A0A077ZE71_TRITR Loading...

CutA1 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZE71, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 111 aa.

						>A0A077ZE71_TRITR|A0A077ZE71
MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALSALRRNTRKLPTCSCRKASGMKMSFTAKARFTAIG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.2	Very low	59.6	Low	223 Å²	223	134.1 Å²	134.1	100%	1.099	74%	0.742	S	S	*	*				0	77.4	0	-159.1	155.6	147	0	0	106.2	D3	M1-D3 PolarHBondContact O-N 3.37Å
2	L	53.5	Low	62.5	Low	169 Å²	169	125.8 Å²	125.8	89%	0.885	70%	0.697	S	S	*	*			trans	-85.6	107.6	171.5	-67.4	170.9	0	0	0	103.7	E4	L2-E4 PolarHBondContact O-N 3.03Å
3	D	51.8	Low	65	Low	140 Å²	140	123.5 Å²	123.5	75%	0.749	69%	0.689	S	S	*	*			trans	-52.4	108.2	178.5	-82.9	-60.1	0	0	0	109.3	M1 K5	M1-D3 PolarHBondContact O-N 3.37Å; D3-K5 PolarHBondContact O-N 3.18Å
4	E	54.4	Low	67.1	Low	193 Å²	193	117 Å²	117	90%	0.902	65%	0.653	S	S	*	*			trans	-68.5	43.5	168.6	-86.4	-176.9	117.4	0	0	111.2	L2 S6	L2-E4 PolarHBondContact O-N 3.03Å; E4-S6 PolarHBondContact O-N 2.83Å
5	K	50	Low	68.9	Low	181 Å²	181	117 Å²	117	79%	0.787	65%	0.651	S	S	*	*			trans	-78.3	60.1	154.6	-94.7	-174.4	176.2	175.3	0	108.6	D3 S7	D3-K5 PolarHBondContact O-N 3.18Å; K5-S7 PolarHBondContact O-N 3.4Å
6	S	47.8	Very low	70.4	Confident	111 Å²	111	110.3 Å²	110.3	78%	0.776	61%	0.614	S	S	*	*			trans	-70.7	61.3	151.8	-177.6	0	0	0	0	107.5	E4 N8	E4-S6 PolarHBondContact O-N 2.83Å; S6-N8 PolarHBondContact O-N 2.79Å
7	S	47.8	Very low	71.7	Confident	77 Å²	77	106 Å²	106	54%	0.538	59%	0.591	S	S	.	*			trans	-76.9	56.8	172.5	63.5	0	0	0	0	108.5	K5 T9	K5-S7 PolarHBondContact O-N 3.4Å; S7-T9 WeakPolarHBondContact O-CG2 3.39Å; S7-T9 PolarHBondContact O-N 3.33Å
8	N	57.6	Low	72.8	Confident	153 Å²	153	100.4 Å²	100.4	82%	0.818	56%	0.561	S	S	*	*	S	Bend	trans	36.5	23.5	171.3	-159.2	26.7	0	0	0	118	S6 A10	S6-N8 PolarHBondContact O-N 2.79Å; N8-A10 PolarHBondContact O-N 2.85Å; N8-A10 VanDerWaalsContact O-N 3.12Å
9	T	70.9	Confident	73.7	Confident	72 Å²	72	96.8 Å²	96.8	44%	0.442	54%	0.542	S	S	.	.			trans	-87	92.2	176.8	50	0	0	0	0	106.4	S7 S11	S7-T9 WeakPolarHBondContact O-CG2 3.39Å; S7-T9 PolarHBondContact O-N 3.33Å; T9-S11 PolarHBondContact O-N 2.92Å
10	A	90.6	Very high	74.5	Confident	56 Å²	56	95.2 Å²	95.2	46%	0.463	53%	0.532	S	S	.	.			trans	-46.8	120.3	171.5	0	0	0	0	0	108.9	N8 T69 V70	N8-A10 PolarHBondContact O-N 2.85Å; N8-A10 VanDerWaalsContact O-N 3.12Å; A10-T69 CarbonylContact O-C 3.58Å; A10-T69 VanDerWaalsContact O-CA 3.31Å; A10-T69 WeakPolarHBondContact O-CA 3.43Å; A10-V70 HydrophobicContact CB-CB 4.34Å; A10-V70 HydrophobicContact CB-CG2 3.55Å; A10-V70 WeakPolarHBondContact O-CG2 3.28Å; A10-V70 PolarHBondContact O-N 3.16Å
11	S	92.2	Very high	75.3	Confident	100 Å²	100	96.1 Å²	96.1	70%	0.699	53%	0.533	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.6	142.3	179.1	-65.6	0	0	0	0	109.4	T9 T68	T9-S11 PolarHBondContact O-N 2.92Å; S11-T68 CarbonylContact C-O 3.55Å; S11-T68 WeakPolarHBondContact CA-O 3.41Å
12	V	94.8	Very high	77.9	Confident	35 Å²	35	89 Å²	89	21%	0.212	51%	0.509	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	147.7	177.1	-65.1	0	0	0	0	110.4	V14 T68 V70	V12-V14 HydrophobicContact CG2-CG2 4.35Å; V12-T68 HydrophobicContact CG2-CG2 3.58Å; V12-T68 PolarHBondContact N-O 2.74Å; V12-T68 PolarHBondContact O-N 3.05Å; V12-T68 VanDerWaalsContact O-O 3.06Å; V12-V70 HydrophobicContact CG1-CG2 3.43Å; V12-V70 VanDerWaalsContact CG1-CG2 3.43Å
13	V	95.1	Very high	79.7	Confident	96 Å²	96	81.6 Å²	81.6	58%	0.582	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.1	123.7	170.2	-179.5	0	0	0	0	107.7	L15 I65 L66	V13-L15 HydrophobicContact CG1-CD2 4.32Å; V13-I65 HydrophobicContact CG1-CG2 3.55Å; V13-L66 WeakPolarHBondContact CA-O 3.46Å
14	V	93.9	Very high	81.6	Confident	32 Å²	32	74.9 Å²	74.9	19%	0.194	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	118.8	176.2	178.3	0	0	0	0	108.4	V12 L66 T68 L76	V12-V14 HydrophobicContact CG2-CG2 4.35Å; V14-L66 HydrophobicContact CB-CB 4.29Å; V14-L66 PolarHBondContact N-O 3.3Å; V14-L66 PolarHBondContact O-N 3.25Å; V14-T68 HydrophobicContact CG2-CG2 4.04Å; V14-L76 HydrophobicContact CB-CD2 3.94Å; V14-L76 HydrophobicContact CG1-CD2 3.94Å; V14-L76 HydrophobicContact CG2-CD2 3.91Å
15	L	94.7	Very high	83.6	Confident	117 Å²	117	71 Å²	71	61%	0.613	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.6	125.8	170.7	-57.9	179.6	0	0	0	108.5	V13 I65	V13-L15 HydrophobicContact CG1-CD2 4.32Å; L15-I65 HydrophobicContact CD2-CB 4.45Å; L15-I65 HydrophobicContact CD2-CG1 3.92Å; L15-I65 HydrophobicContact CD2-CG2 4.27Å
16	C	91.7	Very high	85.7	Confident	9 Å²	9	65.2 Å²	65.2	6%	0.061	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	157	172.6	65.4	0	0	0	0	110.2	Q63 M64	C16-Q63 PolarHBondContact O-NE2 3.48Å; C16-M64 PolarHBondContact N-O 3.43Å; C16-M64 WeakPolarHBondContact O-CA 3.49Å; C16-M64 WeakPolarHBondContact O-CB 3.36Å; C16-M64 PolarHBondContact O-N 3.3Å; C16-M64 VanDerWaalsContact O-O 3.09Å
17	T	92.5	Very high	87.8	Confident	38 Å²	38	60.4 Å²	60.4	23%	0.233	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.3	150.4	177.7	63.9	0	0	0	0	110.5	E61 V62 R80	T17-E61 WeakPolarHBondContact CB-OE2 3.25Å; T17-E61 HydrophobicContact CG2-CG 4.46Å; T17-E61 WeakPolarHBondContact CG2-OE2 3.2Å; T17-E61 PolarHBondContact OG1-OE2 3.09Å; T17-V62 VanDerWaalsContact CA-O 3.32Å; T17-V62 WeakPolarHBondContact CA-O 3.41Å; T17-R80 PolarHBondContact O-NH2 3.14Å; T17-R80 VanDerWaalsContact O-NH2 3.13Å
18	A	91.5	Very high	90	Very high	5 Å²	5	57 Å²	57	4%	0.041	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	148.9	176.1	0	0	0	0	0	109.4	D20 T23 A24 E61 V62 M64	A18-D20 VanDerWaalsContact C-N 3.31Å; A18-D20 PolarHBondContact O-N 3.3Å; A18-T23 HydrophobicContact CB-CG2 4.45Å; A18-A24 HydrophobicContact CB-CB 3.72Å; A18-E61 CarbonylContact O-C 3.54Å; A18-E61 WeakPolarHBondContact O-CA 3.2Å; A18-E61 WeakPolarHBondContact O-CB 3.33Å; A18-V62 PolarHBondContact N-O 3.48Å; A18-V62 PolarHBondContact O-N 3.42Å; A18-M64 HydrophobicContact CB-SD 3.95Å
