A0A077ZEA6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZEA6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 96 aa.

						>A0A077ZEA6_TRITR|A0A077ZEA6
MTYMYQRLELEHASWCLSTFGGAFSAYGDYFYEFAVKAGEISTTQLRIALLLGNELLVSRCRLYYALSLIQQRKLRLAKKIIRYEKGTFFKVRRCL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.7	Low	92.1	Very high	177 Å²	177	108.6 Å²	108.6	87%	0.872	51%	0.507	S	S	*	.				0	126.9	0	-160.1	46.9	58.7	0	0	107.8	Y5 Q6	M1-Y5 VanDerWaalsContact SD-CB 3.51Å; M1-Y5 HydrophobicContact SD-CD2 3.82Å; M1-Y5 HydrophobicContact SD-CG 3.75Å; M1-Q6 HydrophobicContact CG-CG 4.27Å
2	T	90	Very high	92.5	Very high	80 Å²	80	108.1 Å²	108.1	49%	0.491	50%	0.504	S	S	.	.			trans	-73.7	153.8	-178.8	72.5	0	0	0	0	110.3	M4 Y5 Q6	T2-M4 PolarHBondContact O-N 2.97Å; T2-M4 VanDerWaalsContact O-N 3.16Å; T2-Y5 HydrophobicContact CG2-CD2 4.4Å; T2-Y5 PolarHBondContact O-N 3.47Å; T2-Y5 WeakPolarHBondContact OG1-CD2 3.47Å; T2-Q6 PolarHBondContact O-N 3.45Å
3	Y	91.8	Very high	92.9	Very high	149 Å²	149	102.5 Å²	102.5	58%	0.584	49%	0.488	S	S	*	.	H	α-helix	trans	-50.4	-39.1	179.4	175.3	-95.9	0	0	0	112.9	Y5 Q6 R7	Y3-Y5 PolarHBondContact O-N 3.47Å; Y3-Q6 PolarHBondContact O-N 3.09Å; Y3-R7 PolarHBondContact O-N 3.06Å; Y3-R7 PolarHBondContact OH-NH1 3.18Å
4	M	93.6	Very high	93.1	Very high	138 Å²	138	95.6 Å²	95.6	68%	0.68	46%	0.456	S	S	*	.	H	α-helix	trans	-61.9	-42.8	178.9	-65.8	-58.6	-174.8	0	0	112.4	T2 R7 L8	T2-M4 PolarHBondContact O-N 2.97Å; T2-M4 VanDerWaalsContact O-N 3.16Å; M4-R7 PolarHBondContact O-N 3.27Å; M4-L8 PolarHBondContact O-N 3.34Å
5	Y	95.4	Very high	93.3	Very high	131 Å²	131	99.6 Å²	99.6	51%	0.514	47%	0.465	S	S	.	.	H	α-helix	trans	-64.2	-42.4	176.5	-74.1	-69.1	0	0	0	111.7	M1 T2 Y3 R7 L8 E9	M1-Y5 VanDerWaalsContact SD-CB 3.51Å; M1-Y5 HydrophobicContact SD-CD2 3.82Å; M1-Y5 HydrophobicContact SD-CG 3.75Å; T2-Y5 HydrophobicContact CG2-CD2 4.4Å; T2-Y5 PolarHBondContact O-N 3.47Å; T2-Y5 WeakPolarHBondContact OG1-CD2 3.47Å; Y3-Y5 PolarHBondContact O-N 3.47Å; Y5-R7 VanDerWaalsContact C-N 3.27Å; Y5-R7 PolarHBondContact O-N 2.96Å; Y5-L8 PolarHBondContact O-N 3.47Å; Y5-E9 WeakPolarHBondContact O-CG 3.46Å; Y5-E9 PolarHBondContact O-N 3.33Å
6	Q	94.2	Very high	93.5	Very high	108 Å²	108	96.5 Å²	96.5	51%	0.505	46%	0.457	S	S	.	.	H	α-helix	trans	-60.7	-39.4	177.1	-66.2	177.4	-48.6	0	0	111.9	M1 T2 Y3 L10	M1-Q6 HydrophobicContact CG-CG 4.27Å; T2-Q6 PolarHBondContact O-N 3.45Å; Y3-Q6 PolarHBondContact O-N 3.09Å; Q6-L10 WeakPolarHBondContact O-CG 3.5Å; Q6-L10 PolarHBondContact O-N 3.33Å; Q6-L10 VanDerWaalsContact O-N 3.17Å
7	R	95.2	Very high	93.8	Very high	80 Å²	80	93.2 Å²	93.2	30%	0.302	44%	0.443	S	S	.	.	H	α-helix	trans	-66.4	-42.7	176.7	-166.3	174.4	-177.5	98	7.6	111.7	Y3 M4 Y5 L10 E11 L52	Y3-R7 PolarHBondContact O-N 3.06Å; Y3-R7 PolarHBondContact OH-NH1 3.18Å; M4-R7 PolarHBondContact O-N 3.27Å; Y5-R7 VanDerWaalsContact C-N 3.27Å; Y5-R7 PolarHBondContact O-N 2.96Å; R7-L10 PolarHBondContact O-N 2.97Å; R7-E11 IonicContact NE-OE1 3.71Å; R7-E11 WeakPolarHBondContact O-CG 3.05Å; R7-E11 PolarHBondContact O-N 3.44Å; R7-L52 HydrophobicContact CG-CD2 3.72Å; R7-L52 PolarHBondContact NH1-O 3.21Å; R7-L52 PolarHBondContact NH2-O 3.46Å
8	L	96.4	Very high	94	Very high	91 Å²	91	90.7 Å²	90.7	48%	0.476	44%	0.437	S	S	.	.	H	α-helix	trans	-62.5	-41.8	176.8	-176.5	62.7	0	0	0	112.2	M4 Y5 L10 E11 H12	M4-L8 PolarHBondContact O-N 3.34Å; Y5-L8 PolarHBondContact O-N 3.47Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 2.94Å; L8-E11 PolarHBondContact O-N 3.11Å; L8-H12 WeakPolarHBondContact O-CB 3.43Å; L8-H12 PolarHBondContact O-N 2.91Å
9	E	96.9	Very high	94.2	Very high	126 Å²	126	91.6 Å²	91.6	59%	0.589	45%	0.448	S	S	*	.	H	α-helix	trans	-60.9	-41.8	175.3	-72.3	-60.9	148.3	0	0	112	Y5 A13	Y5-E9 WeakPolarHBondContact O-CG 3.46Å; Y5-E9 PolarHBondContact O-N 3.33Å; E9-A13 WeakPolarHBondContact O-CB 3.09Å; E9-A13 PolarHBondContact O-N 3.47Å
10	L	96.4	Very high	94.3	Very high	50 Å²	50	93.3 Å²	93.3	26%	0.262	45%	0.453	S	S	.	.	H	α-helix	trans	-65.9	-41.1	175.8	-74.6	173.4	0	0	0	112.2	Q6 R7 L8 A13 S14 I48 L51 L52	Q6-L10 WeakPolarHBondContact O-CG 3.5Å; Q6-L10 PolarHBondContact O-N 3.33Å; Q6-L10 VanDerWaalsContact O-N 3.17Å; R7-L10 PolarHBondContact O-N 2.97Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 2.94Å; L10-A13 PolarHBondContact O-N 3.3Å; L10-S14 WeakPolarHBondContact O-CB 3.35Å; L10-S14 PolarHBondContact O-N 2.78Å; L10-I48 HydrophobicContact CB-CG2 4.18Å; L10-I48 HydrophobicContact CD2-CG1 4.33Å; L10-I48 HydrophobicContact CD2-CG2 4.23Å; L10-I48 WeakPolarHBondContact O-CG2 3.48Å; L10-L51 HydrophobicContact CD1-CB 4.14Å; L10-L51 HydrophobicContact CD2-CD1 4.4Å; L10-L52 HydrophobicContact CB-CD1 4.44Å; L10-L52 HydrophobicContact CB-CD2 3.73Å; L10-L52 HydrophobicContact CB-CG 4.14Å; L10-L52 HydrophobicContact CD1-CD2 4.26Å
11	E	96.2	Very high	94.5	Very high	65 Å²	65	89.2 Å²	89.2	30%	0.304	44%	0.436	S	S	.	.	H	α-helix	trans	-64	-46	175.8	-74.5	-179.9	-172.6	0	0	111.4	R7 L8 A13 S14 W15 L52	R7-E11 IonicContact NE-OE1 3.71Å; R7-E11 WeakPolarHBondContact O-CG 3.05Å; R7-E11 PolarHBondContact O-N 3.44Å; L8-E11 PolarHBondContact O-N 3.11Å; E11-A13 PolarHBondContact O-N 3.37Å; E11-S14 WeakPolarHBondContact O-CB 3.29Å; E11-S14 PolarHBondContact O-N 3.29Å; E11-S14 VanDerWaalsContact O-N 3.16Å; E11-W15 HydrophobicContact CB-CZ2 4.39Å; E11-W15 PolarHBondContact O-N 3.16Å; E11-L52 HydrophobicContact CG-CD1 4.01Å; E11-L52 HydrophobicContact CG-CD2 3.94Å
12	H	97.1	Very high	96	Very high	102 Å²	102	82.9 Å²	82.9	47%	0.472	42%	0.416	S	S	.	.	H	α-helix	trans	-58.9	-48.2	175.5	178.6	-105.1	0	0	0	111.7	L8 S14 W15 C16	L8-H12 WeakPolarHBondContact O-CB 3.43Å; L8-H12 PolarHBondContact O-N 2.91Å; H12-S14 VanDerWaalsContact C-N 3.29Å; H12-S14 PolarHBondContact O-N 3.38Å; H12-W15 PolarHBondContact O-N 2.92Å; H12-W15 VanDerWaalsContact O-N 3.12Å; H12-C16 PolarHBondContact O-N 3.2Å; H12-C16 PolarHBondContact O-SG 3.04Å
13	A	97.2	Very high	96.4	Very high	35 Å²	35	81.3 Å²	81.3	29%	0.289	41%	0.411	S	S	.	.	H	α-helix	trans	-58.6	-40.8	175.3	0	0	0	0	0	112	E9 L10 E11 W15 C16 L17 I48	E9-A13 WeakPolarHBondContact O-CB 3.09Å; E9-A13 PolarHBondContact O-N 3.47Å; L10-A13 PolarHBondContact O-N 3.3Å; E11-A13 PolarHBondContact O-N 3.37Å; A13-W15 VanDerWaalsContact C-N 3.32Å; A13-W15 PolarHBondContact O-N 3.45Å; A13-C16 PolarHBondContact O-N 3.44Å; A13-L17 WeakPolarHBondContact O-CB 3.49Å; A13-L17 VanDerWaalsContact O-CG 3.27Å; A13-L17 WeakPolarHBondContact O-CG 3.38Å; A13-L17 PolarHBondContact O-N 2.6Å; A13-I48 HydrophobicContact CB-CD1 4.24Å
14	S	96.4	Very high	96.7	Very high	7 Å²	7	77 Å²	77	5%	0.049	40%	0.396	C	S	.	.	H	α-helix	trans	-61.8	-38.6	176.3	-174.2	0	0	0	0	112.5	L10 E11 H12 S18	L10-S14 WeakPolarHBondContact O-CB 3.35Å; L10-S14 PolarHBondContact O-N 2.78Å; E11-S14 WeakPolarHBondContact O-CB 3.29Å; E11-S14 PolarHBondContact O-N 3.29Å; E11-S14 VanDerWaalsContact O-N 3.16Å; H12-S14 VanDerWaalsContact C-N 3.29Å; H12-S14 PolarHBondContact O-N 3.38Å; S14-S18 WeakPolarHBondContact O-CB 3.19Å; S14-S18 PolarHBondContact O-N 3.44Å
