A0A077ZE84_TRITR Loading...

Mediator of rna polymerase ii transcription subun it

AlphaFold DB , UniProt , Accession A0A077ZE84, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 87 aa.

						>A0A077ZE84_TRITR|A0A077ZE84
MLEEVKMPEDGKVAWSEFQSALRSCLGPFRTSAGVPSVNAEEIKTSAEVAAHNFIEASRKLESYFTRKYHLFCAYLPEEALKEACFE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.5	Very low	69.6	Low	220 Å²	220	122.6 Å²	122.6	100%	1.084	61%	0.614	S	S	*	*				0	102.6	0	-80.2	165.5	30.2	0	0	106.5	E3	M1-E3 VanDerWaalsContact C-N 3.26Å; M1-E3 PolarHBondContact O-N 3.16Å
2	L	48	Very low	71.5	Confident	174 Å²	174	119.4 Å²	119.4	91%	0.911	59%	0.593	S	S	*	*			trans	-68.2	99.7	162.8	-73.8	162.1	0	0	0	104.3	E4	L2-E4 PolarHBondContact O-N 3.23Å
3	E	50.8	Low	73.1	Confident	156 Å²	156	116.3 Å²	116.3	73%	0.729	59%	0.585	S	S	*	*			trans	-48.7	140.9	165.9	-66.8	-177.4	157.9	0	0	107.1	M1 V5	M1-E3 VanDerWaalsContact C-N 3.26Å; M1-E3 PolarHBondContact O-N 3.16Å; E3-V5 VanDerWaalsContact C-N 3.28Å; E3-V5 WeakPolarHBondContact O-CG2 3.46Å; E3-V5 PolarHBondContact O-N 2.68Å
4	E	57	Low	74.4	Confident	179 Å²	179	108.7 Å²	108.7	84%	0.836	55%	0.549	S	S	*	.			trans	-49.1	100.5	172.8	-71.8	-178.4	162.7	0	0	107.7	L2 K6	L2-E4 PolarHBondContact O-N 3.23Å; E4-K6 PolarHBondContact O-N 2.6Å
5	V	63.3	Low	75.6	Confident	124 Å²	124	108.6 Å²	108.6	75%	0.752	54%	0.539	S	S	*	.			trans	-70.9	94.4	-176.7	178.5	0	0	0	0	104.5	E3 M7	E3-V5 VanDerWaalsContact C-N 3.28Å; E3-V5 WeakPolarHBondContact O-CG2 3.46Å; E3-V5 PolarHBondContact O-N 2.68Å; V5-M7 PolarHBondContact O-N 3.31Å
6	K	73.8	Confident	76.8	Confident	172 Å²	172	106.3 Å²	106.3	75%	0.748	54%	0.537	S	S	*	.	P	Polyproline II helix	trans	-56.5	119.7	174.8	-73.7	-176.5	179.6	175.9	0	106.3	E4 P8	E4-K6 PolarHBondContact O-N 2.6Å; K6-P8 WeakPolarHBondContact O-CD 3.38Å; K6-P8 VanDerWaalsContact O-N 3.17Å
7	M	79.4	Confident	77.7	Confident	54 Å²	54	104.6 Å²	104.6	27%	0.266	53%	0.526	S	S	.	.	P	Polyproline II helix	trans	-51.3	125.8	175.9	-176.9	167.3	54.1	0	0	108.4	V5 G11 K12 W15 Y64 F65	V5-M7 PolarHBondContact O-N 3.31Å; M7-G11 WeakPolarHBondContact CE-O 3.47Å; M7-K12 HydrophobicContact CB-CG 4.35Å; M7-K12 VanDerWaalsContact CE-CA 3.48Å; M7-K12 HydrophobicContact CE-CB 4.22Å; M7-K12 HydrophobicContact CE-CG 3.81Å; M7-K12 HydrophobicContact CG-CG 4.46Å; M7-K12 WeakPolarHBondContact O-CE 3.29Å; M7-W15 HydrophobicContact CE-CB 3.82Å; M7-W15 HydrophobicContact CE-CG 4.2Å; M7-Y64 HydrophobicContact CG-CE1 4.43Å; M7-Y64 HydrophobicContact SD-CE1 4.42Å; M7-F65 HydrophobicContact SD-CZ 4.27Å
8	P	87	Confident	78.7	Confident	60 Å²	60	100.8 Å²	100.8	39%	0.39	51%	0.506	S	S	.	.	P	Polyproline II helix	trans	-59	159.6	178.2	-17	24	0	0	0	111.5	K6 D10 G11 K12 Y64	K6-P8 WeakPolarHBondContact O-CD 3.38Å; K6-P8 VanDerWaalsContact O-N 3.17Å; P8-D10 VanDerWaalsContact C-N 3.25Å; P8-D10 WeakPolarHBondContact CB-OD1 3.37Å; P8-D10 PolarHBondContact O-N 3.1Å; P8-G11 WeakPolarHBondContact O-CA 3.44Å; P8-G11 PolarHBondContact O-N 2.94Å; P8-K12 PolarHBondContact O-N 2.98Å; P8-K12 VanDerWaalsContact O-N 3.08Å; P8-Y64 WeakPolarHBondContact CD-OH 3.38Å
9	E	89.6	Confident	79.5	Confident	123 Å²	123	98.8 Å²	98.8	58%	0.575	50%	0.495	S	S	*	.	H	α-helix	trans	-57.4	-36.1	-171.2	-74.2	-54.3	141	0	0	113.7	G11 K12 V13	E9-G11 VanDerWaalsContact C-N 3.32Å; E9-G11 PolarHBondContact O-N 3.31Å; E9-K12 PolarHBondContact O-N 3.17Å; E9-K12 IonicContact OE1-NZ 2.72Å; E9-K12 PolarHBondContact OE1-NZ 3.5Å; E9-V13 WeakPolarHBondContact O-CG2 3.29Å; E9-V13 PolarHBondContact O-N 3.04Å
10	D	89	Confident	80.2	Confident	87 Å²	87	97.4 Å²	97.4	47%	0.465	50%	0.495	S	S	.	.	H	α-helix	trans	-59.1	-41.3	174.7	57.8	-6.6	0	0	0	112.6	P8 A14 Y64	P8-D10 VanDerWaalsContact C-N 3.25Å; P8-D10 WeakPolarHBondContact CB-OD1 3.37Å; P8-D10 PolarHBondContact O-N 3.1Å; D10-A14 PolarHBondContact O-N 3.11Å; D10-Y64 HydrophobicContact CB-CE2 4.21Å; D10-Y64 WeakPolarHBondContact OD1-CE2 3.37Å; D10-Y64 PolarHBondContact OD1-OH 3.05Å; D10-Y64 WeakPolarHBondContact OD2-CE2 3.22Å
11	G	90.5	Very high	80.8	Confident	0 Å²	0	93.3 Å²	93.3	0%	0	48%	0.476	C	S	.	.	H	α-helix	trans	-68.7	-39.1	174.9	0	0	0	0	0	113	M7 P8 E9 V13 A14 W15 Y64	M7-G11 WeakPolarHBondContact CE-O 3.47Å; P8-G11 WeakPolarHBondContact O-CA 3.44Å; P8-G11 PolarHBondContact O-N 2.94Å; E9-G11 VanDerWaalsContact C-N 3.32Å; E9-G11 PolarHBondContact O-N 3.31Å; G11-V13 VanDerWaalsContact C-N 3.34Å; G11-V13 PolarHBondContact O-N 3.5Å; G11-A14 PolarHBondContact O-N 3.25Å; G11-W15 VanDerWaalsContact O-CB 3.25Å; G11-W15 WeakPolarHBondContact O-CB 3.29Å; G11-W15 PolarHBondContact O-N 3.07Å; G11-Y64 WeakPolarHBondContact CA-OH 3.28Å; G11-Y64 PolarHBondContact N-OH 3.02Å
12	K	92.1	Very high	83.4	Confident	84 Å²	84	85.6 Å²	85.6	37%	0.365	44%	0.439	S	S	.	.	H	α-helix	trans	-62.3	-42.1	175.2	-68.4	178.9	-173.9	167	0	111.9	M7 P8 E9 W15 S16	M7-K12 HydrophobicContact CB-CG 4.35Å; M7-K12 VanDerWaalsContact CE-CA 3.48Å; M7-K12 HydrophobicContact CE-CB 4.22Å; M7-K12 HydrophobicContact CE-CG 3.81Å; M7-K12 HydrophobicContact CG-CG 4.46Å; M7-K12 WeakPolarHBondContact O-CE 3.29Å; P8-K12 PolarHBondContact O-N 2.98Å; P8-K12 VanDerWaalsContact O-N 3.08Å; E9-K12 PolarHBondContact O-N 3.17Å; E9-K12 IonicContact OE1-NZ 2.72Å; E9-K12 PolarHBondContact OE1-NZ 3.5Å; K12-W15 PolarHBondContact O-N 3.29Å; K12-S16 VanDerWaalsContact O-CB 3.3Å; K12-S16 WeakPolarHBondContact O-CB 3.3Å; K12-S16 PolarHBondContact O-N 3.32Å
13	V	92.7	Very high	85.4	Confident	79 Å²	79	83.9 Å²	83.9	48%	0.479	42%	0.42	S	S	.	.	H	α-helix	trans	-62.7	-51.7	175.9	171.9	0	0	0	0	110.1	E9 G11 W15 S16 E17	E9-V13 WeakPolarHBondContact O-CG2 3.29Å; E9-V13 PolarHBondContact O-N 3.04Å; G11-V13 VanDerWaalsContact C-N 3.34Å; G11-V13 PolarHBondContact O-N 3.5Å; V13-W15 VanDerWaalsContact C-N 3.3Å; V13-W15 PolarHBondContact O-N 3.02Å; V13-S16 PolarHBondContact O-N 2.97Å; V13-E17 WeakPolarHBondContact O-CG 3.14Å; V13-E17 PolarHBondContact O-N 3.45Å