19	P	90.3	Very high	91.9	Very high	32 Å²	32	52.5 Å²	52.5	21%	0.208	32%	0.321	C	S	.	.	S	Bend	trans	-68.8	-28.1	-173.4	29.5	-39.3	0	0	0	114	T23 L86 P87	P19-T23 HydrophobicContact CG-CG2 3.93Å; P19-L86 HydrophobicContact CG-CD1 4.05Å; P19-P87 HydrophobicContact CB-CG 3.28Å; P19-P87 HydrophobicContact CG-CG 3.85Å
20	D	89.4	Confident	93	Very high	64 Å²	64	52.4 Å²	52.4	34%	0.342	31%	0.314	S	S	.	.	S	Bend	trans	-154.2	164.4	-176.1	58.3	66.3	0	0	0	110	A18 A22 T23 A24	A18-D20 VanDerWaalsContact C-N 3.31Å; A18-D20 PolarHBondContact O-N 3.3Å; D20-A22 VanDerWaalsContact C-N 3.32Å; D20-A22 PolarHBondContact O-N 3.46Å; D20-A22 WeakPolarHBondContact OD1-CB 3.38Å; D20-A22 PolarHBondContact OD1-N 2.84Å; D20-T23 PolarHBondContact O-N 3.18Å; D20-T23 VanDerWaalsContact OD1-CB 3.28Å; D20-T23 WeakPolarHBondContact OD1-CB 3.49Å; D20-T23 PolarHBondContact OD1-N 2.88Å; D20-T23 PolarHBondContact OD1-OG1 3.38Å; D20-T23 PolarHBondContact OD2-OG1 3.3Å; D20-A24 WeakPolarHBondContact O-CB 3.37Å; D20-A24 PolarHBondContact O-N 2.8Å
21	E	92.8	Very high	93.2	Very high	116 Å²	116	49.7 Å²	49.7	54%	0.542	29%	0.292	S	S	.	.	H	α-helix	trans	-62.4	-38	-178.4	-69.1	-174.9	-151.7	0	0	112.6	T23 A24 Q25 P44 V62	E21-T23 VanDerWaalsContact C-N 3.34Å; E21-T23 PolarHBondContact O-N 3.07Å; E21-A24 PolarHBondContact O-N 2.86Å; E21-Q25 WeakPolarHBondContact O-CB 3.38Å; E21-Q25 WeakPolarHBondContact O-CG 3.28Å; E21-Q25 PolarHBondContact O-N 3.42Å; E21-P44 HydrophobicContact CG-CB 3.99Å; E21-P44 VanDerWaalsContact OE1-CB 3.28Å; E21-P44 WeakPolarHBondContact OE1-CB 3.28Å; E21-V62 HydrophobicContact CB-CG2 4.48Å; E21-V62 HydrophobicContact CG-CG2 3.81Å
22	A	92	Very high	93.3	Very high	74 Å²	74	48.5 Å²	48.5	61%	0.612	28%	0.277	S	S	*	.	H	α-helix	trans	-63.6	-42.2	-179.5	0	0	0	0	0	111.4	D20 D26	D20-A22 VanDerWaalsContact C-N 3.32Å; D20-A22 PolarHBondContact O-N 3.46Å; D20-A22 WeakPolarHBondContact OD1-CB 3.38Å; D20-A22 PolarHBondContact OD1-N 2.84Å; A22-D26 WeakPolarHBondContact O-CB 3.38Å; A22-D26 PolarHBondContact O-N 3.41Å
23	T	91.2	Very high	93.4	Very high	12 Å²	12	50.7 Å²	50.7	7%	0.074	30%	0.299	C	S	.	.	H	α-helix	trans	-69	-39.5	176	-57.2	0	0	0	0	111.1	A18 P19 D20 E21 L27	A18-T23 HydrophobicContact CB-CG2 4.45Å; P19-T23 HydrophobicContact CG-CG2 3.93Å; D20-T23 PolarHBondContact O-N 3.18Å; D20-T23 VanDerWaalsContact OD1-CB 3.28Å; D20-T23 WeakPolarHBondContact OD1-CB 3.49Å; D20-T23 PolarHBondContact OD1-N 2.88Å; D20-T23 PolarHBondContact OD1-OG1 3.38Å; D20-T23 PolarHBondContact OD2-OG1 3.3Å; E21-T23 VanDerWaalsContact C-N 3.34Å; E21-T23 PolarHBondContact O-N 3.07Å; T23-L27 WeakPolarHBondContact O-CB 3.45Å; T23-L27 PolarHBondContact O-N 2.96Å
24	A	92.9	Very high	93.3	Very high	0 Å²	0	51.3 Å²	51.3	0%	0	30%	0.296	C	S	.	.	H	α-helix	trans	-61.8	-45.5	175	0	0	0	0	0	111.7	A18 D20 E21 L27 A28 L42 V62 M64	A18-A24 HydrophobicContact CB-CB 3.72Å; D20-A24 WeakPolarHBondContact O-CB 3.37Å; D20-A24 PolarHBondContact O-N 2.8Å; E21-A24 PolarHBondContact O-N 2.86Å; A24-L27 PolarHBondContact O-N 3.03Å; A24-A28 VanDerWaalsContact O-CB 3.28Å; A24-A28 WeakPolarHBondContact O-CB 2.99Å; A24-A28 PolarHBondContact O-N 2.73Å; A24-L42 HydrophobicContact CB-CD2 3.76Å; A24-L42 HydrophobicContact CB-CG 4.29Å; A24-V62 HydrophobicContact CB-CB 3.94Å; A24-V62 HydrophobicContact CB-CG1 3.71Å; A24-V62 HydrophobicContact CB-CG2 4.37Å; A24-M64 HydrophobicContact CB-CE 4.46Å; A24-M64 HydrophobicContact CB-CG 4.29Å; A24-M64 HydrophobicContact CB-SD 3.9Å; A24-M64 WeakPolarHBondContact O-CE 3.43Å
25	Q	95.7	Very high	93.3	Very high	112 Å²	112	57.9 Å²	57.9	52%	0.523	32%	0.322	S	S	.	.	H	α-helix	trans	-65.4	-44.1	178.5	-69.3	-72.2	-9.2	0	0	111.6	E21 L27 A28 A29 L42	E21-Q25 WeakPolarHBondContact O-CB 3.38Å; E21-Q25 WeakPolarHBondContact O-CG 3.28Å; E21-Q25 PolarHBondContact O-N 3.42Å; Q25-L27 PolarHBondContact O-N 3.1Å; Q25-A28 PolarHBondContact O-N 3.33Å; Q25-A29 WeakPolarHBondContact O-CB 3.41Å; Q25-A29 PolarHBondContact O-N 3.06Å; Q25-L42 HydrophobicContact CG-CD2 3.9Å
26	D	93.7	Very high	93.3	Very high	58 Å²	58	53 Å²	53	31%	0.31	30%	0.296	S	S	.	.	H	α-helix	trans	-61	-43.8	175.6	178.6	55.2	0	0	0	111.6	A22 A29 K30	A22-D26 WeakPolarHBondContact O-CB 3.38Å; A22-D26 PolarHBondContact O-N 3.41Å; D26-A29 PolarHBondContact O-N 2.84Å; D26-K30 VanDerWaalsContact CG-NZ 3.32Å; D26-K30 WeakPolarHBondContact O-CG 3.46Å; D26-K30 PolarHBondContact O-N 2.73Å; D26-K30 VanDerWaalsContact O-N 3.09Å; D26-K30 WeakPolarHBondContact OD1-CE 3.37Å; D26-K30 IonicContact OD1-NZ 2.67Å; D26-K30 PolarHBondContact OD1-NZ 3.25Å; D26-K30 WeakPolarHBondContact OD2-CE 3.39Å; D26-K30 IonicContact OD2-NZ 3.25Å; D26-K30 PolarHBondContact OD2-NZ 3.1Å
27	L	92.2	Very high	93.4	Very high	11 Å²	11	52.8 Å²	52.8	6%	0.058	30%	0.295	C	S	.	.	H	α-helix	trans	-64.7	-44.7	175.8	-177.2	61.8	0	0	0	111.5	T23 A24 Q25 A29 K30 V31 M64	T23-L27 WeakPolarHBondContact O-CB 3.45Å; T23-L27 PolarHBondContact O-N 2.96Å; A24-L27 PolarHBondContact O-N 3.03Å; Q25-L27 PolarHBondContact O-N 3.1Å; L27-A29 PolarHBondContact O-N 3.19Å; L27-K30 PolarHBondContact O-N 3.18Å; L27-V31 HydrophobicContact CD1-CG1 4.13Å; L27-V31 HydrophobicContact CG-CG1 4.42Å; L27-V31 WeakPolarHBondContact O-CG1 3.5Å; L27-V31 WeakPolarHBondContact O-CG2 3.16Å; L27-V31 PolarHBondContact O-N 2.84Å; L27-M64 HydrophobicContact CB-CE 4.22Å; L27-M64 HydrophobicContact CD2-CE 4.24Å; L27-M64 HydrophobicContact CD2-SD 3.96Å; L27-M64 HydrophobicContact CG-CE 4.29Å