15	W	95.9	Very high	97	Very high	155 Å²	155	71.5 Å²	71.5	59%	0.587	37%	0.371	S	S	*	.	H	α-helix	trans	-68	-47.7	177.2	-61.8	-25.1	0	0	0	111.8	E11 H12 A13 L17 S18 T19	E11-W15 HydrophobicContact CB-CZ2 4.39Å; E11-W15 PolarHBondContact O-N 3.16Å; H12-W15 PolarHBondContact O-N 2.92Å; H12-W15 VanDerWaalsContact O-N 3.12Å; A13-W15 VanDerWaalsContact C-N 3.32Å; A13-W15 PolarHBondContact O-N 3.45Å; W15-L17 VanDerWaalsContact C-N 3.34Å; W15-L17 PolarHBondContact O-N 2.96Å; W15-S18 WeakPolarHBondContact O-CB 3.45Å; W15-S18 PolarHBondContact O-N 3.42Å; W15-T19 PolarHBondContact O-N 3.14Å; W15-T19 VanDerWaalsContact O-N 3.13Å; W15-T19 PolarHBondContact O-OG1 3.41Å
16	C	97.4	Very high	97.1	Very high	50 Å²	50	68 Å²	68	34%	0.338	37%	0.368	S	S	.	.	H	α-helix	trans	-56.2	-49.3	175.4	-65.4	0	0	0	0	111.1	H12 A13 S18 T19 F20	H12-C16 PolarHBondContact O-N 3.2Å; H12-C16 PolarHBondContact O-SG 3.04Å; A13-C16 PolarHBondContact O-N 3.44Å; C16-S18 PolarHBondContact O-N 3.23Å; C16-T19 PolarHBondContact O-N 3.1Å; C16-F20 WeakPolarHBondContact O-CD2 3.41Å; C16-F20 PolarHBondContact O-N 3.49Å
17	L	97.6	Very high	97.3	Very high	40 Å²	40	69.1 Å²	69.1	21%	0.209	37%	0.369	C	S	.	.	H	α-helix	trans	-63.3	-27.6	178.1	-71	171.3	0	0	0	112.8	A13 W15 G21 I41 T44 Q45 I48	A13-L17 WeakPolarHBondContact O-CB 3.49Å; A13-L17 VanDerWaalsContact O-CG 3.27Å; A13-L17 WeakPolarHBondContact O-CG 3.38Å; A13-L17 PolarHBondContact O-N 2.6Å; W15-L17 VanDerWaalsContact C-N 3.34Å; W15-L17 PolarHBondContact O-N 2.96Å; L17-G21 VanDerWaalsContact O-CA 3.32Å; L17-G21 WeakPolarHBondContact O-CA 3.48Å; L17-G21 PolarHBondContact O-N 2.98Å; L17-I41 HydrophobicContact CB-CG2 4.2Å; L17-I41 HydrophobicContact CD2-CG2 4.17Å; L17-I41 WeakPolarHBondContact O-CG2 3.49Å; L17-T44 HydrophobicContact CD1-CG2 3.89Å; L17-Q45 HydrophobicContact CB-CG 3.57Å; L17-Q45 HydrophobicContact CD1-CG 4.04Å; L17-Q45 HydrophobicContact CG-CG 4.44Å; L17-I48 HydrophobicContact CD1-CD1 3.46Å; L17-I48 VanDerWaalsContact CD1-CD1 3.46Å
18	S	97.3	Very high	97.5	Very high	48 Å²	48	65.5 Å²	65.5	34%	0.336	36%	0.357	S	S	.	.	H	α-helix	trans	-70.6	-42.3	175.7	-165.4	0	0	0	0	111.8	S14 W15 C16 G22 Q45	S14-S18 WeakPolarHBondContact O-CB 3.19Å; S14-S18 PolarHBondContact O-N 3.44Å; W15-S18 WeakPolarHBondContact O-CB 3.45Å; W15-S18 PolarHBondContact O-N 3.42Å; C16-S18 PolarHBondContact O-N 3.23Å; S18-G22 PolarHBondContact O-N 3.09Å; S18-Q45 VanDerWaalsContact N-NE2 3.16Å
19	T	98	Very high	97.6	Very high	108 Å²	108	66.1 Å²	66.1	66%	0.663	36%	0.36	S	S	*	.	H	α-helix	trans	-64	-50.9	175.7	-58.4	0	0	0	0	110.9	W15 C16 G22 A23	W15-T19 PolarHBondContact O-N 3.14Å; W15-T19 VanDerWaalsContact O-N 3.13Å; W15-T19 PolarHBondContact O-OG1 3.41Å; C16-T19 PolarHBondContact O-N 3.1Å; T19-G22 PolarHBondContact O-N 2.9Å; T19-A23 PolarHBondContact O-N 3.36Å; T19-A23 VanDerWaalsContact O-N 3.09Å
20	F	96.6	Very high	97.7	Very high	125 Å²	125	69 Å²	69	55%	0.548	37%	0.367	S	S	.	.	H	α-helix	trans	-64.1	-43.9	177.5	-73.4	-65.9	0	0	0	111.9	C16 G22 A23 F24	C16-F20 WeakPolarHBondContact O-CD2 3.41Å; C16-F20 PolarHBondContact O-N 3.49Å; F20-G22 VanDerWaalsContact C-N 3.29Å; F20-G22 PolarHBondContact O-N 2.55Å; F20-A23 WeakPolarHBondContact O-CB 3.48Å; F20-A23 PolarHBondContact O-N 3.38Å; F20-A23 VanDerWaalsContact O-N 3.11Å; F20-F24 HydrophobicContact CB-CD2 4.35Å; F20-F24 HydrophobicContact CB-CE2 4.48Å; F20-F24 WeakPolarHBondContact O-CD2 3.45Å; F20-F24 PolarHBondContact O-N 3.49Å
21	G	98.4	Very high	97.8	Very high	8 Å²	8	71.5 Å²	71.5	8%	0.082	38%	0.376	C	S	.	.	H	α-helix	trans	-58.3	-41.2	177.5	0	0	0	0	0	112.3	L17 S25	L17-G21 VanDerWaalsContact O-CA 3.32Å; L17-G21 WeakPolarHBondContact O-CA 3.48Å; L17-G21 PolarHBondContact O-N 2.98Å; G21-S25 WeakPolarHBondContact O-CB 3.38Å; G21-S25 PolarHBondContact O-N 2.9Å
22	G	98.3	Very high	97.9	Very high	44 Å²	44	74.2 Å²	74.2	45%	0.454	39%	0.385	S	S	.	.	H	α-helix	trans	-61.3	-46.1	172.5	0	0	0	0	0	112.8	S18 T19 F20 S25 A26	S18-G22 PolarHBondContact O-N 3.09Å; T19-G22 PolarHBondContact O-N 2.9Å; F20-G22 VanDerWaalsContact C-N 3.29Å; F20-G22 PolarHBondContact O-N 2.55Å; G22-S25 PolarHBondContact O-N 3.11Å; G22-A26 PolarHBondContact O-N 3.28Å
23	A	98.5	Very high	97.9	Very high	48 Å²	48	75.7 Å²	75.7	40%	0.397	39%	0.392	S	S	.	.	H	α-helix	trans	-61.7	-49.5	176.9	0	0	0	0	0	112.1	T19 F20 S25 A26 Y27	T19-A23 PolarHBondContact O-N 3.36Å; T19-A23 VanDerWaalsContact O-N 3.09Å; F20-A23 WeakPolarHBondContact O-CB 3.48Å; F20-A23 PolarHBondContact O-N 3.38Å; F20-A23 VanDerWaalsContact O-N 3.11Å; A23-S25 VanDerWaalsContact C-N 3.32Å; A23-S25 PolarHBondContact O-N 2.93Å; A23-A26 PolarHBondContact O-N 3.26Å; A23-Y27 VanDerWaalsContact O-CD2 3.31Å; A23-Y27 WeakPolarHBondContact O-CD2 3.28Å; A23-Y27 PolarHBondContact O-N 3.18Å; A23-Y27 VanDerWaalsContact O-N 3.1Å
24	F	98.5	Very high	98	Very high	59 Å²	59	77.6 Å²	77.6	26%	0.259	39%	0.393	S	S	.	.	H	α-helix	trans	-61	-40	176.3	-82.1	-71.5	0	0	0	112.2	F20 Y27 G28 F34 K37 A38 I41	F20-F24 HydrophobicContact CB-CD2 4.35Å; F20-F24 HydrophobicContact CB-CE2 4.48Å; F20-F24 WeakPolarHBondContact O-CD2 3.45Å; F20-F24 PolarHBondContact O-N 3.49Å; F24-Y27 PolarHBondContact O-N 2.96Å; F24-G28 PolarHBondContact O-N 3.43Å; F24-F34 HydrophobicContact CD1-CB 4.48Å; F24-F34 AromaticContact CD1-CD1 3.49Å; F24-F34 HydrophobicContact CD1-CD1 3.49Å; F24-F34 VanDerWaalsContact CD1-CD1 3.49Å; F24-F34 HydrophobicContact CD1-CE1 4.15Å; F24-F34 HydrophobicContact CD1-CG 4.39Å; F24-F34 AromaticContact CE1-CD1 3.61Å; F24-F34 HydrophobicContact CE1-CD1 3.61Å; F24-F34 AromaticContact CE1-CE1 3.83Å; F24-F34 HydrophobicContact CE1-CE1 3.83Å; F24-K37 HydrophobicContact CD1-CB 3.87Å; F24-K37 HydrophobicContact CD1-CG 3.68Å; F24-K37 HydrophobicContact CD2-CG 4.41Å; F24-K37 HydrophobicContact CE1-CB 4.2Å; F24-K37 HydrophobicContact CE1-CG 3.65Å; F24-K37 HydrophobicContact CE2-CG 4.38Å; F24-K37 HydrophobicContact CG-CB 4.41Å; F24-K37 HydrophobicContact CG-CG 4.09Å; F24-K37 HydrophobicContact CZ-CG 4.02Å; F24-A38 HydrophobicContact CB-CB 4.09Å; F24-I41 HydrophobicContact CB-CD1 4.25Å; F24-I41 HydrophobicContact CD2-CD1 3.25Å; F24-I41 HydrophobicContact CE2-CD1 3.82Å; F24-I41 HydrophobicContact CG-CD1 3.92Å
25	S	98.7	Very high	98.1	Very high	21 Å²	21	77.2 Å²	77.2	15%	0.147	39%	0.391	C	S	.	.	H	α-helix	trans	-62.5	-45	174.9	-167.3	0	0	0	0	110.8	G21 G22 A23 Y27 G28 D29 L67 Q71	G21-S25 WeakPolarHBondContact O-CB 3.38Å; G21-S25 PolarHBondContact O-N 2.9Å; G22-S25 PolarHBondContact O-N 3.11Å; A23-S25 VanDerWaalsContact C-N 3.32Å; A23-S25 PolarHBondContact O-N 2.93Å; S25-Y27 VanDerWaalsContact C-N 3.34Å; S25-Y27 PolarHBondContact O-N 3.42Å; S25-G28 WeakPolarHBondContact O-CA 3.38Å; S25-G28 PolarHBondContact O-N 2.91Å; S25-D29 PolarHBondContact O-N 3.35Å; S25-L67 WeakPolarHBondContact OG-CD2 3.18Å; S25-Q71 PolarHBondContact O-NE2 3.07Å; S25-Q71 PolarHBondContact OG-NE2 3.24Å
26	A	98.6	Very high	98.2	Very high	57 Å²	57	72 Å²	72	47%	0.471	38%	0.376	S	S	.	.	H	α-helix	trans	-60.2	-43.1	178.7	0	0	0	0	0	112.2	G22 A23 G28 D29	G22-A26 PolarHBondContact O-N 3.28Å; A23-A26 PolarHBondContact O-N 3.26Å; A26-G28 VanDerWaalsContact C-N 3.27Å; A26-G28 PolarHBondContact O-N 3.1Å; A26-D29 PolarHBondContact O-N 3.31Å
27	Y	98.5	Very high	98.3	Very high	133 Å²	133	73.8 Å²	73.8	52%	0.522	38%	0.378	S	S	.	.	H	α-helix	trans	-67.7	-27.9	172.4	-79.4	-73.6	0	0	0	113.2	A23 F24 S25 D29 Y30 F31 F34	A23-Y27 VanDerWaalsContact O-CD2 3.31Å; A23-Y27 WeakPolarHBondContact O-CD2 3.28Å; A23-Y27 PolarHBondContact O-N 3.18Å; A23-Y27 VanDerWaalsContact O-N 3.1Å; F24-Y27 PolarHBondContact O-N 2.96Å; S25-Y27 VanDerWaalsContact C-N 3.34Å; S25-Y27 PolarHBondContact O-N 3.42Å; Y27-D29 PolarHBondContact O-N 3.47Å; Y27-Y30 PolarHBondContact O-N 3.28Å; Y27-F31 HydrophobicContact CD1-CD2 4.27Å; Y27-F31 HydrophobicContact CD1-CE2 4.14Å; Y27-F31 WeakPolarHBondContact O-CD2 3.43Å; Y27-F31 PolarHBondContact O-N 3.28Å; Y27-F34 HydrophobicContact CD1-CD2 4.42Å; Y27-F34 HydrophobicContact CD1-CE2 4.38Å; Y27-F34 HydrophobicContact CG-CD2 4.16Å; Y27-F34 HydrophobicContact CG-CE2 4.38Å