14	A	90.5	Very high	87.3	Confident	10 Å²	10	79.6 Å²	79.6	8%	0.083	41%	0.408	C	S	.	.	H	α-helix	trans	-58.3	-41.8	178.5	0	0	0	0	0	112.4	D10 G11 E17 F18 L61	D10-A14 PolarHBondContact O-N 3.11Å; G11-A14 PolarHBondContact O-N 3.25Å; A14-E17 PolarHBondContact O-N 2.93Å; A14-F18 WeakPolarHBondContact O-CB 3.33Å; A14-F18 PolarHBondContact O-N 3.09Å; A14-L61 HydrophobicContact CB-CD1 3.9Å
15	W	92.7	Very high	88.7	Confident	107 Å²	107	72.3 Å²	72.3	41%	0.405	38%	0.376	S	S	.	.	H	α-helix	trans	-65.6	-43.7	176.8	177.1	-115.7	0	0	0	112.6	M7 G11 K12 V13 F18 Q19 L61	M7-W15 HydrophobicContact CE-CB 3.82Å; M7-W15 HydrophobicContact CE-CG 4.2Å; G11-W15 VanDerWaalsContact O-CB 3.25Å; G11-W15 WeakPolarHBondContact O-CB 3.29Å; G11-W15 PolarHBondContact O-N 3.07Å; K12-W15 PolarHBondContact O-N 3.29Å; V13-W15 VanDerWaalsContact C-N 3.3Å; V13-W15 PolarHBondContact O-N 3.02Å; W15-F18 HydrophobicContact CE3-CD1 4Å; W15-F18 HydrophobicContact CH2-CD1 4.47Å; W15-F18 HydrophobicContact CH2-CE1 4.48Å; W15-F18 AromaticContact CZ3-CD1 3.75Å; W15-F18 HydrophobicContact CZ3-CD1 3.75Å; W15-F18 AromaticContact CZ3-CE1 3.97Å; W15-F18 HydrophobicContact CZ3-CE1 3.97Å; W15-F18 PolarHBondContact O-N 3.32Å; W15-Q19 HydrophobicContact CD2-CG 4.17Å; W15-Q19 VanDerWaalsContact CE2-NE2 3.25Å; W15-Q19 HydrophobicContact CZ2-CG 4.01Å; W15-Q19 VanDerWaalsContact NE1-NE2 3.12Å; W15-Q19 WeakPolarHBondContact O-CG 3.44Å; W15-Q19 PolarHBondContact O-N 2.92Å; W15-L61 HydrophobicContact CB-CD1 4.37Å; W15-L61 HydrophobicContact CE3-CD1 4.45Å; W15-L61 HydrophobicContact CE3-CD2 3.78Å; W15-L61 HydrophobicContact CZ3-CD2 4.1Å
16	S	94.2	Very high	89.9	Confident	72 Å²	72	69.4 Å²	69.4	50%	0.503	36%	0.356	S	S	.	.	H	α-helix	trans	-63.9	-41.8	176.9	-177.3	0	0	0	0	111.7	K12 V13 Q19 S20	K12-S16 VanDerWaalsContact O-CB 3.3Å; K12-S16 WeakPolarHBondContact O-CB 3.3Å; K12-S16 PolarHBondContact O-N 3.32Å; V13-S16 PolarHBondContact O-N 2.97Å; S16-Q19 PolarHBondContact O-N 3.39Å; S16-S20 WeakPolarHBondContact O-CB 3.3Å; S16-S20 PolarHBondContact O-N 2.84Å
17	E	93.6	Very high	90.3	Very high	77 Å²	77	62.5 Å²	62.5	36%	0.36	33%	0.334	S	S	.	.	H	α-helix	trans	-59.3	-48.2	173.5	-75.5	-174.5	-167.4	0	0	111.1	V13 A14 Q19 S20 A21 K60	V13-E17 WeakPolarHBondContact O-CG 3.14Å; V13-E17 PolarHBondContact O-N 3.45Å; A14-E17 PolarHBondContact O-N 2.93Å; E17-Q19 PolarHBondContact O-N 2.84Å; E17-S20 PolarHBondContact O-N 3.34Å; E17-A21 WeakPolarHBondContact O-CB 3.38Å; E17-A21 PolarHBondContact O-N 2.89Å; E17-K60 IonicContact OE1-NZ 3.6Å; E17-K60 WeakPolarHBondContact OE2-CD 3.36Å; E17-K60 IonicContact OE2-NZ 3.99Å; E17-K60 PolarHBondContact OE2-NZ 3.5Å
18	F	94.1	Very high	90.3	Very high	37 Å²	37	62.1 Å²	62.1	16%	0.162	34%	0.335	C	S	.	.	H	α-helix	trans	-57.6	-49.4	176.1	172.6	-93.3	0	0	0	112.1	A14 W15 S20 A21 L22 F54 S58 L61	A14-F18 WeakPolarHBondContact O-CB 3.33Å; A14-F18 PolarHBondContact O-N 3.09Å; W15-F18 HydrophobicContact CE3-CD1 4Å; W15-F18 HydrophobicContact CH2-CD1 4.47Å; W15-F18 HydrophobicContact CH2-CE1 4.48Å; W15-F18 AromaticContact CZ3-CD1 3.75Å; W15-F18 HydrophobicContact CZ3-CD1 3.75Å; W15-F18 AromaticContact CZ3-CE1 3.97Å; W15-F18 HydrophobicContact CZ3-CE1 3.97Å; W15-F18 PolarHBondContact O-N 3.32Å; F18-S20 VanDerWaalsContact C-N 3.32Å; F18-S20 PolarHBondContact O-N 2.91Å; F18-A21 PolarHBondContact O-N 3.39Å; F18-L22 HydrophobicContact CE1-CD2 4.07Å; F18-L22 HydrophobicContact CZ-CD2 4.37Å; F18-L22 VanDerWaalsContact O-CB 3.3Å; F18-L22 WeakPolarHBondContact O-CB 3.39Å; F18-L22 PolarHBondContact O-N 3.22Å; F18-F54 AromaticContact CD2-CE2 3.97Å; F18-F54 HydrophobicContact CD2-CE2 3.97Å; F18-F54 HydrophobicContact CE2-CD2 4.37Å; F18-F54 AromaticContact CE2-CE2 3.39Å; F18-F54 HydrophobicContact CE2-CE2 3.39Å; F18-F54 AromaticContact CE2-CZ 3.88Å; F18-F54 HydrophobicContact CE2-CZ 3.88Å; F18-F54 AromaticContact CZ-CE2 3.84Å; F18-F54 HydrophobicContact CZ-CE2 3.84Å; F18-F54 HydrophobicContact CZ-CZ 4.26Å; F18-S58 WeakPolarHBondContact CE2-OG 3.36Å; F18-L61 HydrophobicContact CB-CD2 3.85Å; F18-L61 HydrophobicContact CD1-CD2 4.04Å; F18-L61 HydrophobicContact CD2-CD2 3.91Å; F18-L61 HydrophobicContact CE2-CD2 4.48Å; F18-L61 HydrophobicContact CG-CD2 3.66Å
19	Q	94.1	Very high	89.8	Confident	63 Å²	63	67.2 Å²	67.2	29%	0.294	35%	0.352	S	S	.	.	H	α-helix	trans	-62.3	-40.3	179.4	-73.7	-170.3	-26.1	0	0	112.3	W15 S16 E17 R23	W15-Q19 HydrophobicContact CD2-CG 4.17Å; W15-Q19 VanDerWaalsContact CE2-NE2 3.25Å; W15-Q19 HydrophobicContact CZ2-CG 4.01Å; W15-Q19 VanDerWaalsContact NE1-NE2 3.12Å; W15-Q19 WeakPolarHBondContact O-CG 3.44Å; W15-Q19 PolarHBondContact O-N 2.92Å; S16-Q19 PolarHBondContact O-N 3.39Å; E17-Q19 PolarHBondContact O-N 2.84Å; Q19-R23 VanDerWaalsContact O-CG 3.29Å; Q19-R23 WeakPolarHBondContact O-CG 3.3Å; Q19-R23 PolarHBondContact O-N 3.4Å
20	S	94.3	Very high	88.9	Confident	70 Å²	70	69.2 Å²	69.2	49%	0.49	35%	0.354	S	S	.	.	H	α-helix	trans	-62.9	-48.2	176.4	-171.1	0	0	0	0	111	S16 E17 F18 L22 R23 S24	S16-S20 WeakPolarHBondContact O-CB 3.3Å; S16-S20 PolarHBondContact O-N 2.84Å; E17-S20 PolarHBondContact O-N 3.34Å; F18-S20 VanDerWaalsContact C-N 3.32Å; F18-S20 PolarHBondContact O-N 2.91Å; S20-L22 PolarHBondContact O-N 3.49Å; S20-R23 PolarHBondContact O-N 3.33Å; S20-S24 PolarHBondContact O-N 2.88Å