28	A	95.5	Very high	93.5	Very high	5 Å²	5	55.4 Å²	55.4	4%	0.041	32%	0.321	C	S	.	.	H	α-helix	trans	-59.5	-45.6	177.4	0	0	0	0	0	111.7	A24 Q25 K30 V31 L32 A40 L42 M64	A24-A28 VanDerWaalsContact O-CB 3.28Å; A24-A28 WeakPolarHBondContact O-CB 2.99Å; A24-A28 PolarHBondContact O-N 2.73Å; Q25-A28 PolarHBondContact O-N 3.33Å; A28-K30 VanDerWaalsContact C-N 3.35Å; A28-K30 PolarHBondContact O-N 2.88Å; A28-V31 VanDerWaalsContact O-CG2 3.25Å; A28-V31 WeakPolarHBondContact O-CG2 3.32Å; A28-V31 PolarHBondContact O-N 2.82Å; A28-L32 WeakPolarHBondContact O-CB 3.38Å; A28-L32 WeakPolarHBondContact O-CG 3.28Å; A28-L32 PolarHBondContact O-N 2.88Å; A28-L32 VanDerWaalsContact O-N 3.12Å; A28-A40 HydrophobicContact CB-CB 3.89Å; A28-L42 HydrophobicContact CB-CD1 3.92Å; A28-L42 HydrophobicContact CB-CD2 4.43Å; A28-M64 HydrophobicContact CB-CE 3.92Å
29	A	95.9	Very high	93.8	Very high	59 Å²	59	57.1 Å²	57.1	49%	0.488	33%	0.332	S	S	.	.	H	α-helix	trans	-60	-44.7	177.3	0	0	0	0	0	111.6	Q25 D26 L27 L32 A33	Q25-A29 WeakPolarHBondContact O-CB 3.41Å; Q25-A29 PolarHBondContact O-N 3.06Å; D26-A29 PolarHBondContact O-N 2.84Å; L27-A29 PolarHBondContact O-N 3.19Å; A29-L32 PolarHBondContact O-N 3.38Å; A29-A33 WeakPolarHBondContact O-CB 3.37Å; A29-A33 PolarHBondContact O-N 3.06Å
30	K	94.6	Very high	94.1	Very high	69 Å²	69	56.6 Å²	56.6	30%	0.3	33%	0.33	S	S	.	.	H	α-helix	trans	-65.2	-47.6	179.5	-71.5	167.8	177.7	164	0	112.8	D26 L27 A28 L32 A33 E34 L79	D26-K30 VanDerWaalsContact CG-NZ 3.32Å; D26-K30 WeakPolarHBondContact O-CG 3.46Å; D26-K30 PolarHBondContact O-N 2.73Å; D26-K30 VanDerWaalsContact O-N 3.09Å; D26-K30 WeakPolarHBondContact OD1-CE 3.37Å; D26-K30 IonicContact OD1-NZ 2.67Å; D26-K30 PolarHBondContact OD1-NZ 3.25Å; D26-K30 WeakPolarHBondContact OD2-CE 3.39Å; D26-K30 IonicContact OD2-NZ 3.25Å; D26-K30 PolarHBondContact OD2-NZ 3.1Å; L27-K30 PolarHBondContact O-N 3.18Å; A28-K30 VanDerWaalsContact C-N 3.35Å; A28-K30 PolarHBondContact O-N 2.88Å; K30-L32 VanDerWaalsContact C-N 3.25Å; K30-L32 PolarHBondContact O-N 3Å; K30-A33 PolarHBondContact O-N 3.34Å; K30-E34 WeakPolarHBondContact O-CB 3.49Å; K30-E34 WeakPolarHBondContact O-CG 3.37Å; K30-E34 PolarHBondContact O-N 2.8Å; K30-L79 HydrophobicContact CB-CD2 3.95Å
31	V	94.2	Very high	94.5	Very high	0 Å²	0	56.5 Å²	56.5	0%	0	33%	0.332	C	S	.	.	H	α-helix	trans	-65	-32.4	-178.5	-58.5	0	0	0	0	112	L27 A28 K35 L36 A37 L66 L76 L79	L27-V31 HydrophobicContact CD1-CG1 4.13Å; L27-V31 HydrophobicContact CG-CG1 4.42Å; L27-V31 WeakPolarHBondContact O-CG1 3.5Å; L27-V31 WeakPolarHBondContact O-CG2 3.16Å; L27-V31 PolarHBondContact O-N 2.84Å; A28-V31 VanDerWaalsContact O-CG2 3.25Å; A28-V31 WeakPolarHBondContact O-CG2 3.32Å; A28-V31 PolarHBondContact O-N 2.82Å; V31-K35 PolarHBondContact O-N 2.98Å; V31-L36 HydrophobicContact CB-CB 4.5Å; V31-L36 PolarHBondContact O-N 2.85Å; V31-A37 HydrophobicContact CB-CB 4.41Å; V31-A37 HydrophobicContact CG2-CB 4.17Å; V31-A37 PolarHBondContact O-N 3.43Å; V31-L66 HydrophobicContact CG2-CD2 4.34Å; V31-L76 HydrophobicContact CB-CD1 3.88Å; V31-L76 HydrophobicContact CG1-CD1 3.29Å; V31-L79 HydrophobicContact CG1-CD2 3.69Å
32	L	95.9	Very high	94.7	Very high	74 Å²	74	52.9 Å²	52.9	39%	0.387	32%	0.316	S	S	.	.	H	α-helix	trans	-75.8	-44	175.5	-67.1	173.4	0	0	0	111.4	A28 A29 K30 E34 K35 A37 A40	A28-L32 WeakPolarHBondContact O-CB 3.38Å; A28-L32 WeakPolarHBondContact O-CG 3.28Å; A28-L32 PolarHBondContact O-N 2.88Å; A28-L32 VanDerWaalsContact O-N 3.12Å; A29-L32 PolarHBondContact O-N 3.38Å; K30-L32 VanDerWaalsContact C-N 3.25Å; K30-L32 PolarHBondContact O-N 3Å; L32-E34 VanDerWaalsContact C-N 3.32Å; L32-E34 PolarHBondContact O-N 2.95Å; L32-K35 WeakPolarHBondContact O-CA 3.49Å; L32-K35 PolarHBondContact O-N 3.18Å; L32-A37 WeakPolarHBondContact CD2-O 3.35Å; L32-A40 HydrophobicContact CD1-CB 4.5Å
33	A	95.8	Very high	94.9	Very high	82 Å²	82	53 Å²	53	68%	0.678	31%	0.306	S	S	*	.	H	α-helix	trans	-61.4	-40.5	178.6	0	0	0	0	0	112.1	A29 K30 K35	A29-A33 WeakPolarHBondContact O-CB 3.37Å; A29-A33 PolarHBondContact O-N 3.06Å; K30-A33 PolarHBondContact O-N 3.34Å; A33-K35 PolarHBondContact O-N 3.42Å
34	E	93.7	Very high	95.1	Very high	109 Å²	109	55.6 Å²	55.6	51%	0.509	32%	0.323	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79	1.3	175.1	-66.8	-179.2	-150	0	0	113.1	K30 L32 L36 L79	K30-E34 WeakPolarHBondContact O-CB 3.49Å; K30-E34 WeakPolarHBondContact O-CG 3.37Å; K30-E34 PolarHBondContact O-N 2.8Å; L32-E34 VanDerWaalsContact C-N 3.32Å; L32-E34 PolarHBondContact O-N 2.95Å; E34-L36 HydrophobicContact CB-CD1 4.1Å; E34-L36 HydrophobicContact CB-CG 3.8Å; E34-L36 PolarHBondContact O-N 2.63Å; E34-L36 VanDerWaalsContact O-N 3.15Å; E34-L36 WeakPolarHBondContact OE2-CD1 3.47Å; E34-L79 WeakPolarHBondContact OE1-CD1 3.31Å
35	K	94	Very high	95	Very high	169 Å²	169	58.8 Å²	58.8	74%	0.735	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.9	26.3	-177.5	-56.1	178.9	179.5	177.8	0	113.7	V31 L32 A33 A37	V31-K35 PolarHBondContact O-N 2.98Å; L32-K35 WeakPolarHBondContact O-CA 3.49Å; L32-K35 PolarHBondContact O-N 3.18Å; A33-K35 PolarHBondContact O-N 3.42Å; K35-A37 VanDerWaalsContact C-N 3.32Å
36	L	93.4	Very high	94.9	Very high	14 Å²	14	54.6 Å²	54.6	7%	0.073	34%	0.34	C	S	.	.	S	Bend	trans	-79.1	-17.4	176.8	-61.8	-178	0	0	0	112.7	V31 E34 T68 H72 A75 L79	V31-L36 HydrophobicContact CB-CB 4.5Å; V31-L36 PolarHBondContact O-N 2.85Å; E34-L36 HydrophobicContact CB-CD1 4.1Å; E34-L36 HydrophobicContact CB-CG 3.8Å; E34-L36 PolarHBondContact O-N 2.63Å; E34-L36 VanDerWaalsContact O-N 3.15Å; E34-L36 WeakPolarHBondContact OE2-CD1 3.47Å; L36-T68 WeakPolarHBondContact O-CB 3.22Å; L36-T68 PolarHBondContact O-OG1 3.26Å; L36-H72 HydrophobicContact CD2-CB 4.41Å; L36-H72 WeakPolarHBondContact O-CB 3.32Å; L36-A75 HydrophobicContact CD1-CB 4.22Å; L36-A75 HydrophobicContact CD2-CB 3.61Å; L36-L79 HydrophobicContact CD1-CB 4.38Å; L36-L79 HydrophobicContact CD1-CD2 3.97Å