28	G	98.6	Very high	98.3	Very high	4 Å²	4	72 Å²	72	4%	0.041	37%	0.369	C	S	.	.	H	α-helix	trans	-61.9	-20.3	178.1	0	0	0	0	0	114.7	F24 S25 A26 Y30 F31	F24-G28 PolarHBondContact O-N 3.43Å; S25-G28 WeakPolarHBondContact O-CA 3.38Å; S25-G28 PolarHBondContact O-N 2.91Å; A26-G28 VanDerWaalsContact C-N 3.27Å; A26-G28 PolarHBondContact O-N 3.1Å; G28-Y30 PolarHBondContact O-N 3.04Å; G28-F31 WeakPolarHBondContact CA-O 3.39Å
29	D	98.2	Very high	98.4	Very high	103 Å²	103	69.8 Å²	69.8	55%	0.551	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.1	-22.7	173	-71.3	-19	0	0	0	112.6	S25 A26 Y27 Q71	S25-D29 PolarHBondContact O-N 3.35Å; A26-D29 PolarHBondContact O-N 3.31Å; Y27-D29 PolarHBondContact O-N 3.47Å; D29-Q71 WeakPolarHBondContact OD1-CG 3.44Å; D29-Q71 PolarHBondContact OD1-NE2 3.35Å
30	Y	98.2	Very high	98.4	Very high	187 Å²	187	69 Å²	69	73%	0.733	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.9	-32.2	-176.4	-54.2	-78.8	0	0	0	113.2	Y27 G28	Y27-Y30 PolarHBondContact O-N 3.28Å; G28-Y30 PolarHBondContact O-N 3.04Å
31	F	98.4	Very high	98.5	Very high	103 Å²	103	63.6 Å²	63.6	45%	0.452	32%	0.32	S	S	.	.			trans	-129.2	128.7	-175.3	-48.6	-86.3	0	0	0	111.7	Y27 G28 E33 F34 A35	Y27-F31 HydrophobicContact CD1-CD2 4.27Å; Y27-F31 HydrophobicContact CD1-CE2 4.14Å; Y27-F31 WeakPolarHBondContact O-CD2 3.43Å; Y27-F31 PolarHBondContact O-N 3.28Å; G28-F31 WeakPolarHBondContact CA-O 3.39Å; F31-E33 VanDerWaalsContact C-N 3.32Å; F31-E33 PolarHBondContact O-N 3.27Å; F31-F34 HydrophobicContact CB-CD2 3.63Å; F31-F34 HydrophobicContact CB-CE2 4.33Å; F31-F34 AromaticContact CD2-CD2 3.74Å; F31-F34 HydrophobicContact CD2-CD2 3.74Å; F31-F34 HydrophobicContact CD2-CE2 4.02Å; F31-F34 AromaticContact CG-CD2 3.92Å; F31-F34 HydrophobicContact CG-CD2 3.92Å; F31-F34 HydrophobicContact CG-CE2 4.25Å; F31-F34 PolarHBondContact O-N 3.22Å; F31-A35 PolarHBondContact O-N 2.95Å
32	Y	98.4	Very high	98.5	Very high	122 Å²	122	63.5 Å²	63.5	48%	0.478	32%	0.318	S	S	.	.	H	α-helix	trans	-62.7	-37.7	-174.5	175.8	-97.6	0	0	0	112.8	F34 A35 V36 Q72	Y32-F34 VanDerWaalsContact C-N 3.33Å; Y32-F34 PolarHBondContact O-N 3.05Å; Y32-A35 WeakPolarHBondContact O-CB 3.33Å; Y32-A35 PolarHBondContact O-N 2.95Å; Y32-V36 HydrophobicContact CD1-CG2 4.12Å; Y32-V36 HydrophobicContact CE1-CG2 3.6Å; Y32-V36 HydrophobicContact CE2-CG2 4.38Å; Y32-V36 WeakPolarHBondContact O-CG2 3.47Å; Y32-V36 PolarHBondContact O-N 3.1Å; Y32-Q72 HydrophobicContact CD2-CB 4.4Å; Y32-Q72 HydrophobicContact CD2-CG 4.23Å; Y32-Q72 HydrophobicContact CE2-CB 3.85Å; Y32-Q72 HydrophobicContact CE2-CG 3.81Å
33	E	98.6	Very high	98.6	Very high	132 Å²	132	63.7 Å²	63.7	62%	0.617	31%	0.31	S	S	*	.	H	α-helix	trans	-63.2	-40.5	-178.5	-61.1	76.6	-169.4	0	0	111.2	F31 V36 K37	F31-E33 VanDerWaalsContact C-N 3.32Å; F31-E33 PolarHBondContact O-N 3.27Å; E33-V36 PolarHBondContact O-N 3.11Å; E33-K37 PolarHBondContact O-N 3.34Å
34	F	98.7	Very high	98.5	Very high	75 Å²	75	64.1 Å²	64.1	33%	0.329	31%	0.308	S	S	.	.	H	α-helix	trans	-69.8	-34.1	176.5	-68.7	-53.8	0	0	0	111.8	F24 Y27 F31 Y32 K37 A38	F24-F34 HydrophobicContact CD1-CB 4.48Å; F24-F34 AromaticContact CD1-CD1 3.49Å; F24-F34 HydrophobicContact CD1-CD1 3.49Å; F24-F34 VanDerWaalsContact CD1-CD1 3.49Å; F24-F34 HydrophobicContact CD1-CE1 4.15Å; F24-F34 HydrophobicContact CD1-CG 4.39Å; F24-F34 AromaticContact CE1-CD1 3.61Å; F24-F34 HydrophobicContact CE1-CD1 3.61Å; F24-F34 AromaticContact CE1-CE1 3.83Å; F24-F34 HydrophobicContact CE1-CE1 3.83Å; Y27-F34 HydrophobicContact CD1-CD2 4.42Å; Y27-F34 HydrophobicContact CD1-CE2 4.38Å; Y27-F34 HydrophobicContact CG-CD2 4.16Å; Y27-F34 HydrophobicContact CG-CE2 4.38Å; F31-F34 HydrophobicContact CB-CD2 3.63Å; F31-F34 HydrophobicContact CB-CE2 4.33Å; F31-F34 AromaticContact CD2-CD2 3.74Å; F31-F34 HydrophobicContact CD2-CD2 3.74Å; F31-F34 HydrophobicContact CD2-CE2 4.02Å; F31-F34 AromaticContact CG-CD2 3.92Å; F31-F34 HydrophobicContact CG-CD2 3.92Å; F31-F34 HydrophobicContact CG-CE2 4.25Å; F31-F34 PolarHBondContact O-N 3.22Å; Y32-F34 VanDerWaalsContact C-N 3.33Å; Y32-F34 PolarHBondContact O-N 3.05Å; F34-K37 PolarHBondContact O-N 2.97Å; F34-A38 WeakPolarHBondContact O-CB 3.49Å; F34-A38 PolarHBondContact O-N 2.97Å
35	A	98.7	Very high	98.5	Very high	0 Å²	0	61.5 Å²	61.5	0%	0	30%	0.296	C	S	.	.	H	α-helix	trans	-65	-38.5	171.8	0	0	0	0	0	112.4	F31 Y32 G39 S68 Q71 Q72	F31-A35 PolarHBondContact O-N 2.95Å; Y32-A35 WeakPolarHBondContact O-CB 3.33Å; Y32-A35 PolarHBondContact O-N 2.95Å; A35-G39 PolarHBondContact O-N 3.41Å; A35-S68 WeakPolarHBondContact O-CB 3.44Å; A35-Q71 HydrophobicContact CB-CB 3.52Å; A35-Q72 HydrophobicContact CB-CG 3.8Å; A35-Q72 PolarHBondContact O-NE2 3.24Å; A35-Q72 VanDerWaalsContact O-NE2 3.09Å
36	V	98.7	Very high	98.5	Very high	45 Å²	45	62.6 Å²	62.6	27%	0.273	30%	0.3	S	S	.	.	H	α-helix	trans	-62.8	-46.3	172	173.8	0	0	0	0	110	Y32 E33 A38 G39 E40 Q72	Y32-V36 HydrophobicContact CD1-CG2 4.12Å; Y32-V36 HydrophobicContact CE1-CG2 3.6Å; Y32-V36 HydrophobicContact CE2-CG2 4.38Å; Y32-V36 WeakPolarHBondContact O-CG2 3.47Å; Y32-V36 PolarHBondContact O-N 3.1Å; E33-V36 PolarHBondContact O-N 3.11Å; V36-A38 PolarHBondContact O-N 3.05Å; V36-G39 WeakPolarHBondContact O-CA 3.47Å; V36-G39 PolarHBondContact O-N 3.02Å; V36-G39 VanDerWaalsContact O-N 3.07Å; V36-E40 PolarHBondContact O-N 3.18Å; V36-E40 VanDerWaalsContact O-N 3.08Å; V36-Q72 HydrophobicContact CG2-CG 4.14Å
37	K	98.6	Very high	98.5	Very high	87 Å²	87	68.1 Å²	68.1	38%	0.378	31%	0.309	S	S	.	.	H	α-helix	trans	-63.7	-40.4	-179.4	-167.2	57.1	174.8	-178.2	0	113.2	F24 E33 F34 G39 E40 I41	F24-K37 HydrophobicContact CD1-CB 3.87Å; F24-K37 HydrophobicContact CD1-CG 3.68Å; F24-K37 HydrophobicContact CD2-CG 4.41Å; F24-K37 HydrophobicContact CE1-CB 4.2Å; F24-K37 HydrophobicContact CE1-CG 3.65Å; F24-K37 HydrophobicContact CE2-CG 4.38Å; F24-K37 HydrophobicContact CG-CB 4.41Å; F24-K37 HydrophobicContact CG-CG 4.09Å; F24-K37 HydrophobicContact CZ-CG 4.02Å; E33-K37 PolarHBondContact O-N 3.34Å; F34-K37 PolarHBondContact O-N 2.97Å; K37-G39 PolarHBondContact O-N 3.38Å; K37-E40 WeakPolarHBondContact CD-OE2 3.49Å; K37-E40 IonicContact NZ-OE2 2.77Å; K37-E40 PolarHBondContact NZ-OE2 3.32Å; K37-E40 WeakPolarHBondContact O-CB 3.49Å; K37-E40 PolarHBondContact O-N 3.42Å; K37-I41 HydrophobicContact CG-CD1 4.36Å; K37-I41 WeakPolarHBondContact O-CG1 3.38Å; K37-I41 PolarHBondContact O-N 3.11Å
38	A	98.7	Very high	98.5	Very high	2 Å²	2	62.7 Å²	62.7	2%	0.017	29%	0.289	C	S	.	.	H	α-helix	trans	-58.6	-37.6	173.3	0	0	0	0	0	111.7	F24 F34 V36 S42	F24-A38 HydrophobicContact CB-CB 4.09Å; F34-A38 WeakPolarHBondContact O-CB 3.49Å; F34-A38 PolarHBondContact O-N 2.97Å; V36-A38 PolarHBondContact O-N 3.05Å; A38-S42 WeakPolarHBondContact O-CB 3.38Å; A38-S42 PolarHBondContact O-N 3.21Å; A38-S42 PolarHBondContact O-OG 2.89Å
