD-SG 3.52Å; M86-C89 PolarHBondContact O-N 3.07Å; D87-C89 PolarHBondContact O-N 3.01Å
90	K	91.1	Very high	89.2	Confident	96 Å²	96	76.1 Å²	76.1	42%	0.417	39%	0.393	S	S	.	.			trans	-64.8	141.2	179.7	-65.9	178.1	178.6	166.6	0	110.1	D87 N92 V93 I94	D87-K90 WeakPolarHBondContact OD1-CE 3.44Å; D87-K90 IonicContact OD1-NZ 2.64Å; D87-K90 PolarHBondContact OD1-NZ 2.75Å; K90-N92 VanDerWaalsContact CB-OD1 3.26Å; K90-N92 WeakPolarHBondContact CB-OD1 3.39Å; K90-N92 PolarHBondContact O-N 2.85Å; K90-N92 VanDerWaalsContact O-N 3.15Å; K90-V93 HydrophobicContact CB-CB 4.29Å; K90-V93 HydrophobicContact CB-CG2 3.94Å; K90-V93 WeakPolarHBondContact O-CA 3.49Å; K90-V93 WeakPolarHBondContact O-CB 3.2Å; K90-V93 PolarHBondContact O-N 3.41Å; K90-I94 PolarHBondContact O-N 3.35Å; K90-I94 VanDerWaalsContact O-N 3.15Å
91	P	89.2	Confident	89.7	Confident	101 Å²	101	69.8 Å²	69.8	66%	0.656	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.9	-37.3	-178.5	-28.3	35	0	0	0	113.9	V93 G122	P91-V93 VanDerWaalsContact C-N 3.3Å; P91-V93 PolarHBondContact O-N 3.09Å; P91-G122 CarbonylContact O-C 3.57Å; P91-G122 WeakPolarHBondContact O-CA 3.1Å; P91-G122 PolarHBondContact O-N 3.27Å
92	N	91.1	Very high	90.2	Very high	97 Å²	97	66.7 Å²	66.7	52%	0.519	35%	0.345	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.2	-15.2	178	67	-50.5	0	0	0	113.9	K90	K90-N92 VanDerWaalsContact CB-OD1 3.26Å; K90-N92 WeakPolarHBondContact CB-OD1 3.39Å; K90-N92 PolarHBondContact O-N 2.85Å; K90-N92 VanDerWaalsContact O-N 3.15Å
93	V	90.7	Very high	90.9	Very high	44 Å²	44	65.9 Å²	65.9	27%	0.267	34%	0.342	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.8	-43.7	178	173.1	0	0	0	0	109.9	D87 K90 P91	D87-V93 WeakPolarHBondContact O-CG2 3.48Å; K90-V93 HydrophobicContact CB-CB 4.29Å; K90-V93 HydrophobicContact CB-CG2 3.94Å; K90-V93 WeakPolarHBondContact O-CA 3.49Å; K90-V93 WeakPolarHBondContact O-CB 3.2Å; K90-V93 PolarHBondContact O-N 3.41Å; P91-V93 VanDerWaalsContact C-N 3.3Å; P91-V93 PolarHBondContact O-N 3.09Å
94	I	92.2	Very high	91.5	Very high	2 Å²	2	57.7 Å²	57.7	1%	0.01	31%	0.306	C	S	.	.			trans	-146.9	137.8	-174.7	-166.5	65.6	0	0	0	112.6	W36 I63 N88 K90 M96 M119 I120	W36-I94 HydrophobicContact CH2-CD1 4.4Å; W36-I94 HydrophobicContact CZ2-CB 4.17Å; W36-I94 HydrophobicContact CZ2-CD1 4.2Å; W36-I94 HydrophobicContact CZ2-CG1 4.16Å; I63-I94 HydrophobicContact CD1-CB 4.47Å; I63-I94 HydrophobicContact CD1-CD1 4.18Å; I63-I94 HydrophobicContact CD1-CG1 3.32Å; I63-I94 HydrophobicContact CD1-CG2 4.33Å; N88-I94 VanDerWaalsContact O-CG2 3.29Å; N88-I94 