37	A	94.3	Very high	94.8	Very high	6 Å²	6	55 Å²	55	5%	0.05	35%	0.345	C	S	.	.			trans	-138.1	150.2	170.1	0	0	0	0	0	109.2	V31 L32 K35	V31-A37 HydrophobicContact CB-CB 4.41Å; V31-A37 HydrophobicContact CG2-CB 4.17Å; V31-A37 PolarHBondContact O-N 3.43Å; L32-A37 WeakPolarHBondContact CD2-O 3.35Å; K35-A37 VanDerWaalsContact C-N 3.32Å
38	A	94.7	Very high	94.8	Very high	92 Å²	92	55.6 Å²	55.6	76%	0.76	35%	0.35	S	S	*	.	S	Bend	trans	-85	-24.4	174.8	0	0	0	0	0	111.9	K67	A38-K67 PolarHBondContact N-O 3.13Å
39	C	96.9	Very high	94.7	Very high	41 Å²	41	60.5 Å²	60.5	28%	0.277	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-158.7	143.7	-177.4	172.1	0	0	0	0	110	K67	C39-K67 HydrophobicContact CB-CB 4.5Å; C39-K67 PolarHBondContact O-N 3.48Å; C39-K67 WeakPolarHBondContact SG-CE 3.43Å
40	A	96.8	Very high	94.5	Very high	21 Å²	21	60.5 Å²	60.5	17%	0.174	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	121.6	173.5	0	0	0	0	0	109.2	A28 L32 L42 L66	A28-A40 HydrophobicContact CB-CB 3.89Å; L32-A40 HydrophobicContact CD1-CB 4.5Å; A40-L42 HydrophobicContact CB-CD1 4.15Å; A40-L66 HydrophobicContact CB-CD2 3.36Å
41	T	98.2	Very high	94.3	Very high	62 Å²	62	64.1 Å²	64.1	38%	0.38	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	129.1	171.7	-59.3	0	0	0	0	108.6	I43 M64 I65	T41-I43 HydrophobicContact CG2-CG1 4.28Å; T41-M64 CarbonylContact O-C 3.57Å; T41-M64 VanDerWaalsContact O-CA 3.29Å; T41-M64 WeakPolarHBondContact O-CA 3.44Å; T41-I65 PolarHBondContact N-O 2.77Å; T41-I65 PolarHBondContact O-N 2.67Å
42	L	97.4	Very high	94.2	Very high	40 Å²	40	68.3 Å²	68.3	21%	0.209	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	129.1	-178.9	-69.8	64.6	0	0	0	108.1	A24 Q25 A28 A40 V62 M64	A24-L42 HydrophobicContact CB-CD2 3.76Å; A24-L42 HydrophobicContact CB-CG 4.29Å; Q25-L42 HydrophobicContact CG-CD2 3.9Å; A28-L42 HydrophobicContact CB-CD1 3.92Å; A28-L42 HydrophobicContact CB-CD2 4.43Å; A40-L42 HydrophobicContact CB-CD1 4.15Å; L42-V62 HydrophobicContact CB-CG1 4.18Å; L42-M64 HydrophobicContact CD1-CE 4.39Å; L42-M64 HydrophobicContact CG-CE 4.35Å; L42-M64 HydrophobicContact CG-CG 4.37Å
43	I	96.9	Very high	94.1	Very high	78 Å²	78	72.8 Å²	72.8	40%	0.4	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	95.1	-178.2	-54.2	174.3	0	0	0	106.9	T41 Q63 I65	T41-I43 HydrophobicContact CG2-CG1 4.28Å; I43-Q63 HydrophobicContact CB-CB 4.23Å; I43-Q63 PolarHBondContact N-O 3Å; I43-Q63 PolarHBondContact O-N 2.86Å; I43-I65 HydrophobicContact CD1-CD1 3.89Å; I43-I65 HydrophobicContact CD1-CG1 4.43Å
44	P	94.7	Very high	94	Very high	66 Å²	66	72.2 Å²	72.2	43%	0.429	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.7	166.6	178.8	31.8	-35	0	0	0	111.8	E21 A46 V62	E21-P44 HydrophobicContact CG-CB 3.99Å; E21-P44 VanDerWaalsContact OE1-CB 3.28Å; E21-P44 WeakPolarHBondContact OE1-CB 3.28Å; P44-A46 VanDerWaalsContact C-N 3.31Å; P44-A46 PolarHBondContact O-N 2.95Å; P44-V62 HydrophobicContact CB-CG2 4.45Å
45	G	91.3	Very high	93.9	Very high	66 Å²	66	73.9 Å²	73.9	68%	0.68	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	77.8	12	177.7	0	0	0	0	0	114.5
46	A	91.9	Very high	93.8	Very high	25 Å²	25	70.7 Å²	70.7	21%	0.207	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.1	141.2	172.9	0	0	0	0	0	109.6	P44 Y60 E61 Q63	P44-A46 VanDerWaalsContact C-N 3.31Å; P44-A46 PolarHBondContact O-N 2.95Å; A46-Y60 WeakPolarHBondContact O-CA 3.34Å; A46-E61 HydrophobicContact CB-CG 4.02Å; A46-E61 WeakPolarHBondContact CB-O 3.44Å; A46-E61 PolarHBondContact N-O 3.25Å; A46-E61 PolarHBondContact O-N 3.48Å; A46-Q63 HydrophobicContact CB-CB 4.22Å
47	T	92.8	Very high	93.8	Very high	66 Å²	66	72.6 Å²	72.6	41%	0.405	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	120.9	177.3	-61.4	0	0	0	0	107.9	Q58 E59	T47-Q58 HydrophobicContact CG2-CG 3.36Å; T47-E59 CarbonylContact C-O 3.55Å; T47-E59 WeakPolarHBondContact CA-O 3.42Å
48	S	91.6	Very high	93.6	Very high	24 Å²	24	77.2 Å²	77.2	17%	0.168	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	137.6	171.2	60.1	0	0	0	0	110	Q58 E59 E61	S48-Q58 WeakPolarHBondContact O-CA 3.36Å; S48-E59 PolarHBondContact N-O 3.13Å; S48-E59 PolarHBondContact O-N 3.37Å; S48-E59 PolarHBondContact OG-O 3.48Å; S48-E61 WeakPolarHBondContact CB-OE1 3.48Å
49	L	94.1	Very high	93.4	Very high	108 Å²	108	75.4 Å²	75.4	57%	0.565	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.2	127.5	175.7	-69	171.4	0	0	0	108.5	L56 E57 Q58	L49-L56 HydrophobicContact CB-CD1 4.37Å; L49-E57 WeakPolarHBondContact CA-O 3.29Å; L49-Q58 HydrophobicContact CD2-CB 3.64Å; L49-Q58 HydrophobicContact CD2-CG 3.67Å
50	Y	90.6	Very high	93.1	Very high	59 Å²	59	81.3 Å²	81.3	23%	0.231	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.5	155.3	179.8	57.6	-91.8	0	0	0	111.4	W52 E57 E59 C91	Y50-W52 HydrophobicContact CD2-CB 4.21Å; Y50-W52 HydrophobicContact CE2-CB 4.03Å; Y50-E57 HydrophobicContact CD2-CB 4.15Å; Y50-E57 HydrophobicContact CE2-CB 3.84Å; Y50-E57 HydrophobicContact CE2-CG 4.28Å; Y50-E57 PolarHBondContact N-O 3.42Å; Y50-E57 VanDerWaalsContact N-O 3.1Å; Y50-E57 PolarHBondContact O-N 2.99Å; Y50-E59 HydrophobicContact CE1-CG 4.24Å; Y50-E59 PolarHBondContact OH-OE1 3.4Å; Y50-E59 PolarHBondContact OH-OE2 2.86Å; Y50-C91 PolarHBondContact OH-SG 3.41Å
51	Y	91.9	Very high	92.9	Very high	144 Å²	144	82.4 Å²	82.4	57%	0.565	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.8	126.9	172.3	-80.2	-84.5	0	0	0	110.8	K55 L56 I110	Y51-K55 CarbonylContact C-O 3.55Å; Y51-K55 VanDerWaalsContact CA-O 3.28Å; Y51-K55 WeakPolarHBondContact CA-O 3.18Å; Y51-L56 HydrophobicContact CD1-CB 4.47Å; Y51-L56 HydrophobicContact CD2-CD1 4.44Å; Y51-L56 HydrophobicContact CE1-CB 4.07Å; Y51-L56 HydrophobicContact CE2-CD1 4.21Å; Y51-I110 HydrophobicContact CE2-CD1 4.16Å