39	G	98.7	Very high	98.5	Very high	3 Å²	3	62.5 Å²	62.5	3%	0.031	29%	0.287	C	S	.	.	H	α-helix	trans	-64.1	-46.3	174.2	0	0	0	0	0	112.9	A35 V36 K37 I41 S42 T43 S68	A35-G39 PolarHBondContact O-N 3.41Å; V36-G39 WeakPolarHBondContact O-CA 3.47Å; V36-G39 PolarHBondContact O-N 3.02Å; V36-G39 VanDerWaalsContact O-N 3.07Å; K37-G39 PolarHBondContact O-N 3.38Å; G39-I41 PolarHBondContact O-N 3.04Å; G39-S42 WeakPolarHBondContact O-CB 3.45Å; G39-S42 PolarHBondContact O-N 3.32Å; G39-T43 VanDerWaalsContact O-CG2 3.31Å; G39-T43 WeakPolarHBondContact O-CG2 3.43Å; G39-T43 PolarHBondContact O-N 3.04Å; G39-S68 WeakPolarHBondContact CA-OG 3.31Å
40	E	98.6	Very high	98.4	Very high	90 Å²	90	62.5 Å²	62.5	42%	0.421	29%	0.287	S	S	.	.	H	α-helix	trans	-58.9	-45.6	175.4	-65.9	175.5	-178.9	0	0	111.9	V36 K37 S42 T43 T44	V36-E40 PolarHBondContact O-N 3.18Å; V36-E40 VanDerWaalsContact O-N 3.08Å; K37-E40 WeakPolarHBondContact CD-OE2 3.49Å; K37-E40 IonicContact NZ-OE2 2.77Å; K37-E40 PolarHBondContact NZ-OE2 3.32Å; K37-E40 WeakPolarHBondContact O-CB 3.49Å; K37-E40 PolarHBondContact O-N 3.42Å; E40-S42 VanDerWaalsContact C-N 3.35Å; E40-S42 PolarHBondContact O-N 3.43Å; E40-T43 PolarHBondContact O-N 3.15Å; E40-T43 PolarHBondContact O-OG1 3.23Å; E40-T44 PolarHBondContact O-N 3.15Å; E40-T44 PolarHBondContact O-OG1 3.22Å; E40-T44 VanDerWaalsContact O-OG1 3.06Å
41	I	98.6	Very high	98.4	Very high	13 Å²	13	59.6 Å²	59.6	7%	0.067	28%	0.283	C	S	.	.	H	α-helix	trans	-59.9	-47.8	176.3	-70.1	169.4	0	0	0	109.9	L17 F24 K37 G39 T43 T44 Q45	L17-I41 HydrophobicContact CB-CG2 4.2Å; L17-I41 HydrophobicContact CD2-CG2 4.17Å; L17-I41 WeakPolarHBondContact O-CG2 3.49Å; F24-I41 HydrophobicContact CB-CD1 4.25Å; F24-I41 HydrophobicContact CD2-CD1 3.25Å; F24-I41 HydrophobicContact CE2-CD1 3.82Å; F24-I41 HydrophobicContact CG-CD1 3.92Å; K37-I41 HydrophobicContact CG-CD1 4.36Å; K37-I41 WeakPolarHBondContact O-CG1 3.38Å; K37-I41 PolarHBondContact O-N 3.11Å; G39-I41 PolarHBondContact O-N 3.04Å; I41-T43 VanDerWaalsContact C-N 3.28Å; I41-T43 PolarHBondContact O-N 3.17Å; I41-T44 WeakPolarHBondContact O-CA 3.34Å; I41-T44 WeakPolarHBondContact O-CB 3.37Å; I41-T44 PolarHBondContact O-N 3.17Å; I41-Q45 HydrophobicContact CG2-CG 4.29Å; I41-Q45 WeakPolarHBondContact O-CG 3.43Å; I41-Q45 PolarHBondContact O-N 3.21Å
42	S	98.6	Very high	98.3	Very high	5 Å²	5	55.1 Å²	55.1	4%	0.035	26%	0.264	C	S	.	.	H	α-helix	trans	-58.9	-38.4	178.7	-58.9	0	0	0	0	112.4	A38 G39 E40 T44 Q45 L46 Y64 Y65	A38-S42 WeakPolarHBondContact O-CB 3.38Å; A38-S42 PolarHBondContact O-N 3.21Å; A38-S42 PolarHBondContact O-OG 2.89Å; G39-S42 WeakPolarHBondContact O-CB 3.45Å; G39-S42 PolarHBondContact O-N 3.32Å; E40-S42 VanDerWaalsContact C-N 3.35Å; E40-S42 PolarHBondContact O-N 3.43Å; S42-T44 VanDerWaalsContact C-N 3.35Å; S42-Q45 PolarHBondContact O-N 3.48Å; S42-L46 WeakPolarHBondContact O-CB 3.26Å; S42-L46 PolarHBondContact O-N 3.44Å; S42-Y64 WeakPolarHBondContact OG-CB 3.33Å; S42-Y65 PolarHBondContact OG-N 2.96Å
43	T	98.4	Very high	98.1	Very high	49 Å²	49	52 Å²	52	30%	0.301	27%	0.268	S	S	.	.	H	α-helix	trans	-70	-31.9	175.4	67.5	0	0	0	0	112.9	G39 E40 I41 L46 R47 Y65	G39-T43 VanDerWaalsContact O-CG2 3.31Å; G39-T43 WeakPolarHBondContact O-CG2 3.43Å; G39-T43 PolarHBondContact O-N 3.04Å; E40-T43 PolarHBondContact O-N 3.15Å; E40-T43 PolarHBondContact O-OG1 3.23Å; I41-T43 VanDerWaalsContact C-N 3.28Å; I41-T43 PolarHBondContact O-N 3.17Å; T43-L46 PolarHBondContact O-N 2.82Å; T43-R47 WeakPolarHBondContact O-CG 3.34Å; T43-R47 PolarHBondContact O-N 3.16Å; T43-Y65 HydrophobicContact CG2-CD2 3.72Å; T43-Y65 HydrophobicContact CG2-CE2 3.68Å; T43-Y65 HydrophobicContact CG2-CG 4.41Å
44	T	98.4	Very high	98	Very high	57 Å²	57	48.9 Å²	48.9	35%	0.35	26%	0.256	S	S	.	.	H	α-helix	trans	-69.7	-44.6	174.1	-56.9	0	0	0	0	110.6	L17 E40 I41 S42 L46 R47 I48	L17-T44 HydrophobicContact CD1-CG2 3.89Å; E40-T44 PolarHBondContact O-N 3.15Å; E40-T44 PolarHBondContact O-OG1 3.22Å; E40-T44 VanDerWaalsContact O-OG1 3.06Å; I41-T44 WeakPolarHBondContact O-CA 3.34Å; I41-T44 WeakPolarHBondContact O-CB 3.37Å; I41-T44 PolarHBondContact O-N 3.17Å; S42-T44 VanDerWaalsContact C-N 3.35Å; T44-L46 VanDerWaalsContact C-N 3.29Å; T44-L46 PolarHBondContact O-N 3.12Å; T44-R47 WeakPolarHBondContact O-CB 3.36Å; T44-R47 PolarHBondContact O-N 2.95Å; T44-I48 HydrophobicContact CG2-CD1 4.46Å; T44-I48 PolarHBondContact O-N 2.85Å; T44-I48 VanDerWaalsContact O-N 3.15Å
45	Q	98.2	Very high	97.9	Very high	3 Å²	3	51.5 Å²	51.5	1%	0.014	27%	0.269	C	S	.	.	H	α-helix	trans	-59.3	-39.7	173.1	-66.7	-178.9	-62.9	0	0	111.8	L17 S18 I41 S42 R47 I48 A49 C61	L17-Q45 HydrophobicContact CB-CG 3.57Å; L17-Q45 HydrophobicContact CD1-CG 4.04Å; L17-Q45 HydrophobicContact CG-CG 4.44Å; S18-Q45 VanDerWaalsContact N-NE2 3.16Å; I41-Q45 HydrophobicContact CG2-CG 4.29Å; I41-Q45 WeakPolarHBondContact O-CG 3.43Å; I41-Q45 PolarHBondContact O-N 3.21Å; S42-Q45 PolarHBondContact O-N 3.48Å; Q45-R47 VanDerWaalsContact C-N 3.33Å; Q45-R47 PolarHBondContact O-N 3.35Å; Q45-I48 PolarHBondContact O-N 3.49Å; Q45-A49 WeakPolarHBondContact O-CB 3.44Å; Q45-A49 PolarHBondContact O-N 3.27Å; Q45-C61 VanDerWaalsContact C-SG 3.59Å; Q45-C61 HydrophobicContact CB-CB 4.45Å; Q45-C61 WeakPolarHBondContact CB-SG 3.47Å
46	L	98.4	Very high	97.7	Very high	44 Å²	44	56.4 Å²	56.4	23%	0.23	30%	0.295	C	S	.	.	H	α-helix	trans	-59.9	-42.4	176.2	178.2	60.4	0	0	0	112	S42 T43 T44 A49 L50 V58 C61 R62	S42-L46 WeakPolarHBondContact O-CB 3.26Å; S42-L46 PolarHBondContact O-N 3.44Å; T43-L46 PolarHBondContact O-N 2.82Å; T44-L46 VanDerWaalsContact C-N 3.29Å; T44-L46 PolarHBondContact O-N 3.12Å; L46-A49 PolarHBondContact O-N 3.02Å; L46-L50 HydrophobicContact CD1-CD1 4.46Å; L46-L50 HydrophobicContact CD1-CG 4.42Å; L46-L50 HydrophobicContact CG-CD1 4.31Å; L46-L50 WeakPolarHBondContact O-CG 3.47Å; L46-L50 PolarHBondContact O-N 3.5Å; L46-V58 HydrophobicContact CD1-CB 4.31Å; L46-V58 HydrophobicContact CD1-CG1 3.89Å; L46-V58 HydrophobicContact CD1-CG2 4.35Å; L46-C61 HydrophobicContact CB-CB 3.86Å; L46-C61 HydrophobicContact CD1-CB 4.23Å; L46-R62 HydrophobicContact CD1-CG 4.24Å; L46-R62 HydrophobicContact CD2-CG 4.31Å
47	R	98.3	Very high	97.6	Very high	174 Å²	174	55.3 Å²	55.3	66%	0.657	29%	0.287	S	S	*	.	H	α-helix	trans	-61.2	-44.8	175.9	-68.5	173.9	-177.4	170.4	0.9	111.3	T43 T44 Q45 L50 L51	T43-R47 WeakPolarHBondContact O-CG 3.34Å; T43-R47 PolarHBondContact O-N 3.16Å; T44-R47 WeakPolarHBondContact O-CB 3.36Å; T44-R47 PolarHBondContact O-N 2.95Å; Q45-R47 VanDerWaalsContact C-N 3.33Å; Q45-R47 PolarHBondContact O-N 3.35Å; R47-L50 PolarHBondContact O-N 3.45Å; R47-L51 WeakPolarHBondContact O-CG 3.49Å; R47-L51 PolarHBondContact O-N 3.32Å; R47-L51 VanDerWaalsContact O-N 3.09Å
48	I	98.1	Very high	97.5	Very high	18 Å²	18	51.2 Å²	51.2	9%	0.092	27%	0.27	C	S	.	.	H	α-helix	trans	-62.9	-43.6	176.8	-66.3	165.5	0	0	0	110.8	L10 A13 L17 T44 Q45 L50 L51 L52	L10-I48 HydrophobicContact CB-CG2 4.18Å; L10-I48 HydrophobicContact CD2-CG1 4.33Å; L10-I48 HydrophobicContact CD2-CG2 4.23Å; L10-I48 WeakPolarHBondContact O-CG2 3.48Å; A13-I48 HydrophobicContact CB-CD1 4.24Å; L17-I48 HydrophobicContact CD1-CD1 3.46Å; L17-I48 VanDerWaalsContact CD1-CD1 3.46Å; T44-I48 HydrophobicContact CG2-CD1 4.46Å; T44-I48 PolarHBondContact O-N 2.85Å; T44-I48 VanDerWaalsContact O-N 3.15Å; Q45-I48 PolarHBondContact O-N 3.49Å; I48-L50 VanDerWaalsContact C-N 3.32Å; I48-L50 PolarHBondContact O-N 2.91Å; I48-L51 WeakPolarHBondContact O-CB 3.44Å; I48-L51 PolarHBondContact O-N 3.13Å; I48-L51 VanDerWaalsContact O-N 3.14Å; I48-L52 HydrophobicContact CG2-CD1 3.83Å; I48-L52 HydrophobicContact CG2-CG 4.31Å; I48-L52 WeakPolarHBondContact O-CG 3.43Å; I48-L52 PolarHBondContact O-N 3.37Å