WeakPolarHBondContact O-CG2 3.27Å; K90-I94 PolarHBondContact O-N 3.35Å; K90-I94 VanDerWaalsContact O-N 3.15Å; I94-M96 HydrophobicContact CG2-CG 4.09Å; I94-M96 HydrophobicContact CG2-SD 3.75Å; I94-M96 PolarHBondContact O-N 3.07Å; I94-M96 VanDerWaalsContact O-N 3.14Å; I94-M119 HydrophobicContact CD1-CB 3.65Å; I94-M119 HydrophobicContact CD1-CE 3.53Å; I94-M119 HydrophobicContact CD1-CG 4.41Å; I94-M119 HydrophobicContact CG1-CE 4.15Å; I94-I120 WeakPolarHBondContact CD1-O 3Å
95	N	93.4	Very high	91.9	Very high	58 Å²	58	56.2 Å²	56.2	31%	0.31	30%	0.298	S	S	.	.			trans	-83.4	89.2	173.5	-169.8	-15	0	0	0	109.8	K97 A98 H100 I120 G122	N95-K97 PolarHBondContact O-N 3.2Å; N95-K97 PolarHBondContact OD1-N 2.85Å; N95-K97 VanDerWaalsContact OD1-N 3.14Å; N95-A98 HydrophobicContact CB-CB 3.82Å; N95-A98 PolarHBondContact O-N 2.82Å; N95-A98 PolarHBondContact OD1-N 2.86Å; N95-H100 PolarHBondContact O-CE1 2.74Å; N95-H100 PolarHBondContact O-NE2 2.94Å; N95-I120 HydrophobicContact CB-CG2 4.18Å; N95-I120 VanDerWaalsContact CB-O 3.3Å; N95-I120 WeakPolarHBondContact CB-O 3.5Å; N95-I120 PolarHBondContact N-O 2.89Å; N95-G122 VanDerWaalsContact N-N 3.16Å
96	M	89.7	Confident	92.1	Very high	69 Å²	69	57.9 Å²	57.9	34%	0.34	30%	0.303	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	-17.9	179.1	-66.2	-66.4	-65.1	0	0	114.6	I63 C66 I94	I63-M96 HydrophobicContact CB-CE 4.04Å; I63-M96 HydrophobicContact CB-SD 4.1Å; I63-M96 HydrophobicContact CD1-SD 3.72Å; I63-M96 HydrophobicContact CG2-CE 3.44Å; I63-M96 VanDerWaalsContact CG2-CE 3.44Å; I63-M96 HydrophobicContact CG2-SD 3.77Å; C66-M96 HydrophobicContact CB-CE 3.48Å; C66-M96 VanDerWaalsContact CB-CE 3.48Å; C66-M96 HydrophobicContact CB-SD 3.74Å; I94-M96 HydrophobicContact CG2-CG 4.09Å; I94-M96 HydrophobicContact CG2-SD 3.75Å; I94-M96 PolarHBondContact O-N 3.07Å; I94-M96 VanDerWaalsContact O-N 3.14Å
97	K	89.9	Confident	92.3	Very high	198 Å²	198	54.5 Å²	54.5	86%	0.861	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100	-8.1	-179.1	-63	-176.1	178.9	-179.1	0	113.4	N95	N95-K97 PolarHBondContact O-N 3.2Å; N95-K97 PolarHBondContact OD1-N 2.85Å; N95-K97 VanDerWaalsContact OD1-N 3.14Å
98	A	93.5	Very high	92.3	Very high	16 Å²	16	59.2 Å²	59.2	13%	0.132	31%	0.307	C	S	.	.	S	Bend	trans	-84.2	152.9	-178.5	0	0	0	0	0	111.5	N95 I120	N95-A98 HydrophobicContact CB-CB 3.82Å; N95-A98 PolarHBondContact O-N 2.82Å; N95-A98 PolarHBondContact OD1-N 2.86Å; A98-I120 HydrophobicContact CB-CB 4.17Å; A98-I120 HydrophobicContact CB-CD1 3.99Å; A98-I120 HydrophobicContact CB-CG2 4.28Å