52	W	91.8	Very high	92.7	Very high	89 Å²	89	79.7 Å²	79.7	34%	0.337	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	127.9	171	-177.1	-100.4	0	0	0	109.5	Y50 G54 K55 E57 C91	Y50-W52 HydrophobicContact CD2-CB 4.21Å; Y50-W52 HydrophobicContact CE2-CB 4.03Å; W52-G54 PolarHBondContact O-N 2.96Å; W52-K55 PolarHBondContact N-O 2.94Å; W52-K55 PolarHBondContact O-N 3.37Å; W52-E57 HydrophobicContact CB-CG 3.76Å; W52-C91 HydrophobicContact CD2-CB 3.98Å; W52-C91 HydrophobicContact CE3-CB 4.14Å; W52-C91 HydrophobicContact CH2-CB 4.12Å; W52-C91 HydrophobicContact CZ2-CB 3.96Å; W52-C91 HydrophobicContact CZ3-CB 4.2Å
53	E	93.9	Very high	92.7	Very high	168 Å²	168	80.3 Å²	80.3	79%	0.785	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.6	38	-177.4	-66.4	-179.5	174.8	0	0	113.8	K55	E53-K55 VanDerWaalsContact C-N 3.26Å; E53-K55 PolarHBondContact O-N 2.78Å
54	G	92.9	Very high	92.7	Very high	70 Å²	70	76.6 Å²	76.6	72%	0.722	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	3.7	179.8	0	0	0	0	0	115.1	W52	W52-G54 PolarHBondContact O-N 2.96Å
55	K	91	Very high	92.8	Very high	143 Å²	143	75.9 Å²	75.9	62%	0.622	39%	0.391	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.6	140.5	177.1	-63.4	-179.8	-177.9	175.6	0	110.6	Y51 W52 E53 E57	Y51-K55 CarbonylContact C-O 3.55Å; Y51-K55 VanDerWaalsContact CA-O 3.28Å; Y51-K55 WeakPolarHBondContact CA-O 3.18Å; W52-K55 PolarHBondContact N-O 2.94Å; W52-K55 PolarHBondContact O-N 3.37Å; E53-K55 VanDerWaalsContact C-N 3.26Å; E53-K55 PolarHBondContact O-N 2.78Å; K55-E57 PolarHBondContact O-N 2.88Å
56	L	92.9	Very high	93	Very high	103 Å²	103	72.8 Å²	72.8	54%	0.539	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.6	113.7	170.2	-178.3	67.4	0	0	0	107.9	L49 Y51	L49-L56 HydrophobicContact CB-CD1 4.37Å; Y51-L56 HydrophobicContact CD1-CB 4.47Å; Y51-L56 HydrophobicContact CD2-CD1 4.44Å; Y51-L56 HydrophobicContact CE1-CB 4.07Å; Y51-L56 HydrophobicContact CE2-CD1 4.21Å
57	E	92.6	Very high	93.2	Very high	54 Å²	54	76.6 Å²	76.6	25%	0.252	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	149.2	174.8	-65.2	-64.4	145.7	0	0	109.8	L49 Y50 W52 K55	L49-E57 WeakPolarHBondContact CA-O 3.29Å; Y50-E57 HydrophobicContact CD2-CB 4.15Å; Y50-E57 HydrophobicContact CE2-CB 3.84Å; Y50-E57 HydrophobicContact CE2-CG 4.28Å; Y50-E57 PolarHBondContact N-O 3.42Å; Y50-E57 VanDerWaalsContact N-O 3.1Å; Y50-E57 PolarHBondContact O-N 2.99Å; W52-E57 HydrophobicContact CB-CG 3.76Å; K55-E57 PolarHBondContact O-N 2.88Å
58	Q	91.2	Very high	93.2	Very high	103 Å²	103	74 Å²	74	48%	0.481	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	126.7	176.8	-176.5	179.9	-16	0	0	109.1	T47 S48 L49 Y60	T47-Q58 HydrophobicContact CG2-CG 3.36Å; S48-Q58 WeakPolarHBondContact O-CA 3.36Å; L49-Q58 HydrophobicContact CD2-CB 3.64Å; L49-Q58 HydrophobicContact CD2-CG 3.67Å; Q58-Y60 PolarHBondContact NE2-OH 3.3Å
59	E	89.3	Confident	93.3	Very high	54 Å²	54	74 Å²	74	25%	0.252	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	138.1	176.1	-69.2	-174.3	151.3	0	0	111.3	T47 S48 Y50 S90	T47-E59 CarbonylContact C-O 3.55Å; T47-E59 WeakPolarHBondContact CA-O 3.42Å; S48-E59 PolarHBondContact N-O 3.13Å; S48-E59 PolarHBondContact O-N 3.37Å; S48-E59 PolarHBondContact OG-O 3.48Å; Y50-E59 HydrophobicContact CE1-CG 4.24Å; Y50-E59 PolarHBondContact OH-OE1 3.4Å; Y50-E59 PolarHBondContact OH-OE2 2.86Å; E59-S90 PolarHBondContact OE1-N 2.8Å
60	Y	91.1	Very high	93.2	Very high	165 Å²	165	72.2 Å²	72.2	65%	0.647	35%	0.347	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.1	135.9	173.2	-62.9	-77.8	0	0	0	109.8	A46 Q58	A46-Y60 WeakPolarHBondContact O-CA 3.34Å; Q58-Y60 PolarHBondContact NE2-OH 3.3Å
61	E	93.4	Very high	93.3	Very high	43 Å²	43	73.3 Å²	73.3	20%	0.201	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.2	171.7	-178.9	59.7	-178.7	177.7	0	0	111.2	T17 A18 A46 S48	T17-E61 WeakPolarHBondContact CB-OE2 3.25Å; T17-E61 HydrophobicContact CG2-CG 4.46Å; T17-E61 WeakPolarHBondContact CG2-OE2 3.2Å; T17-E61 PolarHBondContact OG1-OE2 3.09Å; A18-E61 CarbonylContact O-C 3.54Å; A18-E61 WeakPolarHBondContact O-CA 3.2Å; A18-E61 WeakPolarHBondContact O-CB 3.33Å; A46-E61 HydrophobicContact CB-CG 4.02Å; A46-E61 WeakPolarHBondContact CB-O 3.44Å; A46-E61 PolarHBondContact N-O 3.25Å; A46-E61 PolarHBondContact O-N 3.48Å; S48-E61 WeakPolarHBondContact CB-OE1 3.48Å
62	V	94.3	Very high	93.2	Very high	6 Å²	6	69.8 Å²	69.8	4%	0.036	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	118.4	171.7	-178.3	0	0	0	0	107.5	T17 A18 E21 A24 L42 P44	T17-V62 VanDerWaalsContact CA-O 3.32Å; T17-V62 WeakPolarHBondContact CA-O 3.41Å; A18-V62 PolarHBondContact N-O 3.48Å; A18-V62 PolarHBondContact O-N 3.42Å; E21-V62 HydrophobicContact CB-CG2 4.48Å; E21-V62 HydrophobicContact CG-CG2 3.81Å; A24-V62 HydrophobicContact CB-CB 3.94Å; A24-V62 HydrophobicContact CB-CG1 3.71Å; A24-V62 HydrophobicContact CB-CG2 4.37Å; L42-V62 HydrophobicContact CB-CG1 4.18Å; P44-V62 HydrophobicContact CB-CG2 4.45Å
63	Q	96.7	Very high	93.1	Very high	52 Å²	52	70.1 Å²	70.1	24%	0.243	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	127.9	173	177.1	64.4	70.1	0	0	109.1	C16 I43 A46	C16-Q63 PolarHBondContact O-NE2 3.48Å; I43-Q63 HydrophobicContact CB-CB 4.23Å; I43-Q63 PolarHBondContact N-O 3Å; I43-Q63 PolarHBondContact O-N 2.86Å; A46-Q63 HydrophobicContact CB-CB 4.22Å
64	M	96.8	Very high	92.7	Very high	0 Å²	0	69.8 Å²	69.8	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	135.8	176.8	-55.1	175.8	70.8	0	0	110.4	C16 A18 A24 L27 A28 T41 L42 L66	C16-M64 PolarHBondContact N-O 3.43Å; C16-M64 WeakPolarHBondContact O-CA 3.49Å; C16-M64 WeakPolarHBondContact O-CB 3.36Å; C16-M64 PolarHBondContact O-N 3.3Å; C16-M64 VanDerWaalsContact O-O 3.09Å; A18-M64 HydrophobicContact CB-SD 3.95Å; A24-M64 HydrophobicContact CB-CE 4.46Å; A24-M64 HydrophobicContact CB-CG 4.29Å; A24-M64 HydrophobicContact CB-SD 3.9Å; A24-M64 WeakPolarHBondContact O-CE 3.43Å; L27-M64 HydrophobicContact CB-CE 4.22Å; L27-M64 HydrophobicContact CD2-CE 4.24Å; L27-M64 HydrophobicContact CD2-SD 3.96Å; L27-M64 HydrophobicContact CG-CE 4.29Å; A28-M64 HydrophobicContact CB-CE 3.92Å; T41-M64 CarbonylContact O-C 3.57Å; T41-M64 VanDerWaalsContact O-CA 3.29Å; T41-M64 WeakPolarHBondContact O-CA 3.44Å; L42-M64 HydrophobicContact CD1-CE 4.39Å; L42-M64 HydrophobicContact CG-CE 4.35Å; L42-M64 HydrophobicContact CG-CG 4.37Å; M64-L66 HydrophobicContact CE-CD2 4.36Å