21	A	92.1	Very high	87.8	Confident	12 Å²	12	69.1 Å²	69.1	10%	0.099	36%	0.357	C	S	.	.	H	α-helix	trans	-64.9	-39.2	179.3	0	0	0	0	0	112.1	E17 F18 S24 C25 F54 A57	E17-A21 WeakPolarHBondContact O-CB 3.38Å; E17-A21 PolarHBondContact O-N 2.89Å; F18-A21 PolarHBondContact O-N 3.39Å; A21-S24 PolarHBondContact O-N 3.09Å; A21-C25 VanDerWaalsContact O-CB 3.29Å; A21-C25 WeakPolarHBondContact O-CB 3.3Å; A21-C25 PolarHBondContact O-N 3.46Å; A21-F54 HydrophobicContact CB-CB 4.27Å; A21-F54 HydrophobicContact CB-CD2 4.39Å; A21-A57 HydrophobicContact CB-CB 3.78Å
22	L	92.4	Very high	86.1	Confident	58 Å²	58	74.2 Å²	74.2	30%	0.304	39%	0.392	S	S	.	.	H	α-helix	trans	-61.9	-46.4	174.5	179.3	60.5	0	0	0	111.7	F18 S20 S24 C25 L26 F54	F18-L22 HydrophobicContact CE1-CD2 4.07Å; F18-L22 HydrophobicContact CZ-CD2 4.37Å; F18-L22 VanDerWaalsContact O-CB 3.3Å; F18-L22 WeakPolarHBondContact O-CB 3.39Å; F18-L22 PolarHBondContact O-N 3.22Å; S20-L22 PolarHBondContact O-N 3.49Å; L22-S24 VanDerWaalsContact C-N 3.31Å; L22-S24 PolarHBondContact O-N 2.9Å; L22-C25 PolarHBondContact O-N 2.83Å; L22-L26 HydrophobicContact CD1-CD1 3.73Å; L22-L26 HydrophobicContact CD1-CG 4Å; L22-L26 HydrophobicContact CG-CD1 3.98Å; L22-L26 WeakPolarHBondContact O-CB 3.49Å; L22-L26 VanDerWaalsContact O-CG 3.28Å; L22-L26 WeakPolarHBondContact O-CG 3.25Å; L22-L26 PolarHBondContact O-N 3.49Å; L22-F54 HydrophobicContact CB-CD2 4.04Å; L22-F54 HydrophobicContact CB-CE2 3.87Å; L22-F54 HydrophobicContact CD1-CD2 4.32Å; L22-F54 HydrophobicContact CD1-CE2 3.73Å; L22-F54 HydrophobicContact CD1-CZ 4.03Å; L22-F54 HydrophobicContact CG-CE2 4.33Å
23	R	91.2	Very high	84.3	Confident	137 Å²	137	75.8 Å²	75.8	52%	0.517	42%	0.421	S	S	.	.	H	α-helix	trans	-62.2	-40.7	176.9	-72.4	177.4	-147.7	140.4	5.6	111.6	Q19 S20 L26 G27	Q19-R23 VanDerWaalsContact O-CG 3.29Å; Q19-R23 WeakPolarHBondContact O-CG 3.3Å; Q19-R23 PolarHBondContact O-N 3.4Å; S20-R23 PolarHBondContact O-N 3.33Å; R23-L26 PolarHBondContact O-N 2.9Å; R23-G27 PolarHBondContact O-N 3.3Å
24	S	89.1	Confident	82.5	Confident	67 Å²	67	75.1 Å²	75.1	47%	0.469	43%	0.43	S	S	.	.	H	α-helix	trans	-63.5	-49.6	176.6	-171.7	0	0	0	0	111.2	S20 A21 L22 L26 G27 P28	S20-S24 PolarHBondContact O-N 2.88Å; A21-S24 PolarHBondContact O-N 3.09Å; L22-S24 VanDerWaalsContact C-N 3.31Å; L22-S24 PolarHBondContact O-N 2.9Å; S24-L26 VanDerWaalsContact C-N 3.29Å; S24-L26 PolarHBondContact O-N 3.29Å; S24-G27 PolarHBondContact O-N 2.94Å; S24-P28 WeakPolarHBondContact O-CD 3.32Å
25	C	88	Confident	80.9	Confident	26 Å²	26	78.7 Å²	78.7	18%	0.176	45%	0.45	C	S	.	.	H	α-helix	trans	-61.6	-35.4	178.5	-171.5	0	0	0	0	112.7	A21 L22 A50 F54	A21-C25 VanDerWaalsContact O-CB 3.29Å; A21-C25 WeakPolarHBondContact O-CB 3.3Å; A21-C25 PolarHBondContact O-N 3.46Å; L22-C25 PolarHBondContact O-N 2.83Å; C25-A50 HydrophobicContact CB-CB 4.44Å; C25-F54 HydrophobicContact CB-CB 3.98Å; C25-F54 HydrophobicContact CB-CG 4.33Å
26	L	86.5	Confident	79	Confident	63 Å²	63	78.7 Å²	78.7	33%	0.33	46%	0.464	S	S	.	.	H	α-helix	trans	-83.5	-13.9	176.5	-65.9	177.7	0	0	0	113.6	L22 R23 S24 F29 R30	L22-L26 HydrophobicContact CD1-CD1 3.73Å; L22-L26 HydrophobicContact CD1-CG 4Å; L22-L26 HydrophobicContact CG-CD1 3.98Å; L22-L26 WeakPolarHBondContact O-CB 3.49Å; L22-L26 VanDerWaalsContact O-CG 3.28Å; L22-L26 WeakPolarHBondContact O-CG 3.25Å; L22-L26 PolarHBondContact O-N 3.49Å; R23-L26 PolarHBondContact O-N 2.9Å; S24-L26 VanDerWaalsContact C-N 3.29Å; S24-L26 PolarHBondContact O-N 3.29Å; L26-F29 PolarHBondContact O-N 3.42Å; L26-R30 WeakPolarHBondContact O-CG 3.45Å; L26-R30 PolarHBondContact O-N 2.9Å
27	G	84	Confident	77.1	Confident	27 Å²	27	81.4 Å²	81.4	28%	0.278	48%	0.483	S	S	.	.	H	α-helix	trans	-51.5	-49.6	-176.4	0	0	0	0	0	113.9	R23 S24 F29 R30	R23-G27 PolarHBondContact O-N 3.3Å; S24-G27 PolarHBondContact O-N 2.94Å; G27-F29 PolarHBondContact O-N 3.41Å; G27-R30 PolarHBondContact O-N 3.48Å
28	P	77.7	Confident	75.6	Confident	46 Å²	46	80.8 Å²	80.8	30%	0.299	48%	0.484	S	S	.	.	H	α-helix	trans	-59.3	-25.4	177.1	-26.5	35.5	0	0	0	114.7	S24 T31 A47	S24-P28 WeakPolarHBondContact O-CD 3.32Å; P28-T31 PolarHBondContact O-OG1 2.82Å; P28-A47 HydrophobicContact CG-CB 4.47Å
29	F	76.5	Confident	74.7	Confident	167 Å²	167	83.1 Å²	83.1	73%	0.732	50%	0.498	S	S	*	.	H	α-helix	trans	-88.2	-12.1	178.7	-57.5	-77.9	0	0	0	113.2	L26 G27	L26-F29 PolarHBondContact O-N 3.42Å; G27-F29 PolarHBondContact O-N 3.41Å
30	R	72.6	Confident	74	Confident	165 Å²	165	83.7 Å²	83.7	62%	0.623	51%	0.514	S	S	*	.	H	α-helix	trans	-90.5	-15.4	-177.6	-71.2	176.7	179.5	-158.9	-1	113.3	L26 G27 S32	L26-R30 WeakPolarHBondContact O-CG 3.45Å; L26-R30 PolarHBondContact O-N 2.9Å; G27-R30 PolarHBondContact O-N 3.48Å; R30-S32 PolarHBondContact O-N 2.96Å; R30-S32 VanDerWaalsContact O-N 3.16Å
31	T	64.7	Low	73.4	Confident	85 Å²	85	85.3 Å²	85.3	52%	0.521	51%	0.514	S	S	.	.	S	Bend	trans	-76.6	104.9	179.9	46.7	0	0	0	0	110.1	P28 A33 V35	P28-T31 PolarHBondContact O-OG1 2.82Å; T31-A33 PolarHBondContact O-N 3.33Å; T31-V35 HydrophobicContact CG2-CG2 3.98Å
32	S	54.8	Low	72.8	Confident	107 Å²	107	90.5 Å²	90.5	75%	0.748	54%	0.536	S	S	*	.			trans	-63.4	114.5	172.6	61	0	0	0	0	110.5	R30 G34	R30-S32 PolarHBondContact O-N 2.96Å; R30-S32 VanDerWaalsContact O-N 3.16Å; S32-G34 PolarHBondContact O-N 3.24Å
33	A	55.3	Low	72.2	Confident	117 Å²	117	91.5 Å²	91.5	97%	0.967	54%	0.541	S	S	*	.	S	Bend	trans	38.7	18	147.4	0	0	0	0	0	121.3	T31	T31-A33 PolarHBondContact O-N 3.33Å
34	G	54.1	Low	71.8	Confident	64 Å²	64	90 Å²	90	66%	0.66	54%	0.538	S	S	*	.			trans	-153.3	12.6	-171.6	0	0	0	0	0	116.7	S32	S32-G34 PolarHBondContact O-N 3.24Å
35	V	56.9	Low	71.5	Confident	86 Å²	86	90.1 Å²	90.1	52%	0.521	54%	0.536	S	S	.	.			trans	-77.3	132	173.4	-170.8	0	0	0	0	108.1	T31 V38	T31-V35 HydrophobicContact CG2-CG2 3.98Å; V35-V38 HydrophobicContact CG1-CG2 3.93Å
36	P	52.9	Low	71.4	Confident	107 Å²	107	92.4 Å²	92.4	70%	0.695	55%	0.553	S	S	*	*			trans	-54	160.9	177.4	-19	29	0	0	0	110.5	V38	P36-V38 WeakPolarHBondContact O-CG2 3.47Å; P36-V38 PolarHBondContact O-N 3.49Å