49	A	98	Very high	97.5	Very high	0 Å²	0	52.6 Å²	52.6	0%	0	28%	0.279	C	S	.	.	H	α-helix	trans	-61.2	-39.6	179.7	0	0	0	0	0	112.8	Q45 L46 L52 G53 N54 L57 V58	Q45-A49 WeakPolarHBondContact O-CB 3.44Å; Q45-A49 PolarHBondContact O-N 3.27Å; L46-A49 PolarHBondContact O-N 3.02Å; A49-L52 PolarHBondContact O-N 2.95Å; A49-G53 PolarHBondContact O-N 3.43Å; A49-N54 PolarHBondContact O-N 3.18Å; A49-N54 VanDerWaalsContact O-N 3.1Å; A49-L57 HydrophobicContact CB-CB 3.96Å; A49-L57 HydrophobicContact CB-CD2 3.72Å; A49-L57 HydrophobicContact CB-CG 3.58Å; A49-V58 HydrophobicContact CB-CB 4.31Å; A49-V58 HydrophobicContact CB-CG2 3.51Å
50	L	98.1	Very high	97.4	Very high	104 Å²	104	58.1 Å²	58.1	55%	0.545	30%	0.299	S	S	.	.	H	α-helix	trans	-64.8	-43.6	173.5	-71	167.6	0	0	0	111.6	L46 R47 I48 L52 G53 V58	L46-L50 HydrophobicContact CD1-CD1 4.46Å; L46-L50 HydrophobicContact CD1-CG 4.42Å; L46-L50 HydrophobicContact CG-CD1 4.31Å; L46-L50 WeakPolarHBondContact O-CG 3.47Å; L46-L50 PolarHBondContact O-N 3.5Å; R47-L50 PolarHBondContact O-N 3.45Å; I48-L50 VanDerWaalsContact C-N 3.32Å; I48-L50 PolarHBondContact O-N 2.91Å; L50-L52 VanDerWaalsContact C-N 3.29Å; L50-L52 PolarHBondContact O-N 3.17Å; L50-G53 PolarHBondContact O-N 3.2Å; L50-G53 VanDerWaalsContact O-N 3.1Å; L50-V58 HydrophobicContact CD2-CG1 4.39Å; L50-V58 HydrophobicContact CD2-CG2 3.86Å; L50-V58 HydrophobicContact CG-CG2 4.03Å
51	L	96.7	Very high	97.4	Very high	126 Å²	126	53.9 Å²	53.9	66%	0.66	28%	0.279	S	S	*	.	H	α-helix	trans	-63.4	-34.8	176.4	-70.3	171.5	0	0	0	112.5	L10 R47 I48 G53	L10-L51 HydrophobicContact CD1-CB 4.14Å; L10-L51 HydrophobicContact CD2-CD1 4.4Å; R47-L51 WeakPolarHBondContact O-CG 3.49Å; R47-L51 PolarHBondContact O-N 3.32Å; R47-L51 VanDerWaalsContact O-N 3.09Å; I48-L51 WeakPolarHBondContact O-CB 3.44Å; I48-L51 PolarHBondContact O-N 3.13Å; I48-L51 VanDerWaalsContact O-N 3.14Å; L51-G53 VanDerWaalsContact C-N 3.28Å; L51-G53 PolarHBondContact O-N 3.22Å
52	L	96	Very high	97.4	Very high	9 Å²	9	55.6 Å²	55.6	5%	0.047	29%	0.285	C	S	.	.	H	α-helix	trans	-75.6	-14.2	175.8	-70.6	172.7	0	0	0	113.2	R7 L10 E11 I48 A49 L50 N54 L57	R7-L52 HydrophobicContact CG-CD2 3.72Å; R7-L52 PolarHBondContact NH1-O 3.21Å; R7-L52 PolarHBondContact NH2-O 3.46Å; L10-L52 HydrophobicContact CB-CD1 4.44Å; L10-L52 HydrophobicContact CB-CD2 3.73Å; L10-L52 HydrophobicContact CB-CG 4.14Å; L10-L52 HydrophobicContact CD1-CD2 4.26Å; E11-L52 HydrophobicContact CG-CD1 4.01Å; E11-L52 HydrophobicContact CG-CD2 3.94Å; I48-L52 HydrophobicContact CG2-CD1 3.83Å; I48-L52 HydrophobicContact CG2-CG 4.31Å; I48-L52 WeakPolarHBondContact O-CG 3.43Å; I48-L52 PolarHBondContact O-N 3.37Å; A49-L52 PolarHBondContact O-N 2.95Å; L50-L52 VanDerWaalsContact C-N 3.29Å; L50-L52 PolarHBondContact O-N 3.17Å; L52-N54 HydrophobicContact CB-CB 4.35Å; L52-N54 PolarHBondContact O-N 2.9Å; L52-L57 HydrophobicContact CD1-CD2 4.27Å
53	G	96	Very high	97.4	Very high	55 Å²	55	58.9 Å²	58.9	57%	0.567	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.9	27.5	-172.4	0	0	0	0	0	113.2	A49 L50 L51	A49-G53 PolarHBondContact O-N 3.43Å; L50-G53 PolarHBondContact O-N 3.2Å; L50-G53 VanDerWaalsContact O-N 3.1Å; L51-G53 VanDerWaalsContact C-N 3.28Å; L51-G53 PolarHBondContact O-N 3.22Å
54	N	95.8	Very high	97.5	Very high	68 Å²	68	61 Å²	61	36%	0.364	31%	0.305	S	S	.	.			trans	-98.3	92.1	-177.3	-173.9	-26.3	0	0	0	110.7	A49 L52 L56 L57 V58	A49-N54 PolarHBondContact O-N 3.18Å; A49-N54 VanDerWaalsContact O-N 3.1Å; L52-N54 HydrophobicContact CB-CB 4.35Å; L52-N54 PolarHBondContact O-N 2.9Å; N54-L56 VanDerWaalsContact C-N 3.28Å; N54-L56 PolarHBondContact O-N 3.21Å; N54-L56 PolarHBondContact OD1-N 3.44Å; N54-L57 HydrophobicContact CB-CB 3.84Å; N54-L57 VanDerWaalsContact CG-CB 3.44Å; N54-L57 WeakPolarHBondContact O-CB 3.43Å; N54-L57 PolarHBondContact O-N 2.9Å; N54-L57 VanDerWaalsContact O-N 3.11Å; N54-L57 WeakPolarHBondContact OD1-CB 3.49Å; N54-L57 PolarHBondContact OD1-N 3.48Å; N54-V58 WeakPolarHBondContact O-CG2 3.41Å; N54-V58 PolarHBondContact O-N 2.93Å
55	E	95.3	Very high	97.5	Very high	130 Å²	130	62.4 Å²	62.4	61%	0.607	30%	0.304	S	S	*	.	H	α-helix	trans	-59.3	-35.2	-177.8	-69.2	-55.5	137.4	0	0	113.9	V58 S59	E55-V58 WeakPolarHBondContact O-CB 3.4Å; E55-V58 PolarHBondContact O-N 3.5Å; E55-S59 PolarHBondContact O-N 3Å
56	L	95.2	Very high	97.5	Very high	103 Å²	103	62.3 Å²	62.3	54%	0.539	30%	0.304	S	S	.	.	H	α-helix	trans	-67.8	-41.8	177.1	-179.3	60.2	0	0	0	111.1	N54 S59 R60	N54-L56 VanDerWaalsContact C-N 3.28Å; N54-L56 PolarHBondContact O-N 3.21Å; N54-L56 PolarHBondContact OD1-N 3.44Å; L56-S59 WeakPolarHBondContact O-CB 3.39Å; L56-S59 PolarHBondContact O-N 3.42Å; L56-R60 WeakPolarHBondContact O-CG 3.34Å; L56-R60 PolarHBondContact O-N 2.78Å
57	L	96.2	Very high	97.5	Very high	22 Å²	22	63.6 Å²	63.6	12%	0.115	31%	0.311	C	S	.	.	H	α-helix	trans	-65.7	-42	175.8	-175.5	61.6	0	0	0	110.9	A49 L52 N54 S59 R60 C61	A49-L57 HydrophobicContact CB-CB 3.96Å; A49-L57 HydrophobicContact CB-CD2 3.72Å; A49-L57 HydrophobicContact CB-CG 3.58Å; L52-L57 HydrophobicContact CD1-CD2 4.27Å; N54-L57 HydrophobicContact CB-CB 3.84Å; N54-L57 VanDerWaalsContact CG-CB 3.44Å; N54-L57 WeakPolarHBondContact O-CB 3.43Å; N54-L57 PolarHBondContact O-N 2.9Å; N54-L57 VanDerWaalsContact O-N 3.11Å; N54-L57 WeakPolarHBondContact OD1-CB 3.49Å; N54-L57 PolarHBondContact OD1-N 3.48Å; L57-S59 VanDerWaalsContact C-N 3.31Å; L57-S59 PolarHBondContact O-N 2.87Å; L57-R60 PolarHBondContact O-N 2.94Å; L57-R60 VanDerWaalsContact O-N 3.15Å; L57-C61 PolarHBondContact O-N 3.38Å; L57-C61 PolarHBondContact O-SG 3.3Å
58	V	98.1	Very high	97.5	Very high	1 Å²	1	55.3 Å²	55.3	1%	0.006	28%	0.279	C	S	.	.	H	α-helix	trans	-55.7	-44.9	174	161.7	0	0	0	0	111.3	L46 A49 L50 N54 E55 C61 R62	L46-V58 HydrophobicContact CD1-CB 4.31Å; L46-V58 HydrophobicContact CD1-CG1 3.89Å; L46-V58 HydrophobicContact CD1-CG2 4.35Å; A49-V58 HydrophobicContact CB-CB 4.31Å; A49-V58 HydrophobicContact CB-CG2 3.51Å; L50-V58 HydrophobicContact CD2-CG1 4.39Å; L50-V58 HydrophobicContact CD2-CG2 3.86Å; L50-V58 HydrophobicContact CG-CG2 4.03Å; N54-V58 WeakPolarHBondContact O-CG2 3.41Å; N54-V58 PolarHBondContact O-N 2.93Å; E55-V58 WeakPolarHBondContact O-CB 3.4Å; E55-V58 PolarHBondContact O-N 3.5Å; V58-C61 PolarHBondContact O-N 3.01Å; V58-R62 VanDerWaalsContact CG1-CZ 3.47Å; V58-R62 PolarHBondContact O-N 3.25Å
59	S	97.6	Very high	97.6	Very high	30 Å²	30	54.7 Å²	54.7	21%	0.21	28%	0.276	C	S	.	.	H	α-helix	trans	-61	-48	174.4	-179.4	0	0	0	0	112.2	E55 L56 L57 C61 R62 L63 E85	E55-S59 PolarHBondContact O-N 3Å; L56-S59 WeakPolarHBondContact O-CB 3.39Å; L56-S59 PolarHBondContact O-N 3.42Å; L57-S59 VanDerWaalsContact C-N 3.31Å; L57-S59 PolarHBondContact O-N 2.87Å; S59-C61 PolarHBondContact O-N 3.02Å; S59-R62 PolarHBondContact O-N 2.97Å; S59-L63 PolarHBondContact O-N 2.76Å; S59-L63 VanDerWaalsContact O-N 3.11Å; S59-E85 WeakPolarHBondContact CA-OE2 3.39Å; S59-E85 WeakPolarHBondContact CB-OE2 3.48Å; S59-E85 PolarHBondContact OG-OE2 3.02Å