99	E	95.2	Very high	92.4	Very high	89 Å²	89	64.2 Å²	64.2	42%	0.416	32%	0.323	S	S	.	.	P	Polyproline II helix	trans	-81.4	123.3	160.9	-66	-160.5	150.2	0	0	109.4	T41 N60 I62 I120	T41-E99 VanDerWaalsContact CB-OE1 3.27Å; T41-E99 WeakPolarHBondContact CB-OE1 3.23Å; T41-E99 VanDerWaalsContact OG1-CD 3.29Å; T41-E99 PolarHBondContact OG1-OE1 3.17Å; N60-E99 HydrophobicContact CB-CB 4.16Å; N60-E99 PolarHBondContact ND2-OE2 2.86Å; I62-E99 HydrophobicContact CG2-CG 4.08Å; E99-I120 WeakPolarHBondContact O-CD1 3.29Å
100	H	94.1	Very high	92.4	Very high	0 Å²	0	67.1 Å²	67.1	0%	0	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	119.9	178.7	-56.5	-57.1	0	0	0	109.5	A61 N95 C102 M119 I120	A61-H100 PolarHBondContact N-O 2.95Å; A61-H100 PolarHBondContact O-N 2.98Å; N95-H100 PolarHBondContact O-CE1 2.74Å; N95-H100 PolarHBondContact O-NE2 2.94Å; H100-C102 PolarHBondContact O-N 3.28Å; H100-M119 HydrophobicContact CB-CE 4.45Å; H100-M119 HydrophobicContact CB-SD 4.13Å; H100-I120 PolarHBondContact CE1-N 3.46Å; H100-I120 PolarHBondContact CE1-O 2.99Å; H100-I120 PolarHBondContact ND1-N 3.43Å
101	P	95.6	Very high	92.3	Very high	54 Å²	54	63.9 Å²	63.9	35%	0.351	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	131.4	176.1	23.7	-27.3	0	0	0	110.3	N118	P101-N118 HydrophobicContact CG-CB 4.16Å; P101-N118 PolarHBondContact O-N 3.14Å
102	C	95.5	Very high	92.3	Very high	8 Å²	8	64.1 Å²	64.1	5%	0.054	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	157	-176.1	-64.3	0	0	0	0	111.5	H58 F59 H100 N116 C117	H58-C102 WeakPolarHBondContact CA-O 3.49Å; F59-C102 HydrophobicContact CD1-CB 4.14Å; F59-C102 HydrophobicContact CD2-CB 4.01Å; F59-C102 HydrophobicContact CE1-CB 3.69Å; F59-C102 HydrophobicContact CE2-CB 3.57Å; F59-C102 HydrophobicContact CG-CB 4.28Å; F59-C102 HydrophobicContact CZ-CB 3.4Å; F59-C102 PolarHBondContact N-O 2.93Å; F59-C102 WeakPolarHBondContact O-CA 3.42Å; F59-C102 PolarHBondContact O-N 2.91Å; H100-C102 PolarHBondContact O-N 3.28Å; C102-N116 CarbonylContact C-O 3.37Å; C102-N116 WeakPolarHBondContact CA-O 3.31Å; C102-C117 HydrophobicContact CB-CB 4.13Å; C102-C117 WeakPolarHBondContact CB-SG 3.09Å; C102-C117 WeakPolarHBondContact SG-CB 3.38Å; C102-C117 CovalentContact SG-SG 2.05Å; C102-C117 PolarHBondContact SG-SG 2.85Å
103	S	94.5	Very high	92.3	Very high	36 Å²	36	60.1 Å²	60.1	25%	0.252	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	138.1	169.5	60.6	0	0	0	0	110.6	I57 L115 N116	I57-S103 CarbonylContact O-C 3.52Å; I57-S103 WeakPolarHBondContact O-CA 3.45Å; S103-L115 WeakPolarHBondContact O-CA 3.3Å; S103-N116 PolarHBondContact N-O 3.35Å; S103-N116 PolarHBondContact O-N 3.02Å