37	S	55	Low	71.4	Confident	128 Å²	128	91 Å²	91	90%	0.895	55%	0.549	S	S	*	.			trans	-51.3	78.9	179.6	64.7	0	0	0	0	113
38	V	61.9	Low	71.7	Confident	64 Å²	64	94.2 Å²	94.2	39%	0.388	56%	0.558	S	S	.	*			trans	-68.1	133.1	163	-176.2	0	0	0	0	104.3	V35 P36 A40 E42 I43	V35-V38 HydrophobicContact CG1-CG2 3.93Å; P36-V38 WeakPolarHBondContact O-CG2 3.47Å; P36-V38 PolarHBondContact O-N 3.49Å; V38-A40 PolarHBondContact O-N 3.49Å; V38-A40 VanDerWaalsContact O-N 3.1Å; V38-E42 HydrophobicContact CG1-CB 4.3Å; V38-I43 HydrophobicContact CB-CD1 3.89Å; V38-I43 HydrophobicContact CB-CG1 3.99Å; V38-I43 HydrophobicContact CG1-CD1 4.21Å; V38-I43 HydrophobicContact CG1-CG1 3.73Å
39	N	74.3	Confident	72.4	Confident	86 Å²	86	95.8 Å²	95.8	46%	0.46	57%	0.566	S	S	.	*			trans	-48.9	122.4	176.9	179.2	-2.8	0	0	0	108.6	E41 E42 I43	N39-E41 PolarHBondContact O-N 3.23Å; N39-E41 VanDerWaalsContact O-N 3.09Å; N39-E41 WeakPolarHBondContact OD1-CB 3.47Å; N39-E41 PolarHBondContact OD1-N 3.42Å; N39-E41 VanDerWaalsContact OD1-N 3.07Å; N39-E42 HydrophobicContact CB-CB 4.1Å; N39-E42 HydrophobicContact CB-CG 3.85Å; N39-E42 WeakPolarHBondContact O-CB 3.39Å; N39-E42 PolarHBondContact O-N 3Å; N39-I43 PolarHBondContact O-N 3.37Å; N39-I43 VanDerWaalsContact O-N 3.11Å
40	A	79.6	Confident	73.1	Confident	75 Å²	75	88 Å²	88	62%	0.62	53%	0.533	S	S	*	.	H	α-helix	trans	-55.4	-31.3	-178.8	0	0	0	0	0	111.4	V38 I43 K44	V38-A40 PolarHBondContact O-N 3.49Å; V38-A40 VanDerWaalsContact O-N 3.1Å; A40-I43 PolarHBondContact O-N 3.11Å; A40-K44 WeakPolarHBondContact O-CB 3.38Å; A40-K44 PolarHBondContact O-N 2.92Å
41	E	81.1	Confident	74	Confident	104 Å²	104	81.9 Å²	81.9	49%	0.486	52%	0.517	S	S	.	.	H	α-helix	trans	-68.2	-40.5	176.1	-160.5	62.8	-161.6	0	0	112	N39 K44 T45	N39-E41 PolarHBondContact O-N 3.23Å; N39-E41 VanDerWaalsContact O-N 3.09Å; N39-E41 WeakPolarHBondContact OD1-CB 3.47Å; N39-E41 PolarHBondContact OD1-N 3.42Å; N39-E41 VanDerWaalsContact OD1-N 3.07Å; E41-K44 PolarHBondContact O-N 2.98Å; E41-T45 PolarHBondContact O-N 3.46Å; E41-T45 PolarHBondContact O-OG1 2.89Å; E41-T45 VanDerWaalsContact O-OG1 3.09Å
42	E	79.8	Confident	75.4	Confident	121 Å²	121	83.6 Å²	83.6	57%	0.565	52%	0.519	S	S	*	.	H	α-helix	trans	-64.6	-41.6	175.7	-72.3	171	-164.9	0	0	111.7	V38 N39 K44 S46	V38-E42 HydrophobicContact CG1-CB 4.3Å; N39-E42 HydrophobicContact CB-CB 4.1Å; N39-E42 HydrophobicContact CB-CG 3.85Å; N39-E42 WeakPolarHBondContact O-CB 3.39Å; N39-E42 PolarHBondContact O-N 3Å; E42-K44 VanDerWaalsContact C-N 3.33Å; E42-K44 PolarHBondContact O-N 2.93Å; E42-S46 VanDerWaalsContact O-CB 3.22Å; E42-S46 WeakPolarHBondContact O-CB 3.32Å; E42-S46 PolarHBondContact O-N 3.2Å
43	I	79.6	Confident	77.2	Confident	79 Å²	79	82.3 Å²	82.3	41%	0.405	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-45.9	174.3	-66.6	167.8	0	0	0	109.9	V38 N39 A40 S46 A47	V38-I43 HydrophobicContact CB-CD1 3.89Å; V38-I43 HydrophobicContact CB-CG1 3.99Å; V38-I43 HydrophobicContact CG1-CD1 4.21Å; V38-I43 HydrophobicContact CG1-CG1 3.73Å; N39-I43 PolarHBondContact O-N 3.37Å; N39-I43 VanDerWaalsContact O-N 3.11Å; A40-I43 PolarHBondContact O-N 3.11Å; I43-S46 PolarHBondContact O-N 3.33Å; I43-A47 VanDerWaalsContact O-CB 3.29Å; I43-A47 WeakPolarHBondContact O-CB 3.38Å; I43-A47 PolarHBondContact O-N 2.98Å
44	K	82.9	Confident	79.1	Confident	105 Å²	105	79.2 Å²	79.2	46%	0.457	47%	0.468	S	S	.	.	H	α-helix	trans	-61.7	-50.6	-179.5	-177	-175.1	168.4	-160.4	0	111.4	A40 E41 E42 S46 A47 E48	A40-K44 WeakPolarHBondContact O-CB 3.38Å; A40-K44 PolarHBondContact O-N 2.92Å; E41-K44 PolarHBondContact O-N 2.98Å; E42-K44 VanDerWaalsContact C-N 3.33Å; E42-K44 PolarHBondContact O-N 2.93Å; K44-S46 VanDerWaalsContact C-N 3.31Å; K44-S46 PolarHBondContact O-N 3.49Å; K44-A47 PolarHBondContact O-N 3.48Å; K44-E48 WeakPolarHBondContact CE-OE1 2.86Å; K44-E48 WeakPolarHBondContact O-CG 3.34Å; K44-E48 PolarHBondContact O-N 3.42Å
45	T	84.1	Confident	81.1	Confident	71 Å²	71	79.7 Å²	79.7	44%	0.436	46%	0.455	S	S	.	.	H	α-helix	trans	-59.7	-42.6	176.3	-56	0	0	0	0	111.4	E41 A47 E48 V49	E41-T45 PolarHBondContact O-N 3.46Å; E41-T45 PolarHBondContact O-OG1 2.89Å; E41-T45 VanDerWaalsContact O-OG1 3.09Å; T45-A47 PolarHBondContact O-N 2.9Å; T45-E48 PolarHBondContact O-N 3.35Å; T45-V49 VanDerWaalsContact O-CG2 3.3Å; T45-V49 WeakPolarHBondContact O-CG2 3.19Å; T45-V49 PolarHBondContact O-N 2.74Å
46	S	85.9	Confident	83	Confident	74 Å²	74	81 Å²	81	52%	0.517	46%	0.456	S	S	.	.	H	α-helix	trans	-63.1	-42.3	177.3	-176.6	0	0	0	0	112.2	E42 I43 K44 V49 A50	E42-S46 VanDerWaalsContact O-CB 3.22Å; E42-S46 WeakPolarHBondContact O-CB 3.32Å; E42-S46 PolarHBondContact O-N 3.2Å; I43-S46 PolarHBondContact O-N 3.33Å; K44-S46 VanDerWaalsContact C-N 3.31Å; K44-S46 PolarHBondContact O-N 3.49Å; S46-V49 PolarHBondContact O-N 3.33Å; S46-A50 VanDerWaalsContact O-CB 3.3Å; S46-A50 WeakPolarHBondContact O-CB 3.38Å; S46-A50 PolarHBondContact O-N 2.86Å
47	A	86.3	Confident	84.9	Confident	32 Å²	32	76.2 Å²	76.2	26%	0.264	43%	0.425	S	S	.	.	H	α-helix	trans	-66.2	-41.1	177.1	0	0	0	0	0	112.1	P28 I43 K44 T45 A50 A51	P28-A47 HydrophobicContact CG-CB 4.47Å; I43-A47 VanDerWaalsContact O-CB 3.29Å; I43-A47 WeakPolarHBondContact O-CB 3.38Å; I43-A47 PolarHBondContact O-N 2.98Å; K44-A47 PolarHBondContact O-N 3.48Å; T45-A47 PolarHBondContact O-N 2.9Å; A47-A50 PolarHBondContact O-N 3.28Å; A47-A51 WeakPolarHBondContact O-CB 3.28Å; A47-A51 PolarHBondContact O-N 2.89Å