65	I	97.2	Very high	92.5	Very high	51 Å²	51	68.6 Å²	68.6	26%	0.262	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	112.8	174.5	-53.1	178.3	0	0	0	107.7	V13 L15 T41 I43	V13-I65 HydrophobicContact CG1-CG2 3.55Å; L15-I65 HydrophobicContact CD2-CB 4.45Å; L15-I65 HydrophobicContact CD2-CG1 3.92Å; L15-I65 HydrophobicContact CD2-CG2 4.27Å; T41-I65 PolarHBondContact N-O 2.77Å; T41-I65 PolarHBondContact O-N 2.67Å; I43-I65 HydrophobicContact CD1-CD1 3.89Å; I43-I65 HydrophobicContact CD1-CG1 4.43Å
66	L	95.7	Very high	92.4	Very high	2 Å²	2	62.3 Å²	62.3	1%	0.01	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	120.2	-177.9	-54.8	-178.6	0	0	0	109.4	V13 V14 V31 A40 M64 L76	V13-L66 WeakPolarHBondContact CA-O 3.46Å; V14-L66 HydrophobicContact CB-CB 4.29Å; V14-L66 PolarHBondContact N-O 3.3Å; V14-L66 PolarHBondContact O-N 3.25Å; V31-L66 HydrophobicContact CG2-CD2 4.34Å; A40-L66 HydrophobicContact CB-CD2 3.36Å; M64-L66 HydrophobicContact CE-CD2 4.36Å; L66-L76 HydrophobicContact CB-CD2 4.47Å; L66-L76 HydrophobicContact CD1-CD1 3.82Å; L66-L76 HydrophobicContact CD1-CD2 3.88Å; L66-L76 HydrophobicContact CD1-CG 4.3Å
67	K	95.2	Very high	92	Very high	105 Å²	105	60 Å²	60	46%	0.457	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	117.1	174.7	-69.1	175.4	-70.5	-179.8	0	108.6	A38 C39	A38-K67 PolarHBondContact N-O 3.13Å; C39-K67 HydrophobicContact CB-CB 4.5Å; C39-K67 PolarHBondContact O-N 3.48Å; C39-K67 WeakPolarHBondContact SG-CE 3.43Å
68	T	94	Very high	91.7	Very high	10 Å²	10	59.5 Å²	59.5	6%	0.061	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.5	-171.4	-176	-170.3	0	0	0	0	111.3	S11 V12 V14 L36 H72 L76	S11-T68 CarbonylContact C-O 3.55Å; S11-T68 WeakPolarHBondContact CA-O 3.41Å; V12-T68 HydrophobicContact CG2-CG2 3.58Å; V12-T68 PolarHBondContact N-O 2.74Å; V12-T68 PolarHBondContact O-N 3.05Å; V12-T68 VanDerWaalsContact O-O 3.06Å; V14-T68 HydrophobicContact CG2-CG2 4.04Å; L36-T68 WeakPolarHBondContact O-CB 3.22Å; L36-T68 PolarHBondContact O-OG1 3.26Å; T68-H72 WeakPolarHBondContact OG1-CB 3.47Å; T68-L76 HydrophobicContact CG2-CD2 4.26Å
69	T	93.6	Very high	91.2	Very high	24 Å²	24	55.5 Å²	55.5	15%	0.147	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	155.3	174.6	60.3	0	0	0	0	110.2	A10 S71 H72 Q73	A10-T69 CarbonylContact O-C 3.58Å; A10-T69 VanDerWaalsContact O-CA 3.31Å; A10-T69 WeakPolarHBondContact O-CA 3.43Å; T69-S71 PolarHBondContact O-N 3.01Å; T69-S71 VanDerWaalsContact O-N 3.14Å; T69-S71 PolarHBondContact OG1-OG 2.99Å; T69-H72 PolarHBondContact O-N 3.41Å; T69-H72 PolarHBondContact OG1-ND1 3.41Å; T69-Q73 PolarHBondContact O-N 2.94Å
70	V	92.2	Very high	90.4	Very high	72 Å²	72	57.9 Å²	57.9	44%	0.436	30%	0.298	S	S	.	.	H	α-helix	trans	-52.2	-37.8	177	174.4	0	0	0	0	111.4	A10 V12 H72 Q73	A10-V70 HydrophobicContact CB-CB 4.34Å; A10-V70 HydrophobicContact CB-CG2 3.55Å; A10-V70 WeakPolarHBondContact O-CG2 3.28Å; A10-V70 PolarHBondContact O-N 3.16Å; V12-V70 HydrophobicContact CG1-CG2 3.43Å; V12-V70 VanDerWaalsContact CG1-CG2 3.43Å; V70-H72 PolarHBondContact O-N 3.38Å; V70-Q73 WeakPolarHBondContact O-CB 3.35Å; V70-Q73 PolarHBondContact O-N 3.29Å
71	S	91.2	Very high	89.2	Confident	82 Å²	82	57.4 Å²	57.4	57%	0.573	30%	0.295	S	S	*	.	H	α-helix	trans	-59.3	-29.9	179.7	59.7	0	0	0	0	114.1	T69	T69-S71 PolarHBondContact O-N 3.01Å; T69-S71 VanDerWaalsContact O-N 3.14Å; T69-S71 PolarHBondContact OG1-OG 2.99Å
72	H	91.3	Very high	87.6	Confident	70 Å²	70	60.6 Å²	60.6	32%	0.324	31%	0.313	S	S	.	.	H	α-helix	trans	-97.9	-7.7	-178.4	-61.7	117.2	0	0	0	113.3	L36 T68 T69 V70 Q74 A75 L76	L36-H72 HydrophobicContact CD2-CB 4.41Å; L36-H72 WeakPolarHBondContact O-CB 3.32Å; T68-H72 WeakPolarHBondContact OG1-CB 3.47Å; T69-H72 PolarHBondContact O-N 3.41Å; T69-H72 PolarHBondContact OG1-ND1 3.41Å; V70-H72 PolarHBondContact O-N 3.38Å; H72-Q74 VanDerWaalsContact C-N 3.3Å; H72-Q74 PolarHBondContact O-N 3.29Å; H72-A75 PolarHBondContact O-N 3.33Å; H72-L76 WeakPolarHBondContact O-CB 3.41Å; H72-L76 PolarHBondContact O-N 2.88Å
73	Q	88	Confident	86	Confident	95 Å²	95	61.5 Å²	61.5	44%	0.444	32%	0.319	S	S	.	.	H	α-helix	trans	-57.6	-41.7	-175.3	-173.9	-176.7	4.6	0	0	112.6	T69 V70 S77	T69-Q73 PolarHBondContact O-N 2.94Å; V70-Q73 WeakPolarHBondContact O-CB 3.35Å; V70-Q73 PolarHBondContact O-N 3.29Å; Q73-S77 PolarHBondContact O-N 3.12Å
74	Q	86.9	Confident	83.9	Confident	162 Å²	162	70 Å²	70	76%	0.757	35%	0.349	S	S	*	.	H	α-helix	trans	-67.9	-45.6	179.9	-66.9	-176	6.7	0	0	111.7	H72 L76 S77 A78	H72-Q74 VanDerWaalsContact C-N 3.3Å; H72-Q74 PolarHBondContact O-N 3.29Å; Q74-L76 VanDerWaalsContact C-N 3.33Å; Q74-L76 PolarHBondContact O-N 3.5Å; Q74-S77 PolarHBondContact O-N 3.49Å; Q74-S77 PolarHBondContact O-OG 2.86Å; Q74-A78 PolarHBondContact O-N 2.9Å; Q74-A78 VanDerWaalsContact O-N 3.09Å
75	A	88.8	Confident	81.7	Confident	44 Å²	44	77.2 Å²	77.2	36%	0.364	38%	0.38	S	S	.	.	H	α-helix	trans	-61.9	-42	177.1	0	0	0	0	0	111.6	L36 H72 S77 A78 L79	L36-A75 HydrophobicContact CD1-CB 4.22Å; L36-A75 HydrophobicContact CD2-CB 3.61Å; H72-A75 PolarHBondContact O-N 3.33Å; A75-S77 VanDerWaalsContact C-N 3.35Å; A75-S77 PolarHBondContact O-N 3.44Å; A75-A78 WeakPolarHBondContact O-CB 3.49Å; A75-A78 PolarHBondContact O-N 3.09Å; A75-A78 VanDerWaalsContact O-N 3.09Å; A75-L79 PolarHBondContact O-N 3.41Å