60	R	97.7	Very high	97.6	Very high	120 Å²	120	57.7 Å²	57.7	45%	0.453	29%	0.292	S	S	.	.	H	α-helix	trans	-58.4	-45.8	177	-71.4	176.8	-171.8	161.5	0.7	112.2	L56 L57 R62 L63 Y64	L56-R60 WeakPolarHBondContact O-CG 3.34Å; L56-R60 PolarHBondContact O-N 2.78Å; L57-R60 PolarHBondContact O-N 2.94Å; L57-R60 VanDerWaalsContact O-N 3.15Å; R60-R62 VanDerWaalsContact C-N 3.28Å; R60-R62 PolarHBondContact O-N 3.48Å; R60-L63 CarbonylContact O-C 3.5Å; R60-L63 WeakPolarHBondContact O-CA 3.44Å; R60-L63 WeakPolarHBondContact O-CB 3.41Å; R60-L63 PolarHBondContact O-N 3.02Å; R60-Y64 HydrophobicContact CB-CE2 4.24Å; R60-Y64 VanDerWaalsContact O-CG 3.31Å; R60-Y64 PolarHBondContact O-N 3.27Å
61	C	98.5	Very high	97.6	Very high	0 Å²	0	53.8 Å²	53.8	0%	0	27%	0.27	C	S	.	.	H	α-helix	trans	-60.6	-37.1	179.2	-63.6	0	0	0	0	112.3	Q45 L46 L57 V58 S59 Y64 Y65	Q45-C61 VanDerWaalsContact C-SG 3.59Å; Q45-C61 HydrophobicContact CB-CB 4.45Å; Q45-C61 WeakPolarHBondContact CB-SG 3.47Å; L46-C61 HydrophobicContact CB-CB 3.86Å; L46-C61 HydrophobicContact CD1-CB 4.23Å; L57-C61 PolarHBondContact O-N 3.38Å; L57-C61 PolarHBondContact O-SG 3.3Å; V58-C61 PolarHBondContact O-N 3.01Å; S59-C61 PolarHBondContact O-N 3.02Å; C61-Y64 PolarHBondContact O-N 3.05Å; C61-Y65 WeakPolarHBondContact O-CB 3.27Å; C61-Y65 PolarHBondContact O-N 3.44Å
62	R	98.7	Very high	97.7	Very high	50 Å²	50	48.7 Å²	48.7	19%	0.189	24%	0.243	C	C	.	.	H	α-helix	trans	-66.7	-36.8	174	-71.7	-172.8	-62.9	-112.9	-1.6	112.2	L46 V58 S59 R60 Y65 A66 I81 E85	L46-R62 HydrophobicContact CD1-CG 4.24Å; L46-R62 HydrophobicContact CD2-CG 4.31Å; V58-R62 VanDerWaalsContact CG1-CZ 3.47Å; V58-R62 PolarHBondContact O-N 3.25Å; S59-R62 PolarHBondContact O-N 2.97Å; R60-R62 VanDerWaalsContact C-N 3.28Å; R60-R62 PolarHBondContact O-N 3.48Å; R62-Y65 PolarHBondContact O-N 2.95Å; R62-A66 WeakPolarHBondContact O-CB 3.39Å; R62-A66 PolarHBondContact O-N 3.21Å; R62-I81 HydrophobicContact CB-CG2 4.01Å; R62-I81 WeakPolarHBondContact O-CG2 3.47Å; R62-E85 HydrophobicContact CB-CG 4.5Å; R62-E85 IonicContact CZ-OE1 3.23Å; R62-E85 IonicContact NE-OE1 2.96Å; R62-E85 PolarHBondContact NE-OE1 3Å; R62-E85 IonicContact NE-OE2 3.14Å; R62-E85 IonicContact NH2-OE1 3.89Å; R62-E85 PolarHBondContact NH2-OE1 3.45Å; R62-E85 IonicContact NH2-OE2 2.6Å; R62-E85 PolarHBondContact NH2-OE2 2.85Å
63	L	98.6	Very high	97.8	Very high	73 Å²	73	58 Å²	58	38%	0.382	28%	0.278	S	S	.	.	H	α-helix	trans	-68.7	-39.7	174.2	-65.3	176.5	0	0	0	112.4	S59 R60 Y65 A66 L67 I82 E85	S59-L63 PolarHBondContact O-N 2.76Å; S59-L63 VanDerWaalsContact O-N 3.11Å; R60-L63 CarbonylContact O-C 3.5Å; R60-L63 WeakPolarHBondContact O-CA 3.44Å; R60-L63 WeakPolarHBondContact O-CB 3.41Å; R60-L63 PolarHBondContact O-N 3.02Å; L63-Y65 VanDerWaalsContact C-N 3.34Å; L63-A66 WeakPolarHBondContact O-CB 3.45Å; L63-A66 PolarHBondContact O-N 3.13Å; L63-L67 PolarHBondContact O-N 3.04Å; L63-I82 HydrophobicContact CD2-CG1 4.41Å; L63-E85 HydrophobicContact CD2-CB 4.09Å; L63-E85 HydrophobicContact CD2-CG 3.88Å; L63-E85 HydrophobicContact CG-CG 4.2Å
64	Y	98.7	Very high	98	Very high	94 Å²	94	59.5 Å²	59.5	37%	0.369	27%	0.269	S	S	.	.	H	α-helix	trans	-62.6	-42.6	173.1	-59.2	-23.2	0	0	0	111.5	S42 R60 C61 A66 L67 S68	S42-Y64 WeakPolarHBondContact OG-CB 3.33Å; R60-Y64 HydrophobicContact CB-CE2 4.24Å; R60-Y64 VanDerWaalsContact O-CG 3.31Å; R60-Y64 PolarHBondContact O-N 3.27Å; C61-Y64 PolarHBondContact O-N 3.05Å; Y64-A66 VanDerWaalsContact C-N 3.34Å; Y64-A66 PolarHBondContact O-N 3.02Å; Y64-L67 WeakPolarHBondContact O-CB 3.32Å; Y64-L67 PolarHBondContact O-N 3.46Å; Y64-S68 PolarHBondContact O-N 3.41Å
65	Y	98.8	Very high	98.1	Very high	86 Å²	86	61.2 Å²	61.2	34%	0.337	28%	0.277	S	S	.	.	H	α-helix	trans	-62	-41.8	173.4	-174.2	-116.8	0	0	0	111.8	S42 T43 C61 R62 L63 L67 S68 L69 I81	S42-Y65 PolarHBondContact OG-N 2.96Å; T43-Y65 HydrophobicContact CG2-CD2 3.72Å; T43-Y65 HydrophobicContact CG2-CE2 3.68Å; T43-Y65 HydrophobicContact CG2-CG 4.41Å; C61-Y65 WeakPolarHBondContact O-CB 3.27Å; C61-Y65 PolarHBondContact O-N 3.44Å; R62-Y65 PolarHBondContact O-N 2.95Å; L63-Y65 VanDerWaalsContact C-N 3.34Å; Y65-L67 VanDerWaalsContact C-N 3.32Å; Y65-L67 PolarHBondContact O-N 3.18Å; Y65-S68 PolarHBondContact O-N 3.2Å; Y65-S68 PolarHBondContact O-OG 3.49Å; Y65-L69 HydrophobicContact CD1-CD1 4.12Å; Y65-L69 HydrophobicContact CE1-CD1 3.84Å; Y65-L69 HydrophobicContact CE1-CG 4.36Å; Y65-L69 WeakPolarHBondContact O-CG 3.38Å; Y65-L69 PolarHBondContact O-N 2.76Å; Y65-L69 VanDerWaalsContact O-N 3.08Å; Y65-I81 HydrophobicContact CD1-CD1 3.76Å; Y65-I81 HydrophobicContact CE1-CD1 4.11Å
66	A	98.8	Very high	98.3	Very high	1 Å²	1	65.9 Å²	65.9	1%	0.008	29%	0.289	C	S	.	.	H	α-helix	trans	-61.7	-37.9	174.4	0	0	0	0	0	112.7	R62 L63 Y64 L69 I70 A78 I81 I82	R62-A66 WeakPolarHBondContact O-CB 3.39Å; R62-A66 PolarHBondContact O-N 3.21Å; L63-A66 WeakPolarHBondContact O-CB 3.45Å; L63-A66 PolarHBondContact O-N 3.13Å; Y64-A66 VanDerWaalsContact C-N 3.34Å; Y64-A66 PolarHBondContact O-N 3.02Å; A66-L69 WeakPolarHBondContact O-CB 3.42Å; A66-L69 PolarHBondContact O-N 3.06Å; A66-I70 WeakPolarHBondContact O-CG1 3.2Å; A66-I70 PolarHBondContact O-N 3.26Å; A66-A78 HydrophobicContact CB-CB 4.45Å; A66-A78 WeakPolarHBondContact O-CB 3.47Å; A66-I81 HydrophobicContact CB-CB 4.12Å; A66-I81 HydrophobicContact CB-CD1 4.41Å; A66-I81 HydrophobicContact CB-CG2 3.98Å; A66-I82 HydrophobicContact CB-CD1 4.42Å; A66-I82 HydrophobicContact CB-CG1 4.05Å
67	L	98.8	Very high	98.4	Very high	72 Å²	72	65.6 Å²	65.6	38%	0.377	29%	0.288	S	S	.	.	H	α-helix	trans	-62.5	-45.5	174.2	-178.6	59.4	0	0	0	111.3	S25 L63 Y64 Y65 L69 I70 Q71	S25-L67 WeakPolarHBondContact OG-CD2 3.18Å; L63-L67 PolarHBondContact O-N 3.04Å; Y64-L67 WeakPolarHBondContact O-CB 3.32Å; Y64-L67 PolarHBondContact O-N 3.46Å; Y65-L67 VanDerWaalsContact C-N 3.32Å; Y65-L67 PolarHBondContact O-N 3.18Å; L67-L69 PolarHBondContact O-N 2.98Å; L67-I70 WeakPolarHBondContact O-CA 3.49Å; L67-I70 WeakPolarHBondContact O-CB 3.44Å; L67-I70 PolarHBondContact O-N 3.08Å; L67-Q71 WeakPolarHBondContact O-CG 3.4Å; L67-Q71 PolarHBondContact O-N 3.25Å
68	S	98.8	Very high	98.5	Very high	0 Å²	0	64.7 Å²	64.7	0%	0	28%	0.283	C	S	.	.	H	α-helix	trans	-57.9	-36.4	175.2	82.9	0	0	0	0	112.5	A35 G39 Y64 Y65 Q71 Q72	A35-S68 WeakPolarHBondContact O-CB 3.44Å; G39-S68 WeakPolarHBondContact CA-OG 3.31Å; Y64-S68 PolarHBondContact O-N 3.41Å; Y65-S68 PolarHBondContact O-N 3.2Å; Y65-S68 PolarHBondContact O-OG 3.49Å; S68-Q71 PolarHBondContact O-N 2.65Å; S68-Q72 WeakPolarHBondContact O-CB 3.46Å; S68-Q72 VanDerWaalsContact O-CG 3.23Å; S68-Q72 WeakPolarHBondContact O-CG 3.42Å; S68-Q72 PolarHBondContact O-N 3.48Å; S68-Q72 PolarHBondContact O-NE2 2.99Å
69	L	98.9	Very high	98.6	Very high	4 Å²	4	70 Å²	70	2%	0.021	31%	0.307	C	S	.	.	H	α-helix	trans	-68.9	-35.6	175.5	-69.4	170.8	0	0	0	112	Y65 A66 L67 Q72 R73 K74 L77 A78 I81	Y65-L69 HydrophobicContact CD1-CD1 4.12Å; Y65-L69 HydrophobicContact CE1-CD1 3.84Å; Y65-L69 HydrophobicContact CE1-CG 4.36Å; Y65-L69 WeakPolarHBondContact O-CG 3.38Å; Y65-L69 PolarHBondContact O-N 2.76Å; Y65-L69 VanDerWaalsContact O-N 3.08Å; A66-L69 WeakPolarHBondContact O-CB 3.42Å; A66-L69 PolarHBondContact O-N 3.06Å; L67-L69 PolarHBondContact O-N 2.98Å; L69-Q72 CarbonylContact O-C 3.6Å; L69-Q72 PolarHBondContact O-N 3.38Å; L69-R73 PolarHBondContact O-N 3.21Å; L69-K74 HydrophobicContact CB-CB 4.15Å; L69-K74 HydrophobicContact CD2-CB 3.96Å; L69-K74 HydrophobicContact CD2-CD 3.7Å; L69-K74 HydrophobicContact CD2-CG 4.45Å; L69-K74 WeakPolarHBondContact O-CA 3.2Å; L69-K74 WeakPolarHBondContact O-CB 3.49Å; L69-K74 PolarHBondContact O-N 2.98Å; L69-L77 HydrophobicContact CD1-CB 3.88Å; L69-A78 HydrophobicContact CB-CB 3.95Å; L69-I81 HydrophobicContact CD1-CD1 3.6Å