48	E	90.1	Very high	86.9	Confident	96 Å²	96	71.7 Å²	71.7	45%	0.449	39%	0.394	S	S	.	.	H	α-helix	trans	-61.5	-48.5	175.1	-75	174.1	-177.9	0	0	111.2	K44 T45 A50 A51 H52	K44-E48 WeakPolarHBondContact CE-OE1 2.86Å; K44-E48 WeakPolarHBondContact O-CG 3.34Å; K44-E48 PolarHBondContact O-N 3.42Å; T45-E48 PolarHBondContact O-N 3.35Å; E48-A50 VanDerWaalsContact C-N 3.32Å; E48-A50 PolarHBondContact O-N 2.97Å; E48-A51 PolarHBondContact O-N 2.98Å; E48-H52 PolarHBondContact O-CD2 3.02Å; E48-H52 PolarHBondContact O-N 3.4Å
49	V	91.1	Very high	88.5	Confident	78 Å²	78	76.5 Å²	76.5	47%	0.473	41%	0.405	S	S	.	.	H	α-helix	trans	-60.3	-43.3	175.8	172.1	0	0	0	0	111	T45 S46 A51 H52 N53	T45-V49 VanDerWaalsContact O-CG2 3.3Å; T45-V49 WeakPolarHBondContact O-CG2 3.19Å; T45-V49 PolarHBondContact O-N 2.74Å; S46-V49 PolarHBondContact O-N 3.33Å; V49-A51 PolarHBondContact O-N 3.18Å; V49-H52 PolarHBondContact O-N 3.5Å; V49-N53 VanDerWaalsContact O-CG 3.26Å; V49-N53 PolarHBondContact O-N 3.41Å; V49-N53 PolarHBondContact O-ND2 3.3Å
50	A	91.2	Very high	89.4	Confident	5 Å²	5	77.6 Å²	77.6	4%	0.041	41%	0.405	C	S	.	.	H	α-helix	trans	-64.8	-38.4	177.7	0	0	0	0	0	112.5	C25 S46 A47 E48 N53 F54	C25-A50 HydrophobicContact CB-CB 4.44Å; S46-A50 VanDerWaalsContact O-CB 3.3Å; S46-A50 WeakPolarHBondContact O-CB 3.38Å; S46-A50 PolarHBondContact O-N 2.86Å; A47-A50 PolarHBondContact O-N 3.28Å; E48-A50 VanDerWaalsContact C-N 3.32Å; E48-A50 PolarHBondContact O-N 2.97Å; A50-N53 PolarHBondContact O-N 3.49Å; A50-F54 WeakPolarHBondContact O-CB 3.33Å; A50-F54 PolarHBondContact O-N 3.09Å
51	A	91.9	Very high	90	Very high	35 Å²	35	74.8 Å²	74.8	29%	0.289	38%	0.38	S	S	.	.	H	α-helix	trans	-65.2	-43.9	175.2	0	0	0	0	0	111.7	A47 E48 V49 F54 I55	A47-A51 WeakPolarHBondContact O-CB 3.28Å; A47-A51 PolarHBondContact O-N 2.89Å; E48-A51 PolarHBondContact O-N 2.98Å; V49-A51 PolarHBondContact O-N 3.18Å; A51-F54 PolarHBondContact O-N 3.26Å; A51-I55 WeakPolarHBondContact O-CG1 3.33Å; A51-I55 PolarHBondContact O-N 2.98Å
52	H	94.2	Very high	90.6	Very high	122 Å²	122	75.8 Å²	75.8	57%	0.565	39%	0.385	S	S	*	.	H	α-helix	trans	-59.6	-48.3	174.8	-78.4	-62.4	0	0	0	111.9	E48 V49 F54 I55 E56	E48-H52 PolarHBondContact O-CD2 3.02Å; E48-H52 PolarHBondContact O-N 3.4Å; V49-H52 PolarHBondContact O-N 3.5Å; H52-F54 VanDerWaalsContact C-N 3.27Å; H52-F54 PolarHBondContact O-N 3.1Å; H52-I55 PolarHBondContact O-N 3.46Å; H52-E56 PolarHBondContact O-N 2.85Å
53	N	93.7	Very high	91.3	Very high	79 Å²	79	73.9 Å²	73.9	42%	0.422	39%	0.385	S	S	.	.	H	α-helix	trans	-59.5	-38.5	176.5	-69.8	-23.8	0	0	0	112.1	V49 A50 E56 A57	V49-N53 VanDerWaalsContact O-CG 3.26Å; V49-N53 PolarHBondContact O-N 3.41Å; V49-N53 PolarHBondContact O-ND2 3.3Å; A50-N53 PolarHBondContact O-N 3.49Å; N53-E56 PolarHBondContact O-N 3.5Å; N53-A57 WeakPolarHBondContact O-CB 3.49Å; N53-A57 PolarHBondContact O-N 2.68Å
54	F	94.5	Very high	91.8	Very high	52 Å²	52	71.3 Å²	71.3	23%	0.228	37%	0.37	C	S	.	.	H	α-helix	trans	-65.8	-42.8	175.9	174.7	-111.4	0	0	0	112.8	F18 A21 L22 C25 A50 A51 H52 E56 A57 S58	F18-F54 AromaticContact CD2-CE2 3.97Å; F18-F54 HydrophobicContact CD2-CE2 3.97Å; F18-F54 HydrophobicContact CE2-CD2 4.37Å; F18-F54 AromaticContact CE2-CE2 3.39Å; F18-F54 HydrophobicContact CE2-CE2 3.39Å; F18-F54 AromaticContact CE2-CZ 3.88Å; F18-F54 HydrophobicContact CE2-CZ 3.88Å; F18-F54 AromaticContact CZ-CE2 3.84Å; F18-F54 HydrophobicContact CZ-CE2 3.84Å; F18-F54 HydrophobicContact CZ-CZ 4.26Å; A21-F54 HydrophobicContact CB-CB 4.27Å; A21-F54 HydrophobicContact CB-CD2 4.39Å; L22-F54 HydrophobicContact CB-CD2 4.04Å; L22-F54 HydrophobicContact CB-CE2 3.87Å; L22-F54 HydrophobicContact CD1-CD2 4.32Å; L22-F54 HydrophobicContact CD1-CE2 3.73Å; L22-F54 HydrophobicContact CD1-CZ 4.03Å; L22-F54 HydrophobicContact CG-CE2 4.33Å; C25-F54 HydrophobicContact CB-CB 3.98Å; C25-F54 HydrophobicContact CB-CG 4.33Å; A50-F54 WeakPolarHBondContact O-CB 3.33Å; A50-F54 PolarHBondContact O-N 3.09Å; A51-F54 PolarHBondContact O-N 3.26Å; H52-F54 VanDerWaalsContact C-N 3.27Å; H52-F54 PolarHBondContact O-N 3.1Å; F54-E56 VanDerWaalsContact C-N 3.35Å; F54-E56 PolarHBondContact O-N 2.72Å; F54-A57 PolarHBondContact O-N 3.22Å; F54-S58 WeakPolarHBondContact O-CB 3.34Å; F54-S58 PolarHBondContact O-N 3.08Å; F54-S58 PolarHBondContact O-OG 3.4Å
55	I	95.7	Very high	92.2	Very high	75 Å²	75	71 Å²	71	39%	0.385	37%	0.369	S	S	.	.	H	α-helix	trans	-61.6	-44.8	175.9	-69	163.7	0	0	0	110.5	A51 H52 S58 R59	A51-I55 WeakPolarHBondContact O-CG1 3.33Å; A51-I55 PolarHBondContact O-N 2.98Å; H52-I55 PolarHBondContact O-N 3.46Å; I55-S58 PolarHBondContact O-N 3.39Å; I55-R59 WeakPolarHBondContact O-CG 3.41Å; I55-R59 PolarHBondContact O-N 3.19Å
56	E	96.4	Very high	92.6	Very high	113 Å²	113	70.5 Å²	70.5	53%	0.528	37%	0.366	S	S	.	.	H	α-helix	trans	-63	-46	177.7	-71.2	-173.1	167.6	0	0	112.3	H52 N53 F54 S58 R59 K60	H52-E56 PolarHBondContact O-N 2.85Å; N53-E56 PolarHBondContact O-N 3.5Å; F54-E56 VanDerWaalsContact C-N 3.35Å; F54-E56 PolarHBondContact O-N 2.72Å; E56-S58 VanDerWaalsContact C-N 3.3Å; E56-S58 PolarHBondContact O-N 3.48Å; E56-R59 PolarHBondContact O-N 2.96Å; E56-K60 WeakPolarHBondContact O-CG 3.36Å; E56-K60 PolarHBondContact O-N 3.01Å
57	A	94.7	Very high	92.8	Very high	7 Å²	7	75.8 Å²	75.8	6%	0.058	37%	0.374	C	S	.	.	H	α-helix	trans	-63.1	-37.7	176.9	0	0	0	0	0	112.1	A21 N53 F54 K60 L61	A21-A57 HydrophobicContact CB-CB 3.78Å; N53-A57 WeakPolarHBondContact O-CB 3.49Å; N53-A57 PolarHBondContact O-N 2.68Å; F54-A57 PolarHBondContact O-N 3.22Å; A57-K60 PolarHBondContact O-N 2.74Å; A57-L61 WeakPolarHBondContact O-CB 3.38Å; A57-L61 PolarHBondContact O-N 3.05Å
58	S	95.4	Very high	92.9	Very high	33 Å²	33	78 Å²	78	23%	0.231	38%	0.378	C	S	.	.	H	α-helix	trans	-63	-45.1	175.2	-58.7	0	0	0	0	111.7	F18 F54 I55 E56 K60 L61 E62	F18-S58 WeakPolarHBondContact CE2-OG 3.36Å; F54-S58 WeakPolarHBondContact O-CB 3.34Å; F54-S58 PolarHBondContact O-N 3.08Å; F54-S58 PolarHBondContact O-OG 3.4Å; I55-S58 PolarHBondContact O-N 3.39Å; E56-S58 VanDerWaalsContact C-N 3.3Å; E56-S58 PolarHBondContact O-N 3.48Å; S58-K60 PolarHBondContact O-N 2.97Å; S58-L61 PolarHBondContact O-N 3.23Å; S58-E62 WeakPolarHBondContact O-CB 3.47Å; S58-E62 PolarHBondContact O-N 3.45Å