76	L	88.3	Confident	79.4	Confident	11 Å²	11	79.4 Å²	79.4	6%	0.058	39%	0.392	C	S	.	.	H	α-helix	trans	-58.3	-45.3	174.9	-178	67.2	0	0	0	112.1	V14 V31 L66 T68 H72 Q74 A78 L79 R80	V14-L76 HydrophobicContact CB-CD2 3.94Å; V14-L76 HydrophobicContact CG1-CD2 3.94Å; V14-L76 HydrophobicContact CG2-CD2 3.91Å; V31-L76 HydrophobicContact CB-CD1 3.88Å; V31-L76 HydrophobicContact CG1-CD1 3.29Å; L66-L76 HydrophobicContact CB-CD2 4.47Å; L66-L76 HydrophobicContact CD1-CD1 3.82Å; L66-L76 HydrophobicContact CD1-CD2 3.88Å; L66-L76 HydrophobicContact CD1-CG 4.3Å; T68-L76 HydrophobicContact CG2-CD2 4.26Å; H72-L76 WeakPolarHBondContact O-CB 3.41Å; H72-L76 PolarHBondContact O-N 2.88Å; Q74-L76 VanDerWaalsContact C-N 3.33Å; Q74-L76 PolarHBondContact O-N 3.5Å; L76-A78 VanDerWaalsContact C-N 3.25Å; L76-A78 PolarHBondContact O-N 3.09Å; L76-L79 PolarHBondContact O-N 3.24Å; L76-R80 PolarHBondContact O-N 3.46Å
77	S	85	Confident	77	Confident	55 Å²	55	82.7 Å²	82.7	39%	0.385	41%	0.413	S	S	.	.	H	α-helix	trans	-65.6	-27.7	177.2	79.5	0	0	0	0	113.3	Q73 Q74 A75 R81	Q73-S77 PolarHBondContact O-N 3.12Å; Q74-S77 PolarHBondContact O-N 3.49Å; Q74-S77 PolarHBondContact O-OG 2.86Å; A75-S77 VanDerWaalsContact C-N 3.35Å; A75-S77 PolarHBondContact O-N 3.44Å; S77-R81 PolarHBondContact O-NE 2.91Å
78	A	85.2	Confident	74.5	Confident	43 Å²	43	83 Å²	83	36%	0.355	42%	0.424	S	S	.	.	H	α-helix	trans	-76.6	-42.4	177.1	0	0	0	0	0	111.8	Q74 A75 L76 R80 R81 N82	Q74-A78 PolarHBondContact O-N 2.9Å; Q74-A78 VanDerWaalsContact O-N 3.09Å; A75-A78 WeakPolarHBondContact O-CB 3.49Å; A75-A78 PolarHBondContact O-N 3.09Å; A75-A78 VanDerWaalsContact O-N 3.09Å; L76-A78 VanDerWaalsContact C-N 3.25Å; L76-A78 PolarHBondContact O-N 3.09Å; A78-R80 VanDerWaalsContact C-N 3.31Å; A78-R80 PolarHBondContact O-N 3.35Å; A78-R81 WeakPolarHBondContact O-CB 3.4Å; A78-R81 PolarHBondContact O-N 3.24Å; A78-R81 VanDerWaalsContact O-N 3.16Å; A78-N82 PolarHBondContact O-N 2.7Å
79	L	81	Confident	72.2	Confident	20 Å²	20	84.3 Å²	84.3	11%	0.105	43%	0.434	C	S	.	.	H	α-helix	trans	-60.1	-40.3	177.6	-176.9	63.6	0	0	0	112.1	K30 V31 E34 L36 A75 L76 R81 N82 T83	K30-L79 HydrophobicContact CB-CD2 3.95Å; V31-L79 HydrophobicContact CG1-CD2 3.69Å; E34-L79 WeakPolarHBondContact OE1-CD1 3.31Å; L36-L79 HydrophobicContact CD1-CB 4.38Å; L36-L79 HydrophobicContact CD1-CD2 3.97Å; A75-L79 PolarHBondContact O-N 3.41Å; L76-L79 PolarHBondContact O-N 3.24Å; L79-R81 VanDerWaalsContact C-N 3.27Å; L79-R81 PolarHBondContact O-N 3.07Å; L79-N82 PolarHBondContact O-N 2.91Å; L79-N82 VanDerWaalsContact O-N 3.13Å; L79-T83 PolarHBondContact O-N 2.97Å; L79-T83 PolarHBondContact O-OG1 3.42Å
80	R	72.1	Confident	70.3	Confident	103 Å²	103	85.9 Å²	85.9	39%	0.389	45%	0.446	S	S	.	.	H	α-helix	trans	-57.6	-39.5	176.6	-170.2	179.9	180	-160	1.2	112.3	T17 L76 A78 N82 T83	T17-R80 PolarHBondContact O-NH2 3.14Å; T17-R80 VanDerWaalsContact O-NH2 3.13Å; L76-R80 PolarHBondContact O-N 3.46Å; A78-R80 VanDerWaalsContact C-N 3.31Å; A78-R80 PolarHBondContact O-N 3.35Å; R80-N82 VanDerWaalsContact C-N 3.29Å; R80-N82 PolarHBondContact O-N 3.34Å; R80-T83 PolarHBondContact O-N 3.4Å
81	R	67.4	Low	68.1	Low	155 Å²	155	83.9 Å²	83.9	59%	0.585	43%	0.434	S	S	*	.	H	α-helix	trans	-67.4	-27.6	179.7	-75	-177.5	-76.4	142.5	-7.5	113.6	S77 A78 L79 F101	S77-R81 PolarHBondContact O-NE 2.91Å; A78-R81 WeakPolarHBondContact O-CB 3.4Å; A78-R81 PolarHBondContact O-N 3.24Å; A78-R81 VanDerWaalsContact O-N 3.16Å; L79-R81 VanDerWaalsContact C-N 3.27Å; L79-R81 PolarHBondContact O-N 3.07Å; R81-F101 HydrophobicContact CG-CD2 4.39Å; R81-F101 HydrophobicContact CG-CE1 4.22Å; R81-F101 HydrophobicContact CG-CE2 3.37Å; R81-F101 HydrophobicContact CG-CZ 3.25Å
82	N	59.3	Low	66.1	Low	110 Å²	110	87.1 Å²	87.1	59%	0.588	43%	0.434	S	S	*	.	H	α-helix	trans	-84.9	-13.6	-178.5	-166.2	19.5	0	0	0	112.9	A78 L79 R80 R84	A78-N82 PolarHBondContact O-N 2.7Å; L79-N82 PolarHBondContact O-N 2.91Å; L79-N82 VanDerWaalsContact O-N 3.13Å; R80-N82 VanDerWaalsContact C-N 3.29Å; R80-N82 PolarHBondContact O-N 3.34Å; N82-R84 VanDerWaalsContact C-N 3.34Å; N82-R84 PolarHBondContact O-N 3.01Å
83	T	60.1	Low	63.8	Low	25 Å²	25	93 Å²	93	15%	0.153	46%	0.459	C	S	.	.			trans	-76.2	88.8	-179.8	-54.1	0	0	0	0	109	L79 R80 K85	L79-T83 PolarHBondContact O-N 2.97Å; L79-T83 PolarHBondContact O-OG1 3.42Å; R80-T83 PolarHBondContact O-N 3.4Å; T83-K85 PolarHBondContact O-N 3.23Å
84	R	51.9	Low	61.7	Low	231 Å²	231	90.8 Å²	90.8	87%	0.872	46%	0.456	S	S	*	.			trans	-60.7	-5.8	-174.5	-84.3	-175.3	-74.8	-126.2	-3	116.1	N82 L86	N82-R84 VanDerWaalsContact C-N 3.34Å; N82-R84 PolarHBondContact O-N 3.01Å; R84-L86 PolarHBondContact O-N 3.15Å
85	K	51.6	Low	59.5	Low	151 Å²	151	89 Å²	89	66%	0.657	46%	0.462	S	S	*	.			trans	-92.7	77.9	174.9	-71.7	-175.1	179	-177.3	0	109.4	T83	T83-K85 PolarHBondContact O-N 3.23Å
86	L	47.8	Very low	56.7	Low	97 Å²	97	90.7 Å²	90.7	51%	0.508	48%	0.483	S	S	.	.			trans	-113	117.7	155.5	-152.7	73.6	0	0	0	105.6	P19 R84 T88	P19-L86 HydrophobicContact CG-CD1 4.05Å; R84-L86 PolarHBondContact O-N 3.15Å; L86-T88 PolarHBondContact O-N 2.86Å
87	P	46.5	Very low	54	Low	71 Å²	71	97.8 Å²	97.8	46%	0.461	52%	0.518	S	S	.	.			trans	-53.5	146	166.2	24.1	-26.4	0	0	0	107.1	P19 C89	P19-P87 HydrophobicContact CB-CG 3.28Å; P19-P87 HydrophobicContact CG-CG 3.85Å; P87-C89 VanDerWaalsContact C-N 3.33Å; P87-C89 PolarHBondContact O-N 2.55Å
88	T	42.2	Very low	51.3	Low	111 Å²	111	104.6 Å²	104.6	68%	0.681	54%	0.541	S	S	*	.			trans	-60.3	102	174.2	52.2	0	0	0	0	106.9	L86	L86-T88 PolarHBondContact O-N 2.86Å
89	C	46.9	Very low	48.7	Very low	39 Å²	39	109.8 Å²	109.8	26%	0.264	56%	0.559	S	S	.	*			trans	-49	146.8	159.1	57.4	0	0	0	0	107.5	P87 C91 R92	P87-C89 VanDerWaalsContact C-N 3.33Å; P87-C89 PolarHBondContact O-N 2.55Å; C89-C91 WeakPolarHBondContact CB-SG 3.43Å; C89-C91 PolarHBondContact O-N 3.2Å; C89-C91 PolarHBondContact SG-SG 3.27Å; C89-R92 WeakPolarHBondContact O-CB 3.45Å; C89-R92 PolarHBondContact O-N 2.97Å