70	I	98.8	Very high	98.6	Very high	64 Å²	64	76.2 Å²	76.2	33%	0.328	33%	0.329	S	S	.	.	H	α-helix	trans	-63.7	-46.1	175.1	-69.1	166.4	0	0	0	110.1	A66 L67 Q72 R73 L75 A78 I82	A66-I70 WeakPolarHBondContact O-CG1 3.2Å; A66-I70 PolarHBondContact O-N 3.26Å; L67-I70 WeakPolarHBondContact O-CA 3.49Å; L67-I70 WeakPolarHBondContact O-CB 3.44Å; L67-I70 PolarHBondContact O-N 3.08Å; I70-Q72 VanDerWaalsContact C-N 3.28Å; I70-Q72 PolarHBondContact O-N 3.24Å; I70-R73 WeakPolarHBondContact O-CA 3.41Å; I70-R73 PolarHBondContact O-N 2.93Å; I70-L75 HydrophobicContact CB-CD2 4.43Å; I70-L75 HydrophobicContact CG1-CD2 4.3Å; I70-L75 HydrophobicContact CG2-CD2 4.17Å; I70-A78 HydrophobicContact CD1-CB 4.25Å; I70-A78 HydrophobicContact CG1-CB 3.59Å; I70-I82 HydrophobicContact CD1-CD1 4.28Å
71	Q	98.7	Very high	98.7	Very high	21 Å²	21	72.1 Å²	72.1	10%	0.098	32%	0.316	C	S	.	.	H	α-helix	trans	-60.3	-39.1	176.8	-67.8	173.6	-28.3	0	0	111.5	S25 D29 A35 L67 S68 R73	S25-Q71 PolarHBondContact O-NE2 3.07Å; S25-Q71 PolarHBondContact OG-NE2 3.24Å; D29-Q71 WeakPolarHBondContact OD1-CG 3.44Å; D29-Q71 PolarHBondContact OD1-NE2 3.35Å; A35-Q71 HydrophobicContact CB-CB 3.52Å; L67-Q71 WeakPolarHBondContact O-CG 3.4Å; L67-Q71 PolarHBondContact O-N 3.25Å; S68-Q71 PolarHBondContact O-N 2.65Å; Q71-R73 PolarHBondContact O-N 3.47Å
72	Q	98.6	Very high	98.7	Very high	19 Å²	19	75.6 Å²	75.6	9%	0.089	33%	0.334	C	S	.	.	T	Hydrogen-bonded Turn	trans	-76	6.5	171.8	-66.7	169.9	51.5	0	0	114.6	Y32 A35 V36 S68 L69 I70 K74	Y32-Q72 HydrophobicContact CD2-CB 4.4Å; Y32-Q72 HydrophobicContact CD2-CG 4.23Å; Y32-Q72 HydrophobicContact CE2-CB 3.85Å; Y32-Q72 HydrophobicContact CE2-CG 3.81Å; A35-Q72 HydrophobicContact CB-CG 3.8Å; A35-Q72 PolarHBondContact O-NE2 3.24Å; A35-Q72 VanDerWaalsContact O-NE2 3.09Å; V36-Q72 HydrophobicContact CG2-CG 4.14Å; S68-Q72 WeakPolarHBondContact O-CB 3.46Å; S68-Q72 VanDerWaalsContact O-CG 3.23Å; S68-Q72 WeakPolarHBondContact O-CG 3.42Å; S68-Q72 PolarHBondContact O-N 3.48Å; S68-Q72 PolarHBondContact O-NE2 2.99Å; L69-Q72 CarbonylContact O-C 3.6Å; L69-Q72 PolarHBondContact O-N 3.38Å; I70-Q72 VanDerWaalsContact C-N 3.28Å; I70-Q72 PolarHBondContact O-N 3.24Å; Q72-K74 HydrophobicContact CB-CD 4.22Å; Q72-K74 HydrophobicContact CB-CG 4.22Å; Q72-K74 PolarHBondContact O-N 3.06Å; Q72-K74 VanDerWaalsContact O-N 3.15Å
73	R	98.3	Very high	98.6	Very high	206 Å²	206	80.7 Å²	80.7	78%	0.777	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.3	15.5	-176.1	-49.1	-60.4	-176.9	176.7	-2.3	115.4	L69 I70 Q71 L75	L69-R73 PolarHBondContact O-N 3.21Å; I70-R73 WeakPolarHBondContact O-CA 3.41Å; I70-R73 PolarHBondContact O-N 2.93Å; Q71-R73 PolarHBondContact O-N 3.47Å; R73-L75 PolarHBondContact O-N 3.21Å
74	K	98.6	Very high	98.6	Very high	85 Å²	85	83.6 Å²	83.6	37%	0.37	36%	0.36	S	S	.	.			trans	-83.3	54	176.5	-63.7	176	-178.4	163.2	0	111.9	L69 Q72 R76 L77 A78	L69-K74 HydrophobicContact CB-CB 4.15Å; L69-K74 HydrophobicContact CD2-CB 3.96Å; L69-K74 HydrophobicContact CD2-CD 3.7Å; L69-K74 HydrophobicContact CD2-CG 4.45Å; L69-K74 WeakPolarHBondContact O-CA 3.2Å; L69-K74 WeakPolarHBondContact O-CB 3.49Å; L69-K74 PolarHBondContact O-N 2.98Å; Q72-K74 HydrophobicContact CB-CD 4.22Å; Q72-K74 HydrophobicContact CB-CG 4.22Å; Q72-K74 PolarHBondContact O-N 3.06Å; Q72-K74 VanDerWaalsContact O-N 3.15Å; K74-R76 VanDerWaalsContact C-N 3.32Å; K74-R76 PolarHBondContact O-N 3.08Å; K74-L77 PolarHBondContact O-N 2.77Å; K74-A78 PolarHBondContact O-N 2.71Å
75	L	98.6	Very high	98.5	Very high	105 Å²	105	79.7 Å²	79.7	55%	0.55	35%	0.345	S	S	.	.	H	α-helix	trans	-60.1	-34.3	-168.9	-58.4	-179	0	0	0	114.4	I70 R73 K79	I70-L75 HydrophobicContact CB-CD2 4.43Å; I70-L75 HydrophobicContact CG1-CD2 4.3Å; I70-L75 HydrophobicContact CG2-CD2 4.17Å; R73-L75 PolarHBondContact O-N 3.21Å; L75-K79 VanDerWaalsContact O-CB 3.26Å; L75-K79 WeakPolarHBondContact O-CB 3.4Å; L75-K79 PolarHBondContact O-N 3.3Å
76	R	98.6	Very high	98.3	Very high	228 Å²	228	81.9 Å²	81.9	86%	0.86	36%	0.356	S	S	*	.	H	α-helix	trans	-64.2	-42.6	179.8	-62.8	-176.7	-169.1	172.4	3.6	111.8	K74 K80	K74-R76 VanDerWaalsContact C-N 3.32Å; K74-R76 PolarHBondContact O-N 3.08Å; R76-K80 PolarHBondContact O-N 3.36Å
77	L	98.6	Very high	98.1	Very high	97 Å²	97	83.8 Å²	83.8	51%	0.508	38%	0.376	S	S	.	.	H	α-helix	trans	-69.9	-45.6	178.7	-67.1	176.4	0	0	0	111	L69 K74 K79 K80 I81	L69-L77 HydrophobicContact CD1-CB 3.88Å; K74-L77 PolarHBondContact O-N 2.77Å; L77-K79 VanDerWaalsContact C-N 3.32Å; L77-K79 PolarHBondContact O-N 3.42Å; L77-K80 WeakPolarHBondContact O-CB 3.23Å; L77-K80 PolarHBondContact O-N 2.85Å; L77-K80 VanDerWaalsContact O-N 3.13Å; L77-I81 PolarHBondContact O-N 3.2Å
78	A	98.7	Very high	97.6	Very high	2 Å²	2	82.8 Å²	82.8	2%	0.017	37%	0.373	C	S	.	.	H	α-helix	trans	-56.1	-46.7	175.7	0	0	0	0	0	111.8	A66 L69 I70 K74 K80 I81 I82	A66-A78 HydrophobicContact CB-CB 4.45Å; A66-A78 WeakPolarHBondContact O-CB 3.47Å; L69-A78 HydrophobicContact CB-CB 3.95Å; I70-A78 HydrophobicContact CD1-CB 4.25Å; I70-A78 HydrophobicContact CG1-CB 3.59Å; K74-A78 PolarHBondContact O-N 2.71Å; A78-K80 VanDerWaalsContact C-N 3.3Å; A78-K80 PolarHBondContact O-N 2.91Å; A78-I81 PolarHBondContact O-N 3.11Å; A78-I82 WeakPolarHBondContact O-CG1 3.42Å; A78-I82 PolarHBondContact O-N 3.09Å
79	K	98.7	Very high	97.1	Very high	114 Å²	114	88 Å²	88	50%	0.496	40%	0.396	S	S	.	.	H	α-helix	trans	-58.8	-39	177.5	-171.1	-179	-164.2	-178.1	0	112.7	L75 L77 R83	L75-K79 VanDerWaalsContact O-CB 3.26Å; L75-K79 WeakPolarHBondContact O-CB 3.4Å; L75-K79 PolarHBondContact O-N 3.3Å; L77-K79 VanDerWaalsContact C-N 3.32Å; L77-K79 PolarHBondContact O-N 3.42Å; K79-R83 WeakPolarHBondContact O-CB 3.17Å; K79-R83 VanDerWaalsContact O-CG 3.28Å; K79-R83 WeakPolarHBondContact O-CG 3.49Å; K79-R83 PolarHBondContact O-N 3.37Å
80	K	98.6	Very high	96.5	Very high	159 Å²	159	93.5 Å²	93.5	69%	0.691	42%	0.42	S	S	*	.	H	α-helix	trans	-62.5	-44.9	177.4	-175	177.8	177.2	-179.5	0	110.9	R76 L77 A78 Y84	R76-K80 PolarHBondContact O-N 3.36Å; L77-K80 WeakPolarHBondContact O-CB 3.23Å; L77-K80 PolarHBondContact O-N 2.85Å; L77-K80 VanDerWaalsContact O-N 3.13Å; A78-K80 VanDerWaalsContact C-N 3.3Å; A78-K80 PolarHBondContact O-N 2.91Å; K80-Y84 PolarHBondContact O-N 3.15Å; K80-Y84 VanDerWaalsContact O-N 3.1Å
81	I	98.6	Very high	95.8	Very high	35 Å²	35	98 Å²	98	18%	0.179	44%	0.437	C	S	.	.	H	α-helix	trans	-66.1	-47.7	179.3	-64	161.5	0	0	0	111.1	R62 Y65 A66 L69 L77 A78 R83 Y84 E85	R62-I81 HydrophobicContact CB-CG2 4.01Å; R62-I81 WeakPolarHBondContact O-CG2 3.47Å; Y65-I81 HydrophobicContact CD1-CD1 3.76Å; Y65-I81 HydrophobicContact CE1-CD1 4.11Å; A66-I81 HydrophobicContact CB-CB 4.12Å; A66-I81 HydrophobicContact CB-CD1 4.41Å; A66-I81 HydrophobicContact CB-CG2 3.98Å; L69-I81 HydrophobicContact CD1-CD1 3.6Å; L77-I81 PolarHBondContact O-N 3.2Å; A78-I81 PolarHBondContact O-N 3.11Å; I81-R83 VanDerWaalsContact C-N 3.3Å; I81-R83 PolarHBondContact O-N 3.36Å; I81-Y84 WeakPolarHBondContact O-CB 3.43Å; I81-Y84 PolarHBondContact O-N 2.76Å; I81-Y84 VanDerWaalsContact O-N 3.11Å; I81-E85 PolarHBondContact O-N 3.22Å