59	R	95.1	Very high	92.8	Very high	165 Å²	165	78.2 Å²	78.2	62%	0.623	38%	0.375	S	S	*	.	H	α-helix	trans	-62.9	-40	176.7	-74	173.3	175.2	172.6	-0.7	112.6	I55 E56 L61 S63	I55-R59 WeakPolarHBondContact O-CG 3.41Å; I55-R59 PolarHBondContact O-N 3.19Å; E56-R59 PolarHBondContact O-N 2.96Å; R59-L61 VanDerWaalsContact C-N 3.35Å; R59-S63 VanDerWaalsContact O-CB 3.28Å; R59-S63 WeakPolarHBondContact O-CB 3.39Å; R59-S63 PolarHBondContact O-N 3.45Å
60	K	93.4	Very high	92.8	Very high	108 Å²	108	80.2 Å²	80.2	47%	0.47	38%	0.379	S	S	.	.	H	α-helix	trans	-61.9	-44.8	174.7	-71.8	179.7	-173.6	-178.8	0	111.2	E17 E56 A57 S58 S63 Y64	E17-K60 IonicContact OE1-NZ 3.6Å; E17-K60 WeakPolarHBondContact OE2-CD 3.36Å; E17-K60 IonicContact OE2-NZ 3.99Å; E17-K60 PolarHBondContact OE2-NZ 3.5Å; E56-K60 WeakPolarHBondContact O-CG 3.36Å; E56-K60 PolarHBondContact O-N 3.01Å; A57-K60 PolarHBondContact O-N 2.74Å; S58-K60 PolarHBondContact O-N 2.97Å; K60-S63 PolarHBondContact O-N 3.05Å; K60-Y64 PolarHBondContact O-N 2.79Å
61	L	93.1	Very high	92.7	Very high	16 Å²	16	83.6 Å²	83.6	8%	0.084	40%	0.396	C	S	.	.	H	α-helix	trans	-66.2	-43.8	179.6	-171.1	65.6	0	0	0	112	A14 W15 F18 A57 S58 R59 Y64 F65	A14-L61 HydrophobicContact CB-CD1 3.9Å; W15-L61 HydrophobicContact CB-CD1 4.37Å; W15-L61 HydrophobicContact CE3-CD1 4.45Å; W15-L61 HydrophobicContact CE3-CD2 3.78Å; W15-L61 HydrophobicContact CZ3-CD2 4.1Å; F18-L61 HydrophobicContact CB-CD2 3.85Å; F18-L61 HydrophobicContact CD1-CD2 4.04Å; F18-L61 HydrophobicContact CD2-CD2 3.91Å; F18-L61 HydrophobicContact CE2-CD2 4.48Å; F18-L61 HydrophobicContact CG-CD2 3.66Å; A57-L61 WeakPolarHBondContact O-CB 3.38Å; A57-L61 PolarHBondContact O-N 3.05Å; S58-L61 PolarHBondContact O-N 3.23Å; R59-L61 VanDerWaalsContact C-N 3.35Å; L61-Y64 WeakPolarHBondContact O-CB 3.4Å; L61-Y64 PolarHBondContact O-N 3.02Å; L61-F65 HydrophobicContact CD1-CD2 3.98Å; L61-F65 HydrophobicContact CD1-CE2 3.48Å; L61-F65 VanDerWaalsContact CD1-CE2 3.48Å; L61-F65 HydrophobicContact CD1-CZ 4.42Å; L61-F65 HydrophobicContact CD2-CE2 4.31Å; L61-F65 HydrophobicContact CG-CD2 3.9Å; L61-F65 HydrophobicContact CG-CE2 3.74Å; L61-F65 WeakPolarHBondContact O-CD2 3.4Å; L61-F65 PolarHBondContact O-N 2.83Å
62	E	94	Very high	92.5	Very high	126 Å²	126	84.7 Å²	84.7	59%	0.589	40%	0.395	S	S	*	.	H	α-helix	trans	-58.8	-49.8	173.7	-178.4	-175.8	-168.8	0	0	110.9	S58 Y64 F65 T66	S58-E62 WeakPolarHBondContact O-CB 3.47Å; S58-E62 PolarHBondContact O-N 3.45Å; E62-Y64 PolarHBondContact O-N 3.29Å; E62-F65 PolarHBondContact O-N 3.1Å; E62-T66 VanDerWaalsContact O-CB 3.3Å; E62-T66 WeakPolarHBondContact O-CB 3.44Å; E62-T66 PolarHBondContact O-N 3.06Å; E62-T66 PolarHBondContact O-OG1 3.03Å
63	S	93.2	Very high	92.2	Very high	81 Å²	81	80.7 Å²	80.7	57%	0.566	38%	0.38	S	S	*	.	H	α-helix	trans	-56.6	-40.4	177.8	-176	0	0	0	0	112.2	R59 K60 R67	R59-S63 VanDerWaalsContact O-CB 3.28Å; R59-S63 WeakPolarHBondContact O-CB 3.39Å; R59-S63 PolarHBondContact O-N 3.45Å; K60-S63 PolarHBondContact O-N 3.05Å; S63-R67 WeakPolarHBondContact O-CB 3.48Å; S63-R67 PolarHBondContact O-N 3.26Å; S63-R67 VanDerWaalsContact O-N 3.1Å
64	Y	91.6	Very high	92	Very high	25 Å²	25	80.6 Å²	80.6	10%	0.098	39%	0.39	C	S	.	.	H	α-helix	trans	-59.9	-56	175.1	176.7	-101.8	0	0	0	112	M7 P8 D10 G11 K60 L61 E62 R67 K68	M7-Y64 HydrophobicContact CG-CE1 4.43Å; M7-Y64 HydrophobicContact SD-CE1 4.42Å; P8-Y64 WeakPolarHBondContact CD-OH 3.38Å; D10-Y64 HydrophobicContact CB-CE2 4.21Å; D10-Y64 WeakPolarHBondContact OD1-CE2 3.37Å; D10-Y64 PolarHBondContact OD1-OH 3.05Å; D10-Y64 WeakPolarHBondContact OD2-CE2 3.22Å; G11-Y64 WeakPolarHBondContact CA-OH 3.28Å; G11-Y64 PolarHBondContact N-OH 3.02Å; K60-Y64 PolarHBondContact O-N 2.79Å; L61-Y64 WeakPolarHBondContact O-CB 3.4Å; L61-Y64 PolarHBondContact O-N 3.02Å; E62-Y64 PolarHBondContact O-N 3.29Å; Y64-R67 PolarHBondContact O-N 3.29Å; Y64-K68 HydrophobicContact CE1-CG 4.13Å; Y64-K68 HydrophobicContact CE2-CD 4.49Å; Y64-K68 HydrophobicContact CE2-CG 4.24Å; Y64-K68 VanDerWaalsContact CZ-CE 3.47Å; Y64-K68 WeakPolarHBondContact O-CG 3.43Å; Y64-K68 PolarHBondContact O-N 3.02Å; Y64-K68 VanDerWaalsContact O-N 3.09Å; Y64-K68 WeakPolarHBondContact OH-CE 3.3Å
65	F	91	Very high	91.7	Very high	99 Å²	99	86.9 Å²	86.9	43%	0.434	41%	0.414	S	S	.	.	H	α-helix	trans	-67.4	-40.2	-176.7	-77.1	-63.6	0	0	0	112.4	M7 L61 E62 R67 K68 Y69	M7-F65 HydrophobicContact SD-CZ 4.27Å; L61-F65 HydrophobicContact CD1-CD2 3.98Å; L61-F65 HydrophobicContact CD1-CE2 3.48Å; L61-F65 VanDerWaalsContact CD1-CE2 3.48Å; L61-F65 HydrophobicContact CD1-CZ 4.42Å; L61-F65 HydrophobicContact CD2-CE2 4.31Å; L61-F65 HydrophobicContact CG-CD2 3.9Å; L61-F65 HydrophobicContact CG-CE2 3.74Å; L61-F65 WeakPolarHBondContact O-CD2 3.4Å; L61-F65 PolarHBondContact O-N 2.83Å; E62-F65 PolarHBondContact O-N 3.1Å; F65-R67 VanDerWaalsContact C-N 3.29Å; F65-R67 PolarHBondContact O-N 3.35Å; F65-K68 PolarHBondContact O-N 2.78Å; F65-K68 VanDerWaalsContact O-N 3.1Å; F65-Y69 WeakPolarHBondContact O-CB 3.28Å; F65-Y69 PolarHBondContact O-N 3.2Å
66	T	92	Very high	91.5	Very high	60 Å²	60	87.1 Å²	87.1	37%	0.368	42%	0.415	S	S	.	.	H	α-helix	trans	-57.4	-43.1	174.5	-65.2	0	0	0	0	111.3	E62 K68 Y69 H70	E62-T66 VanDerWaalsContact O-CB 3.3Å; E62-T66 WeakPolarHBondContact O-CB 3.44Å; E62-T66 PolarHBondContact O-N 3.06Å; E62-T66 PolarHBondContact O-OG1 3.03Å; T66-K68 PolarHBondContact O-N 3.15Å; T66-Y69 PolarHBondContact O-N 3.44Å; T66-H70 VanDerWaalsContact O-CG 3.29Å; T66-H70 PolarHBondContact O-N 3Å; T66-H70 PolarHBondContact O-ND1 3.42Å