104	L	94.1	Very high	92.3	Very high	1 Å²	1	63.4 Å²	63.4	1%	0.005	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	117.3	172.6	-175	93.9	0	0	0	108.1	F22 V23 K26 I56 I57 F59 N114 L115	F22-L104 HydrophobicContact CD1-CD2 4.24Å; F22-L104 HydrophobicContact CE1-CD2 3.62Å; V23-L104 HydrophobicContact CG2-CD2 4.42Å; K26-L104 HydrophobicContact CB-CD1 4.25Å; K26-L104 HydrophobicContact CG-CD2 4.48Å; I56-L104 WeakPolarHBondContact CA-O 2.96Å; I57-L104 HydrophobicContact CB-CB 4.35Å; I57-L104 HydrophobicContact CD1-CD2 4.07Å; I57-L104 HydrophobicContact CG1-CD2 4.47Å; I57-L104 PolarHBondContact N-O 2.03Å; I57-L104 PolarHBondContact O-N 3.34Å; F59-L104 HydrophobicContact CE1-CB 3.94Å; L104-N114 WeakPolarHBondContact CA-O 2.99Å; L104-L115 HydrophobicContact CD1-CB 4.32Å; L104-L115 HydrophobicContact CD1-CD1 4.17Å
105	L	94	Very high	92.3	Very high	62 Å²	62	65.2 Å²	65.2	33%	0.325	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	110.1	166.6	172.9	66.1	0	0	0	108.4	Q54 I56 S113 N114	Q54-L105 HydrophobicContact CB-CD1 4.22Å; Q54-L105 HydrophobicContact CG-CD1 4.37Å; I56-L105 HydrophobicContact CD1-CD1 4.41Å; I56-L105 HydrophobicContact CG1-CD1 3.63Å; L105-S113 CarbonylContact O-C 3.51Å; L105-S113 VanDerWaalsContact O-CA 3.3Å; L105-S113 WeakPolarHBondContact O-CA 3.26Å; L105-N114 HydrophobicContact CB-CB 4.38Å; L105-N114 PolarHBondContact N-O 2.87Å; L105-N114 PolarHBondContact O-N 3.15Å
106	Y	93.5	Very high	92.3	Very high	46 Å²	46	66.8 Å²	66.8	18%	0.18	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	136.8	178.5	172	-102.1	0	0	0	111.2	F22 Q54 L55 K108 G111 N112	F22-Y106 HydrophobicContact CE1-CG 4.31Å; F22-Y106 AromaticContact CZ-CD1 3.9Å; F22-Y106 HydrophobicContact CZ-CD1 3.9Å; F22-Y106 AromaticContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CD2 3.84Å; F22-Y106 HydrophobicContact CZ-CE1 4.19Å; F22-Y106 HydrophobicContact CZ-CE2 4.12Å; F22-Y106 AromaticContact CZ-CG 3.71Å; F22-Y106 HydrophobicContact CZ-CG 3.71Å; Q54-Y106 CarbonylContact C-O 3.58Å; Q54-Y106 WeakPolarHBondContact CA-O 3.4Å; L55-Y106 HydrophobicContact CB-CD1 4.15Å; L55-Y106 HydrophobicContact CD2-CD1 4.49Å; L55-Y106 PolarHBondContact N-O 3.01Å; L55-Y106 PolarHBondContact O-N 3.38Å; Y106-K108 HydrophobicContact CE1-CB 4.15Å; Y106-G111 WeakPolarHBondContact CE2-O 3.48Å; Y106-N112 WeakPolarHBondContact CD2-O 3.48Å