90	S	52.3	Low	46	Very low	57 Å²	57	113.2 Å²	113.2	40%	0.399	59%	0.585	S	S	.	*	G	3₁₀ helix	trans	-55	-29.5	179.2	64.6	0	0	0	0	110.8	E59 R92 K93	E59-S90 PolarHBondContact OE1-N 2.8Å; S90-R92 PolarHBondContact O-N 2.93Å; S90-K93 PolarHBondContact O-N 2.85Å
91	C	46	Very low	44	Very low	29 Å²	29	114.6 Å²	114.6	20%	0.196	59%	0.594	C	S	.	*	G	3₁₀ helix	trans	-64.7	-11.8	174.3	23.5	0	0	0	0	115.2	Y50 W52 C89 K93 A94	Y50-C91 PolarHBondContact OH-SG 3.41Å; W52-C91 HydrophobicContact CD2-CB 3.98Å; W52-C91 HydrophobicContact CE3-CB 4.14Å; W52-C91 HydrophobicContact CH2-CB 4.12Å; W52-C91 HydrophobicContact CZ2-CB 3.96Å; W52-C91 HydrophobicContact CZ3-CB 4.2Å; C89-C91 WeakPolarHBondContact CB-SG 3.43Å; C89-C91 PolarHBondContact O-N 3.2Å; C89-C91 PolarHBondContact SG-SG 3.27Å; C91-K93 PolarHBondContact O-N 3.22Å; C91-A94 PolarHBondContact O-N 3.02Å
92	R	50.1	Low	42.2	Very low	151 Å²	151	112.4 Å²	112.4	57%	0.57	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-74.4	-8.4	176.9	-143	-179.5	-128.1	-100.5	4.4	113.9	C89 S90 A94	C89-R92 WeakPolarHBondContact O-CB 3.45Å; C89-R92 PolarHBondContact O-N 2.97Å; S90-R92 PolarHBondContact O-N 2.93Å; R92-A94 PolarHBondContact O-N 3.14Å; R92-A94 VanDerWaalsContact O-N 3.14Å
93	K	43.6	Very low	40.9	Very low	194 Å²	194	112 Å²	112	84%	0.843	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-67	-2.6	170.3	-73.4	-163.6	-178	-179.2	0	114	S90 C91 S95	S90-K93 PolarHBondContact O-N 2.85Å; C91-K93 PolarHBondContact O-N 3.22Å; K93-S95 VanDerWaalsContact C-N 3.25Å; K93-S95 PolarHBondContact O-N 2.8Å
94	A	43.9	Very low	39.6	Very low	48 Å²	48	120 Å²	120	40%	0.397	64%	0.643	S	S	.	*			trans	-71	80.5	169.1	0	0	0	0	0	111.4	C91 R92 G96	C91-A94 PolarHBondContact O-N 3.02Å; R92-A94 PolarHBondContact O-N 3.14Å; R92-A94 VanDerWaalsContact O-N 3.14Å; A94-G96 PolarHBondContact O-N 2.83Å
95	S	38.7	Very low	39	Very low	125 Å²	125	111.8 Å²	111.8	87%	0.874	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58	95.2	162.5	52.5	0	0	0	0	109.3	K93	K93-S95 VanDerWaalsContact C-N 3.25Å; K93-S95 PolarHBondContact O-N 2.8Å
96	G	30.5	Very low	38.5	Very low	79 Å²	79	115.3 Å²	115.3	81%	0.814	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	141.5	-4.6	168.9	0	0	0	0	0	117.7	A94	A94-G96 PolarHBondContact O-N 2.83Å
97	M	31.5	Very low	38.2	Very low	160 Å²	160	119.6 Å²	119.6	79%	0.788	65%	0.649	S	S	*	*			trans	-98.1	113.6	-173.7	-146.2	83.3	158.4	0	0	112.7	M99	M97-M99 PolarHBondContact O-N 2.84Å
98	K	28.8	Very low	37.8	Very low	198 Å²	198	121.9 Å²	121.9	86%	0.861	66%	0.662	S	S	*	*			trans	-58.2	119.2	173.2	-146.9	177	-172.6	-177.8	0	109.5	S100	K98-S100 PolarHBondContact O-N 2.82Å
99	M	30.5	Very low	37.7	Very low	151 Å²	151	120.3 Å²	120.3	74%	0.744	66%	0.66	S	S	*	*			trans	-66.7	87.5	-179.7	-72.1	-74.8	-71.5	0	0	111.2	M97	M97-M99 PolarHBondContact O-N 2.84Å
100	S	25.5	Very low	37.7	Very low	93 Å²	93	125.8 Å²	125.8	65%	0.65	69%	0.685	S	S	*	*			trans	-94	127.7	160	-71.3	0	0	0	0	108	K98 T102	K98-S100 PolarHBondContact O-N 2.82Å; S100-T102 PolarHBondContact O-N 3.07Å
101	F	30	Very low	36.9	Very low	131 Å²	131	129.8 Å²	129.8	58%	0.575	74%	0.736	S	S	*	*	S	Bend	trans	-69.1	28.7	-171.1	-113.8	-102.1	0	0	0	115.5	R81	R81-F101 HydrophobicContact CG-CD2 4.39Å; R81-F101 HydrophobicContact CG-CE1 4.22Å; R81-F101 HydrophobicContact CG-CE2 3.37Å; R81-F101 HydrophobicContact CG-CZ 3.25Å
102	T	27.6	Very low	36.5	Very low	109 Å²	109	134.9 Å²	134.9	67%	0.669	76%	0.763	S	S	*	*	S	Bend	trans	-105.9	117.9	167.4	-25.8	0	0	0	0	104.9	S100 K104	S100-T102 PolarHBondContact O-N 3.07Å; T102-K104 PolarHBondContact O-N 2.64Å
103	A	32.2	Very low	35.7	Very low	103 Å²	103	134 Å²	134	85%	0.851	77%	0.773	S	S	*	*			trans	-60.1	77.6	167.5	0	0	0	0	0	108.2	A105	A103-A105 PolarHBondContact O-N 3.12Å
104	K	34.5	Very low	35.3	Very low	191 Å²	191	130.7 Å²	130.7	83%	0.83	77%	0.769	S	S	*	*			trans	-83.6	60.1	173.3	-145.6	164.5	-171.3	174.6	0	105.5	T102 R106	T102-K104 PolarHBondContact O-N 2.64Å; K104-R106 PolarHBondContact O-N 2.97Å
105	A	39.3	Very low	34.8	Very low	60 Å²	60	135.5 Å²	135.5	50%	0.496	79%	0.791	S	S	.	*			trans	-50.7	115.9	153	0	0	0	0	0	104.2	A103 F107	A103-A105 PolarHBondContact O-N 3.12Å; A105-F107 HydrophobicContact CB-CD2 4.02Å; A105-F107 HydrophobicContact CB-CE2 4.4Å; A105-F107 PolarHBondContact O-N 2.87Å
106	R	40.4	Very low	34.6	Very low	224 Å²	224	136.2 Å²	136.2	85%	0.845	79%	0.785	S	S	*	*			trans	-62.4	85	161	-86.4	175.6	147	152.6	-7.5	104.6	K104 T108	K104-R106 PolarHBondContact O-N 2.97Å; R106-T108 PolarHBondContact O-N 2.85Å
107	F	41.5	Very low	34.8	Very low	188 Å²	188	140 Å²	140	83%	0.825	78%	0.783	S	S	*	*			trans	-62.6	90.3	158.8	-102.6	-94.3	0	0	0	104.2	A105 A109	A105-F107 HydrophobicContact CB-CD2 4.02Å; A105-F107 HydrophobicContact CB-CE2 4.4Å; A105-F107 PolarHBondContact O-N 2.87Å; F107-A109 VanDerWaalsContact C-N 3.28Å; F107-A109 PolarHBondContact O-N 2.81Å
108	T	37.7	Very low	35.1	Very low	119 Å²	119	138.6 Å²	138.6	73%	0.73	78%	0.783	S	S	*	*			trans	-59.2	106.5	154.7	-45.4	0	0	0	0	103.6	R106 I110	R106-T108 PolarHBondContact O-N 2.85Å; T108-I110 PolarHBondContact O-N 2.93Å; T108-I110 VanDerWaalsContact O-N 3.1Å
109	A	39.7	Very low	35.6	Very low	78 Å²	78	134 Å²	134	65%	0.645	78%	0.777	S	S	*	*			trans	-51.6	121.8	175.6	0	0	0	0	0	107.6	F107 G111	F107-A109 VanDerWaalsContact C-N 3.28Å; F107-A109 PolarHBondContact O-N 2.81Å; A109-G111 PolarHBondContact O-N 3.49Å
110	I	46.5	Very low	36	Very low	154 Å²	154	132.6 Å²	132.6	79%	0.79	78%	0.78	S	S	*	*			trans	-75.4	98.9	165.9	-59	171.2	0	0	0	104.1	Y51 T108	Y51-I110 HydrophobicContact CE2-CD1 4.16Å; T108-I110 PolarHBondContact O-N 2.93Å; T108-I110 VanDerWaalsContact O-N 3.1Å
111	G	36.8	Very low	36.9	Very low	141 Å²	141	136.2 Å²	136.2	100%	1.454	79%	0.792	S	S	*	*			trans	125.9	0	178.7	0	0	0	0	0	113.6	A109	A109-G111 PolarHBondContact O-N 3.49Å

Retrieved 111 of 111 residues in 17.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).