67	R	90.6	Very high	91.1	Very high	185 Å²	185	85.1 Å²	85.1	70%	0.698	41%	0.412	S	S	*	.	H	α-helix	trans	-64.3	-41.3	176	-175.7	177.5	-179	-179.3	1	112.2	S63 Y64 F65 L71	S63-R67 WeakPolarHBondContact O-CB 3.48Å; S63-R67 PolarHBondContact O-N 3.26Å; S63-R67 VanDerWaalsContact O-N 3.1Å; Y64-R67 PolarHBondContact O-N 3.29Å; F65-R67 VanDerWaalsContact C-N 3.29Å; F65-R67 PolarHBondContact O-N 3.35Å; R67-L71 WeakPolarHBondContact O-CG 3.34Å; R67-L71 PolarHBondContact O-N 2.91Å
68	K	88.4	Confident	90.8	Very high	79 Å²	79	91.2 Å²	91.2	34%	0.343	44%	0.439	S	S	.	.	H	α-helix	trans	-66.9	-40.3	177	-65.4	-61.2	-177.1	-177.9	0	111.5	Y64 F65 T66 L71 F72	Y64-K68 HydrophobicContact CE1-CG 4.13Å; Y64-K68 HydrophobicContact CE2-CD 4.49Å; Y64-K68 HydrophobicContact CE2-CG 4.24Å; Y64-K68 VanDerWaalsContact CZ-CE 3.47Å; Y64-K68 WeakPolarHBondContact O-CG 3.43Å; Y64-K68 PolarHBondContact O-N 3.02Å; Y64-K68 VanDerWaalsContact O-N 3.09Å; Y64-K68 WeakPolarHBondContact OH-CE 3.3Å; F65-K68 PolarHBondContact O-N 2.78Å; F65-K68 VanDerWaalsContact O-N 3.1Å; T66-K68 PolarHBondContact O-N 3.15Å; K68-L71 PolarHBondContact O-N 3.06Å; K68-F72 PolarHBondContact O-N 3.25Å
69	Y	87.9	Confident	90.4	Very high	99 Å²	99	93 Å²	93	39%	0.388	44%	0.444	S	S	.	.	H	α-helix	trans	-62.8	-44.1	175.7	-174.5	-108.9	0	0	0	111.6	F65 T66 L71 F72 C73	F65-Y69 WeakPolarHBondContact O-CB 3.28Å; F65-Y69 PolarHBondContact O-N 3.2Å; T66-Y69 PolarHBondContact O-N 3.44Å; Y69-L71 VanDerWaalsContact C-N 3.3Å; Y69-L71 PolarHBondContact O-N 3.11Å; Y69-F72 HydrophobicContact CD2-CD1 4.23Å; Y69-F72 HydrophobicContact CE2-CD1 4.19Å; Y69-F72 CarbonylContact O-C 3.59Å; Y69-F72 WeakPolarHBondContact O-CA 3.18Å; Y69-F72 WeakPolarHBondContact O-CB 3.46Å; Y69-F72 PolarHBondContact O-N 2.93Å; Y69-F72 VanDerWaalsContact O-N 3.1Å; Y69-C73 WeakPolarHBondContact CE1-SG 3.35Å; Y69-C73 VanDerWaalsContact CZ-SG 3.55Å; Y69-C73 PolarHBondContact O-N 3.37Å; Y69-C73 PolarHBondContact O-SG 3.25Å
70	H	90.4	Very high	89.9	Confident	120 Å²	120	85.4 Å²	85.4	56%	0.556	42%	0.417	S	S	*	.	H	α-helix	trans	-59	-40.2	174	-70	159.5	0	0	0	113.2	T66 A74	T66-H70 VanDerWaalsContact O-CG 3.29Å; T66-H70 PolarHBondContact O-N 3Å; T66-H70 PolarHBondContact O-ND1 3.42Å; H70-A74 WeakPolarHBondContact O-CB 3.49Å; H70-A74 PolarHBondContact O-N 3.09Å
71	L	89	Confident	89.4	Confident	76 Å²	76	85.8 Å²	85.8	40%	0.398	42%	0.423	S	S	.	.	H	α-helix	trans	-65.5	-44.5	174.2	-68.3	172	0	0	0	110.7	R67 K68 Y69 C73 A74 Y75	R67-L71 WeakPolarHBondContact O-CG 3.34Å; R67-L71 PolarHBondContact O-N 2.91Å; K68-L71 PolarHBondContact O-N 3.06Å; Y69-L71 VanDerWaalsContact C-N 3.3Å; Y69-L71 PolarHBondContact O-N 3.11Å; L71-C73 PolarHBondContact O-N 3.45Å; L71-A74 WeakPolarHBondContact O-CB 3.36Å; L71-A74 PolarHBondContact O-N 2.96Å; L71-A74 VanDerWaalsContact O-N 3.09Å; L71-Y75 HydrophobicContact CB-CD2 4.32Å; L71-Y75 HydrophobicContact CB-CE2 4.33Å; L71-Y75 HydrophobicContact CD2-CE2 4.2Å; L71-Y75 WeakPolarHBondContact O-CD2 3.44Å; L71-Y75 PolarHBondContact O-N 3.37Å
72	F	88	Confident	89.1	Confident	59 Å²	59	90.3 Å²	90.3	26%	0.259	44%	0.442	S	S	.	.	H	α-helix	trans	-55.6	-50	175	172.9	-104.1	0	0	0	111.7	K68 Y69 A74 Y75 L76 E79 A80	K68-F72 PolarHBondContact O-N 3.25Å; Y69-F72 HydrophobicContact CD2-CD1 4.23Å; Y69-F72 HydrophobicContact CE2-CD1 4.19Å; Y69-F72 CarbonylContact O-C 3.59Å; Y69-F72 WeakPolarHBondContact O-CA 3.18Å; Y69-F72 WeakPolarHBondContact O-CB 3.46Å; Y69-F72 PolarHBondContact O-N 2.93Å; Y69-F72 VanDerWaalsContact O-N 3.1Å; F72-A74 PolarHBondContact O-N 3.02Å; F72-Y75 PolarHBondContact O-N 2.88Å; F72-L76 HydrophobicContact CD2-CB 4.21Å; F72-L76 HydrophobicContact CD2-CD1 3.93Å; F72-L76 HydrophobicContact CE2-CB 3.99Å; F72-L76 HydrophobicContact CE2-CD1 3.65Å; F72-L76 HydrophobicContact CE2-CG 4.46Å; F72-L76 HydrophobicContact CZ-CB 4.48Å; F72-L76 WeakPolarHBondContact O-CA 3.4Å; F72-L76 PolarHBondContact O-N 3.1Å; F72-E79 HydrophobicContact CE1-CB 4.41Å; F72-E79 HydrophobicContact CE2-CB 4.24Å; F72-E79 HydrophobicContact CZ-CB 3.63Å; F72-A80 HydrophobicContact CD1-CB 4.09Å; F72-A80 HydrophobicContact CE1-CB 3.86Å
73	C	88.7	Confident	88.3	Confident	38 Å²	38	89.6 Å²	89.6	26%	0.257	44%	0.439	S	S	.	.	H	α-helix	trans	-58.5	-34.6	175.3	-62.7	0	0	0	0	113.2	Y69 L71 P77 A80	Y69-C73 WeakPolarHBondContact CE1-SG 3.35Å; Y69-C73 VanDerWaalsContact CZ-SG 3.55Å; Y69-C73 PolarHBondContact O-N 3.37Å; Y69-C73 PolarHBondContact O-SG 3.25Å; L71-C73 PolarHBondContact O-N 3.45Å; C73-P77 VanDerWaalsContact O-CA 3.31Å; C73-P77 WeakPolarHBondContact O-CA 3.43Å; C73-P77 WeakPolarHBondContact O-CB 3.37Å; C73-A80 HydrophobicContact CB-CB 4.11Å; C73-A80 VanDerWaalsContact SG-CB 3.55Å
74	A	88.9	Confident	87.5	Confident	76 Å²	76	88.4 Å²	88.4	63%	0.628	43%	0.434	S	S	*	.	H	α-helix	trans	-73.8	-36.3	178.3	0	0	0	0	0	112.9	H70 L71 F72	H70-A74 WeakPolarHBondContact O-CB 3.49Å; H70-A74 PolarHBondContact O-N 3.09Å; L71-A74 WeakPolarHBondContact O-CB 3.36Å; L71-A74 PolarHBondContact O-N 2.96Å; L71-A74 VanDerWaalsContact O-N 3.09Å; F72-A74 PolarHBondContact O-N 3.02Å
75	Y	89.3	Confident	86.1	Confident	185 Å²	185	92.1 Å²	92.1	73%	0.725	46%	0.462	S	S	*	.	H	α-helix	trans	-88.6	-29.6	-178.2	-72.8	-68.5	0	0	0	113.5	L71 F72	L71-Y75 HydrophobicContact CB-CD2 4.32Å; L71-Y75 HydrophobicContact CB-CE2 4.33Å; L71-Y75 HydrophobicContact CD2-CE2 4.2Å; L71-Y75 WeakPolarHBondContact O-CD2 3.44Å; L71-Y75 PolarHBondContact O-N 3.37Å; F72-Y75 PolarHBondContact O-N 2.88Å