107	S	92.7	Very high	92.4	Very high	28 Å²	28	64.6 Å²	64.6	20%	0.196	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	115.8	172.2	173.1	0	0	0	0	109.9	Y109 T110 G111 N112	S107-Y109 PolarHBondContact O-N 3.03Å; S107-T110 VanDerWaalsContact CB-OG1 3.31Å; S107-T110 WeakPolarHBondContact CB-OG1 3.29Å; S107-T110 PolarHBondContact O-N 3.36Å; S107-T110 PolarHBondContact OG-N 2.91Å; S107-T110 PolarHBondContact OG-OG1 3.12Å; S107-G111 WeakPolarHBondContact O-CA 3.41Å; S107-G111 PolarHBondContact O-N 3.29Å; S107-N112 PolarHBondContact N-O 2.95Å
108	K	90.1	Very high	92.5	Very high	156 Å²	156	60.2 Å²	60.2	68%	0.678	32%	0.32	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.3	-33.5	175.3	-175.3	180	176	-178.3	0	112.1	G53 Y106	G53-K108 VanDerWaalsContact O-CB 3.31Å; G53-K108 WeakPolarHBondContact O-CB 3.28Å; G53-K108 PolarHBondContact O-N 3.43Å; Y106-K108 HydrophobicContact CE1-CB 4.15Å
109	Y	89.1	Confident	92.4	Very high	161 Å²	161	61.7 Å²	61.7	63%	0.631	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.6	-33.2	-176.6	-61.9	-52.8	0	0	0	113.2	L51 T52 S107	L51-Y109 PolarHBondContact O-OH 3.49Å; T52-Y109 VanDerWaalsContact C-CE2 3.45Å; T52-Y109 WeakPolarHBondContact O-CE2 3.43Å; S107-Y109 PolarHBondContact O-N 3.03Å
110	T	90.9	Very high	92.3	Very high	87 Å²	87	60.9 Å²	60.9	53%	0.534	32%	0.323	S	S	.	.	T	Hydrogen-bonded Turn	trans	-106.4	-15.1	-179	61	0	0	0	0	113.4	S107 N112	S107-T110 VanDerWaalsContact CB-OG1 3.31Å; S107-T110 WeakPolarHBondContact CB-OG1 3.29Å; S107-T110 PolarHBondContact O-N 3.36Å; S107-T110 PolarHBondContact OG-N 2.91Å; S107-T110 PolarHBondContact OG-OG1 3.12Å; T110-N112 PolarHBondContact O-N 3.15Å; T110-N112 PolarHBondContact OG1-N 2.96Å
111	G	88.5	Confident	92.1	Very high	29 Å²	29	70 Å²	70	30%	0.299	36%	0.357	S	S	.	.			trans	73	-2.5	-172.7	0	0	0	0	0	114.3	K26 Y106 S107	K26-G111 PolarHBondContact NZ-O 2.89Å; Y106-G111 WeakPolarHBondContact CE2-O 3.48Å; S107-G111 WeakPolarHBondContact O-CA 3.41Å; S107-G111 PolarHBondContact O-N 3.29Å
112	N	89.6	Confident	91.7	Very high	105 Å²	105	68.2 Å²	68.2	56%	0.561	35%	0.349	S	S	*	.			trans	-80	149.9	-177.9	-64.5	-19	0	0	0	111.2	Y106 S107 T110	Y106-N112 WeakPolarHBondContact CD2-O 3.48Å; S107-N112 PolarHBondContact N-O 2.95Å; T110-N112 PolarHBondContact O-N 3.15Å; T110-N112 PolarHBondContact OG1-N 2.96Å
113	S	90.8	Very high	91.1	Very high	13 Å²	13	80.1 Å²	80.1	9%	0.091	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	147	170.1	-3.7	0	0	0	0	110	K26 E30 L105	K26-S113 WeakPolarHBondContact CD-OG 3.28Å; K26-S113 WeakPolarHBondContact CE-OG 3.49Å; K26-S113 PolarHBondContact NZ-OG 3.24Å; E30-S113 VanDerWaalsContact CD-OG 3.26Å; E30-S113 WeakPolarHBondContact OE1-CB 3.35Å; E30-S113 PolarHBondContact OE1-OG 3.14Å; E30-S113 PolarHBondContact OE2-OG 3.24Å; L105-S113 CarbonylContact O-C 3.51Å; L105-S113 VanDerWaalsContact O-CA 3.3Å; L105-S113 WeakPolarHBondContact O-CA 3.26Å