76	L	90.3	Very high	84.5	Confident	79 Å²	79	96 Å²	96	41%	0.414	48%	0.479	S	S	.	.			trans	-137.6	62.2	-173.5	-65	175.2	0	0	0	110.2	F72 E78 E79 A80	F72-L76 HydrophobicContact CD2-CB 4.21Å; F72-L76 HydrophobicContact CD2-CD1 3.93Å; F72-L76 HydrophobicContact CE2-CB 3.99Å; F72-L76 HydrophobicContact CE2-CD1 3.65Å; F72-L76 HydrophobicContact CE2-CG 4.46Å; F72-L76 HydrophobicContact CZ-CB 4.48Å; F72-L76 WeakPolarHBondContact O-CA 3.4Å; F72-L76 PolarHBondContact O-N 3.1Å; L76-E78 VanDerWaalsContact C-N 3.3Å; L76-E78 PolarHBondContact O-N 3.49Å; L76-E79 HydrophobicContact CB-CB 4.08Å; L76-E79 HydrophobicContact CB-CG 4.32Å; L76-E79 WeakPolarHBondContact CB-OE2 3.31Å; L76-E79 PolarHBondContact O-N 3.19Å; L76-A80 PolarHBondContact O-N 3.36Å
77	P	87.6	Confident	82.5	Confident	71 Å²	71	104.5 Å²	104.5	46%	0.461	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-33.8	-175.9	24.9	-34.2	0	0	0	112.8	C73 A80 L81	C73-P77 VanDerWaalsContact O-CA 3.31Å; C73-P77 WeakPolarHBondContact O-CA 3.43Å; C73-P77 WeakPolarHBondContact O-CB 3.37Å; P77-A80 PolarHBondContact O-N 2.83Å; P77-L81 WeakPolarHBondContact O-CB 3.47Å; P77-L81 VanDerWaalsContact O-CG 3.28Å; P77-L81 WeakPolarHBondContact O-CG 3.28Å; P77-L81 PolarHBondContact O-N 2.78Å
78	E	89.6	Confident	82.1	Confident	135 Å²	135	100.5 Å²	100.5	63%	0.631	51%	0.506	S	S	*	.	H	α-helix	trans	-66.9	-39.5	177.9	-65.1	-174.8	-174.4	0	0	111.8	L76 K82	L76-E78 VanDerWaalsContact C-N 3.3Å; L76-E78 PolarHBondContact O-N 3.49Å; E78-K82 WeakPolarHBondContact O-CG 3.08Å; E78-K82 PolarHBondContact O-N 3.25Å; E78-K82 VanDerWaalsContact O-N 3.11Å
79	E	87	Confident	81.8	Confident	70 Å²	70	101.6 Å²	101.6	33%	0.327	51%	0.514	S	S	.	.	H	α-helix	trans	-67.6	-42.1	173.9	-70.6	61.2	-142.8	0	0	111.7	F72 L76 L81 K82 E83	F72-E79 HydrophobicContact CE1-CB 4.41Å; F72-E79 HydrophobicContact CE2-CB 4.24Å; F72-E79 HydrophobicContact CZ-CB 3.63Å; L76-E79 HydrophobicContact CB-CB 4.08Å; L76-E79 HydrophobicContact CB-CG 4.32Å; L76-E79 WeakPolarHBondContact CB-OE2 3.31Å; L76-E79 PolarHBondContact O-N 3.19Å; E79-L81 VanDerWaalsContact C-N 3.32Å; E79-L81 PolarHBondContact O-N 3.3Å; E79-K82 WeakPolarHBondContact O-CB 3.46Å; E79-K82 PolarHBondContact O-N 3.1Å; E79-K82 VanDerWaalsContact O-N 3.15Å; E79-K82 IonicContact OE1-NZ 2.79Å; E79-E83 PolarHBondContact O-N 3.29Å
80	A	83.8	Confident	81.4	Confident	7 Å²	7	101.8 Å²	101.8	6%	0.058	52%	0.521	C	S	.	.	H	α-helix	trans	-62.5	-38.8	175.7	0	0	0	0	0	112.5	F72 C73 L76 P77 K82 E83 A84	F72-A80 HydrophobicContact CD1-CB 4.09Å; F72-A80 HydrophobicContact CE1-CB 3.86Å; C73-A80 HydrophobicContact CB-CB 4.11Å; C73-A80 VanDerWaalsContact SG-CB 3.55Å; L76-A80 PolarHBondContact O-N 3.36Å; P77-A80 PolarHBondContact O-N 2.83Å; A80-K82 VanDerWaalsContact C-N 3.33Å; A80-E83 PolarHBondContact O-N 3.47Å; A80-A84 WeakPolarHBondContact O-CB 3.5Å; A80-A84 PolarHBondContact O-N 2.95Å
81	L	83.1	Confident	80.9	Confident	115 Å²	115	100.7 Å²	100.7	60%	0.602	52%	0.519	S	S	*	.	H	α-helix	trans	-65	-37.4	173.6	-74.7	172	0	0	0	112	P77 E79 A84 C85	P77-L81 WeakPolarHBondContact O-CB 3.47Å; P77-L81 VanDerWaalsContact O-CG 3.28Å; P77-L81 WeakPolarHBondContact O-CG 3.28Å; P77-L81 PolarHBondContact O-N 2.78Å; E79-L81 VanDerWaalsContact C-N 3.32Å; E79-L81 PolarHBondContact O-N 3.3Å; L81-A84 PolarHBondContact O-N 3.09Å; L81-C85 PolarHBondContact O-N 3.46Å; L81-C85 VanDerWaalsContact O-N 3.1Å; L81-C85 PolarHBondContact O-SG 3.18Å
82	K	86.3	Confident	80.4	Confident	111 Å²	111	102.3 Å²	102.3	48%	0.483	53%	0.527	S	S	.	.	H	α-helix	trans	-59.9	-50.2	174.2	-71.3	165	-166.1	157.5	0	110.1	E78 E79 A80 A84 C85 F86	E78-K82 WeakPolarHBondContact O-CG 3.08Å; E78-K82 PolarHBondContact O-N 3.25Å; E78-K82 VanDerWaalsContact O-N 3.11Å; E79-K82 WeakPolarHBondContact O-CB 3.46Å; E79-K82 PolarHBondContact O-N 3.1Å; E79-K82 VanDerWaalsContact O-N 3.15Å; E79-K82 IonicContact OE1-NZ 2.79Å; A80-K82 VanDerWaalsContact C-N 3.33Å; K82-A84 PolarHBondContact O-N 3.25Å; K82-C85 PolarHBondContact O-N 2.91Å; K82-F86 HydrophobicContact CB-CE2 4.42Å; K82-F86 WeakPolarHBondContact O-CD2 3.42Å; K82-F86 VanDerWaalsContact O-CE2 3.28Å; K82-F86 WeakPolarHBondContact O-CE2 3.48Å
83	E	77.9	Confident	79.9	Confident	112 Å²	112	105.1 Å²	105.1	52%	0.523	55%	0.545	S	S	.	.	H	α-helix	trans	-59.5	-46	177.6	-71	-171.3	167.7	0	0	112.4	E79 A80 C85 F86	E79-E83 PolarHBondContact O-N 3.29Å; A80-E83 PolarHBondContact O-N 3.47Å; E83-C85 PolarHBondContact O-N 3.33Å; E83-F86 PolarHBondContact O-N 3.07Å; E83-F86 VanDerWaalsContact O-N 3.09Å
84	A	75.1	Confident	79.3	Confident	55 Å²	55	109.9 Å²	109.9	46%	0.455	57%	0.565	S	S	.	*	H	α-helix	trans	-65.3	-24	-179.5	0	0	0	0	0	114.1	A80 L81 K82 F86	A80-A84 WeakPolarHBondContact O-CB 3.5Å; A80-A84 PolarHBondContact O-N 2.95Å; L81-A84 PolarHBondContact O-N 3.09Å; K82-A84 PolarHBondContact O-N 3.25Å; A84-F86 VanDerWaalsContact C-N 3.33Å
85	C	62.9	Low	78.5	Confident	103 Å²	103	112.5 Å²	112.5	70%	0.696	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	-4	175.8	-68.9	0	0	0	0	114	L81 K82 E83	L81-C85 PolarHBondContact O-N 3.46Å; L81-C85 VanDerWaalsContact O-N 3.1Å; L81-C85 PolarHBondContact O-SG 3.18Å; K82-C85 PolarHBondContact O-N 2.91Å; E83-C85 PolarHBondContact O-N 3.33Å
86	F	58.1	Low	77.6	Confident	180 Å²	180	106.5 Å²	106.5	79%	0.789	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	1.4	177.4	-71.1	-67	0	0	0	114.2	K82 E83 A84	K82-F86 HydrophobicContact CB-CE2 4.42Å; K82-F86 WeakPolarHBondContact O-CD2 3.42Å; K82-F86 VanDerWaalsContact O-CE2 3.28Å; K82-F86 WeakPolarHBondContact O-CE2 3.48Å; E83-F86 PolarHBondContact O-N 3.07Å; E83-F86 VanDerWaalsContact O-N 3.09Å; A84-F86 VanDerWaalsContact C-N 3.33Å
87	E	49.7	Very low	76.5	Confident	240 Å²	240	109 Å²	109	100%	1.122	56%	0.559	S	S	*	*			trans	-102.6	0	168.4	-65.4	-172.1	167.2	0	0	111.5

Retrieved 87 of 87 residues in 16.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).