114	N	91.5	Very high	90.9	Very high	114 Å²	114	82.3 Å²	82.3	61%	0.61	41%	0.407	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111	112.2	164.2	-70.2	-32.8	0	0	0	107.1	L104 L105	L104-N114 WeakPolarHBondContact CA-O 2.99Å; L105-N114 HydrophobicContact CB-CB 4.38Å; L105-N114 PolarHBondContact N-O 2.87Å; L105-N114 PolarHBondContact O-N 3.15Å
115	L	92.4	Very high	90.7	Very high	39 Å²	39	86.6 Å²	86.6	20%	0.204	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	130.4	177.2	178	67.9	0	0	0	109.5	L27 V34 F59 S103 L104	L27-L115 HydrophobicContact CD2-CD1 3.84Å; L27-L115 HydrophobicContact CD2-CD2 3.45Å; L27-L115 VanDerWaalsContact CD2-CD2 3.45Å; L27-L115 HydrophobicContact CD2-CG 4.31Å; V34-L115 HydrophobicContact CG1-CD2 3.4Å; V34-L115 HydrophobicContact CG1-CG 4.47Å; F59-L115 HydrophobicContact CE1-CD1 4.19Å; F59-L115 HydrophobicContact CZ-CD1 3.71Å; S103-L115 WeakPolarHBondContact O-CA 3.3Å; L104-L115 HydrophobicContact CD1-CB 4.32Å; L104-L115 HydrophobicContact CD1-CD1 4.17Å
116	N	92.6	Very high	90.6	Very high	92 Å²	92	87.9 Å²	87.9	49%	0.492	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	134.4	172.3	-179.5	38.1	0	0	0	109.7	C102 S103	C102-N116 CarbonylContact C-O 3.37Å; C102-N116 WeakPolarHBondContact CA-O 3.31Å; S103-N116 PolarHBondContact N-O 3.35Å; S103-N116 PolarHBondContact O-N 3.02Å
117	C	92.5	Very high	90.4	Very high	23 Å²	23	90.4 Å²	90.4	16%	0.155	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	126.9	178.6	-68.7	0	0	0	0	110.1	L38 C102 M119	L38-C117 HydrophobicContact CD1-CB 4.35Å; L38-C117 WeakPolarHBondContact CD1-SG 3.46Å; C102-C117 HydrophobicContact CB-CB 4.13Å; C102-C117 WeakPolarHBondContact CB-SG 3.09Å; C102-C117 WeakPolarHBondContact SG-CB 3.38Å; C102-C117 CovalentContact SG-SG 2.05Å; C102-C117 PolarHBondContact SG-SG 2.85Å; C117-M119 HydrophobicContact CB-CG 4.48Å; C117-M119 HydrophobicContact CB-SD 3.61Å; C117-M119 PolarHBondContact O-N 3.15Å; C117-M119 VanDerWaalsContact O-N 3.07Å
118	N	92.5	Very high	90.3	Very high	105 Å²	105	94.3 Å²	94.3	56%	0.561	46%	0.464	S	S	*	.			trans	-82.5	88	175.1	-70.1	-31.9	0	0	0	108.9	P101 I120	P101-N118 HydrophobicContact CG-CB 4.16Å; P101-N118 PolarHBondContact O-N 3.14Å; N118-I120 PolarHBondContact O-N 3.43Å
119	M	91.6	Very high	90.3	Very high	47 Å²	47	90.2 Å²	90.2	23%	0.232	45%	0.45	C	S	.	.			trans	-69.7	123.6	-174.4	-58.1	-55.1	-63.5	0	0	111.4	W36 L38 I63 I94 H100 C117 R121	W36-M119 HydrophobicContact CD2-CE 3.84Å; W36-M119 HydrophobicContact CE3-CE 3.39Å; W36-M119 HydrophobicContact CE3-CG 4.1Å; W36-M119 HydrophobicContact CE3-SD 4.02Å; W36-M119 HydrophobicContact CG-CE 4.45Å; W36-M119 HydrophobicContact CH2-CE 4.46Å; W36-M119 HydrophobicContact CH2-CG 4.17Å; W36-M119 HydrophobicContact CZ3-CB 4.34Å; W36-M119 HydrophobicContact CZ3-CE 3.77Å; W36-M119 HydrophobicContact CZ3-CG 3.53Å; W36-M119 HydrophobicContact CZ3-SD 4.09Å; L38-M119 HydrophobicContact CD2-CE 4.31Å; I63-M119 HydrophobicContact CD1-CE 3.83Å; I63-M119 HydrophobicContact CG1-CE 4.12Å; I94-M119 HydrophobicContact CD1-CB 3.65Å; I94-M119 HydrophobicContact CD1-CE 3.53Å; I94-M119 HydrophobicContact CD1-CG 4.41Å; I94-M119 HydrophobicContact CG1-CE 4.15Å; H100-M119 HydrophobicContact CB-CE 4.45Å; H100-M119 HydrophobicContact CB-SD 4.13Å; C117-M119 HydrophobicContact CB-CG 4.48Å; C117-M119 HydrophobicContact CB-SD 3.61Å; C117-M119 PolarHBondContact O-N 3.15Å; C117-M119 VanDerWaalsContact O-N 3.07Å; M119-R121 PolarHBondContact O-N 2.64Å
120	I	92.6	Very high	90.3	Very high	72 Å²	72	85.1 Å²	85.1	37%	0.369	44%	0.437	S	S	.	.			trans	-83.1	115.4	179.2	-61	172.2	0	0	0	107.5	I94 N95 A98 E99 H100 N118	I94-I120 WeakPolarHBondContact CD1-O 3Å; N95-I120 HydrophobicContact CB-CG2 4.18Å; N95-I120 VanDerWaalsContact CB-O 3.3Å; N95-I120 WeakPolarHBondContact CB-O 3.5Å; N95-I120 PolarHBondContact N-O 2.89Å; A98-I120 HydrophobicContact CB-CB 4.17Å; A98-I120 HydrophobicContact CB-CD1 3.99Å; A98-I120 HydrophobicContact CB-CG2 4.28Å; E99-I120 WeakPolarHBondContact O-CD1 3.29Å; H100-I120 PolarHBondContact CE1-N 3.46Å; H100-I120 PolarHBondContact CE1-O 2.99Å; H100-I120 PolarHBondContact ND1-N 3.43Å; N118-I120 PolarHBondContact O-N 3.43Å
121	R	90.6	Very high	90.3	Very high	192 Å²	192	85 Å²	85	73%	0.725	43%	0.43	S	S	*	.			trans	-65.4	143.1	175.6	-53.8	-175.9	97.5	169	7.6	109.5	M119	M119-R121 PolarHBondContact O-N 2.64Å
122	G	86.4	Confident	90.5	Very high	16 Å²	16	89.7 Å²	89.7	17%	0.165	44%	0.441	C	S	.	.			trans	-80.2	172.1	172.1	0	0	0	0	0	111.3	P91 N95	P91-G122 CarbonylContact O-C 3.57Å; P91-G122 WeakPolarHBondContact O-CA 3.1Å; P91-G122 PolarHBondContact O-N 3.27Å; N95-G122 VanDerWaalsContact N-N 3.16Å
123	K	82.4	Confident	90.5	Very high	258 Å²	258	88.3 Å²	88.3	100%	1.122	43%	0.43	S	S	*	.			trans	-97.2	0	-178.2	-67.5	-175.2	178.1	-178.7	0	110.4

Retrieved 123 of 123 residues in 224 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).