82	I	98.5	Very high	94.9	Very high	72 Å²	72	100.9 Å²	100.9	37%	0.369	46%	0.456	S	S	.	.	H	α-helix	trans	-61.2	-39.8	-179.8	-66	164.1	0	0	0	111.2	L63 A66 I70 A78 E85 K86	L63-I82 HydrophobicContact CD2-CG1 4.41Å; A66-I82 HydrophobicContact CB-CD1 4.42Å; A66-I82 HydrophobicContact CB-CG1 4.05Å; I70-I82 HydrophobicContact CD1-CD1 4.28Å; A78-I82 WeakPolarHBondContact O-CG1 3.42Å; A78-I82 PolarHBondContact O-N 3.09Å; I82-E85 PolarHBondContact O-N 3.4Å; I82-K86 VanDerWaalsContact O-CB 3.29Å; I82-K86 WeakPolarHBondContact O-CB 3.39Å; I82-K86 PolarHBondContact O-N 3.23Å
83	R	98.1	Very high	94.1	Very high	158 Å²	158	108 Å²	108	60%	0.596	48%	0.482	S	S	*	.	H	α-helix	trans	-64.9	-39.7	175.6	-77.8	173.7	168.2	179.8	-10.9	112.4	K79 I81 K86 G87	K79-R83 WeakPolarHBondContact O-CB 3.17Å; K79-R83 VanDerWaalsContact O-CG 3.28Å; K79-R83 WeakPolarHBondContact O-CG 3.49Å; K79-R83 PolarHBondContact O-N 3.37Å; I81-R83 VanDerWaalsContact C-N 3.3Å; I81-R83 PolarHBondContact O-N 3.36Å; R83-K86 PolarHBondContact O-N 2.85Å; R83-G87 PolarHBondContact O-N 3.45Å
84	Y	97.7	Very high	93.2	Very high	133 Å²	133	108.8 Å²	108.8	52%	0.522	49%	0.485	S	S	.	.	H	α-helix	trans	-60.8	-50.5	174.7	171.8	-95.4	0	0	0	110.8	K80 I81 K86 G87 T88	K80-Y84 PolarHBondContact O-N 3.15Å; K80-Y84 VanDerWaalsContact O-N 3.1Å; I81-Y84 WeakPolarHBondContact O-CB 3.43Å; I81-Y84 PolarHBondContact O-N 2.76Å; I81-Y84 VanDerWaalsContact O-N 3.11Å; Y84-K86 PolarHBondContact O-N 2.9Å; Y84-G87 PolarHBondContact O-N 3.3Å; Y84-T88 PolarHBondContact O-N 3.26Å; Y84-T88 PolarHBondContact O-OG1 2.85Å
85	E	96.9	Very high	92.1	Very high	12 Å²	12	110 Å²	110	6%	0.056	50%	0.503	C	S	.	.	H	α-helix	trans	-61.5	-42.3	177.1	-68.4	-50	118.5	0	0	112.9	S59 R62 L63 I81 I82 G87 T88 F89	S59-E85 WeakPolarHBondContact CA-OE2 3.39Å; S59-E85 WeakPolarHBondContact CB-OE2 3.48Å; S59-E85 PolarHBondContact OG-OE2 3.02Å; R62-E85 HydrophobicContact CB-CG 4.5Å; R62-E85 IonicContact CZ-OE1 3.23Å; R62-E85 IonicContact NE-OE1 2.96Å; R62-E85 PolarHBondContact NE-OE1 3Å; R62-E85 IonicContact NE-OE2 3.14Å; R62-E85 IonicContact NH2-OE1 3.89Å; R62-E85 PolarHBondContact NH2-OE1 3.45Å; R62-E85 IonicContact NH2-OE2 2.6Å; R62-E85 PolarHBondContact NH2-OE2 2.85Å; L63-E85 HydrophobicContact CD2-CB 4.09Å; L63-E85 HydrophobicContact CD2-CG 3.88Å; L63-E85 HydrophobicContact CG-CG 4.2Å; I81-E85 PolarHBondContact O-N 3.22Å; I82-E85 PolarHBondContact O-N 3.4Å; E85-G87 VanDerWaalsContact C-N 3.34Å; E85-G87 PolarHBondContact O-N 2.97Å; E85-T88 PolarHBondContact O-N 3.38Å; E85-F89 WeakPolarHBondContact O-CB 3.31Å; E85-F89 PolarHBondContact O-N 2.88Å
86	K	95.1	Very high	90.7	Very high	132 Å²	132	114.3 Å²	114.3	57%	0.574	53%	0.526	S	S	*	.	H	α-helix	trans	-59.5	-45.4	175.8	-176.7	173.6	-179.9	176	0	111	I82 R83 Y84 F89 F90	I82-K86 VanDerWaalsContact O-CB 3.29Å; I82-K86 WeakPolarHBondContact O-CB 3.39Å; I82-K86 PolarHBondContact O-N 3.23Å; R83-K86 PolarHBondContact O-N 2.85Å; Y84-K86 PolarHBondContact O-N 2.9Å; K86-F89 PolarHBondContact O-N 3.09Å; K86-F90 HydrophobicContact CD-CE2 4.16Å; K86-F90 VanDerWaalsContact CE-CE2 3.49Å; K86-F90 HydrophobicContact CG-CD2 3.9Å; K86-F90 HydrophobicContact CG-CE2 3.54Å; K86-F90 WeakPolarHBondContact O-CD2 3.49Å; K86-F90 PolarHBondContact O-N 3.44Å; K86-F90 VanDerWaalsContact O-N 3.11Å
87	G	94	Very high	90.3	Very high	41 Å²	41	108.6 Å²	108.6	42%	0.423	51%	0.509	S	S	.	.	H	α-helix	trans	-61.7	-45	176.6	0	0	0	0	0	112.6	R83 Y84 E85 F89 F90 K91	R83-G87 PolarHBondContact O-N 3.45Å; Y84-G87 PolarHBondContact O-N 3.3Å; E85-G87 VanDerWaalsContact C-N 3.34Å; E85-G87 PolarHBondContact O-N 2.97Å; G87-F89 VanDerWaalsContact C-N 3.35Å; G87-F89 PolarHBondContact O-N 2.77Å; G87-F90 PolarHBondContact O-N 2.94Å; G87-K91 PolarHBondContact O-N 3.48Å
88	T	88.6	Confident	89.9	Confident	51 Å²	51	109.2 Å²	109.2	31%	0.313	51%	0.509	S	S	.	.	H	α-helix	trans	-59.5	-44.7	175.6	-56.5	0	0	0	0	111.4	Y84 E85 F90 K91 V92	Y84-T88 PolarHBondContact O-N 3.26Å; Y84-T88 PolarHBondContact O-OG1 2.85Å; E85-T88 PolarHBondContact O-N 3.38Å; T88-F90 PolarHBondContact O-N 3.28Å; T88-K91 WeakPolarHBondContact O-CB 3.38Å; T88-K91 PolarHBondContact O-N 3.21Å; T88-V92 WeakPolarHBondContact O-CG2 3.19Å; T88-V92 PolarHBondContact O-N 3.41Å
89	F	87.2	Confident	89.4	Confident	110 Å²	110	115.2 Å²	115.2	48%	0.482	54%	0.536	S	S	.	.	H	α-helix	trans	-59.6	-46.2	177.3	179.8	-97.6	0	0	0	112.7	E85 K86 G87 K91 V92 R93	E85-F89 WeakPolarHBondContact O-CB 3.31Å; E85-F89 PolarHBondContact O-N 2.88Å; K86-F89 PolarHBondContact O-N 3.09Å; G87-F89 VanDerWaalsContact C-N 3.35Å; G87-F89 PolarHBondContact O-N 2.77Å; F89-K91 VanDerWaalsContact C-N 3.31Å; F89-K91 PolarHBondContact O-N 3.5Å; F89-V92 PolarHBondContact O-N 3.1Å; F89-R93 HydrophobicContact CE1-CG 4.13Å; F89-R93 HydrophobicContact CZ-CG 4.15Å; F89-R93 VanDerWaalsContact CZ-NE 3.26Å; F89-R93 PolarHBondContact O-N 3.34Å
90	F	86.7	Confident	88.8	Confident	120 Å²	120	115.2 Å²	115.2	53%	0.526	54%	0.539	S	S	.	.	H	α-helix	trans	-65.6	-33.8	176.2	-76.3	-66.4	0	0	0	112.8	K86 G87 T88 R94	K86-F90 HydrophobicContact CD-CE2 4.16Å; K86-F90 VanDerWaalsContact CE-CE2 3.49Å; K86-F90 HydrophobicContact CG-CD2 3.9Å; K86-F90 HydrophobicContact CG-CE2 3.54Å; K86-F90 WeakPolarHBondContact O-CD2 3.49Å; K86-F90 PolarHBondContact O-N 3.44Å; K86-F90 VanDerWaalsContact O-N 3.11Å; G87-F90 PolarHBondContact O-N 2.94Å; T88-F90 PolarHBondContact O-N 3.28Å; F90-R94 WeakPolarHBondContact O-CB 3.48Å; F90-R94 PolarHBondContact O-N 3.43Å
91	K	84	Confident	88.2	Confident	157 Å²	157	112.5 Å²	112.5	68%	0.683	53%	0.529	S	S	*	.	H	α-helix	trans	-64.1	-45.4	174.7	-171.4	179.4	178.7	-177	0	111.3	G87 T88 F89 R94 C95	G87-K91 PolarHBondContact O-N 3.48Å; T88-K91 WeakPolarHBondContact O-CB 3.38Å; T88-K91 PolarHBondContact O-N 3.21Å; F89-K91 VanDerWaalsContact C-N 3.31Å; F89-K91 PolarHBondContact O-N 3.5Å; K91-R94 PolarHBondContact O-N 3.44Å; K91-C95 PolarHBondContact O-N 2.98Å; K91-C95 PolarHBondContact O-SG 3.31Å
92	V	81	Confident	87.5	Confident	83 Å²	83	117.7 Å²	117.7	50%	0.503	55%	0.552	S	S	.	*	H	α-helix	trans	-63.4	-45.6	176.8	176.6	0	0	0	0	110.8	T88 F89 R94 C95 L96	T88-V92 WeakPolarHBondContact O-CG2 3.19Å; T88-V92 PolarHBondContact O-N 3.41Å; F89-V92 PolarHBondContact O-N 3.1Å; V92-R94 PolarHBondContact O-N 3.18Å; V92-C95 PolarHBondContact O-N 2.97Å; V92-C95 VanDerWaalsContact O-N 3.09Å; V92-L96 HydrophobicContact CG1-CD1 4.48Å; V92-L96 PolarHBondContact O-N 3.02Å
93	R	81.7	Confident	86.8	Confident	167 Å²	167	120.9 Å²	120.9	63%	0.63	57%	0.566	S	S	*	*	H	α-helix	trans	-64.2	-24.1	178	-86.9	-155	173.5	-131.1	1.3	114.7	F89 C95	F89-R93 HydrophobicContact CE1-CG 4.13Å; F89-R93 HydrophobicContact CZ-CG 4.15Å; F89-R93 VanDerWaalsContact CZ-NE 3.26Å; F89-R93 PolarHBondContact O-N 3.34Å; R93-C95 VanDerWaalsContact C-N 3.34Å
94	R	78.6	Confident	85.9	Confident	224 Å²	224	118.1 Å²	118.1	85%	0.845	56%	0.563	S	S	*	*	H	α-helix	trans	-79.6	-19	175.8	-168.2	176.2	179.8	-174.5	0.3	112.6	F90 K91 V92	F90-R94 WeakPolarHBondContact O-CB 3.48Å; F90-R94 PolarHBondContact O-N 3.43Å; K91-R94 PolarHBondContact O-N 3.44Å; V92-R94 PolarHBondContact O-N 3.18Å
95	C	75.6	Confident	84.9	Confident	110 Å²	110	116.8 Å²	116.8	74%	0.743	57%	0.567	S	S	*	*			trans	-91.6	-6	177.6	-65.2	0	0	0	0	113.5	K91 V92 R93	K91-C95 PolarHBondContact O-N 2.98Å; K91-C95 PolarHBondContact O-SG 3.31Å; V92-C95 PolarHBondContact O-N 2.97Å; V92-C95 VanDerWaalsContact O-N 3.09Å; R93-C95 VanDerWaalsContact C-N 3.34Å
96	L	69.4	Low	83.8	Confident	195 Å²	195	126.4 Å²	126.4	100%	1.021	61%	0.613	S	S	*	*			trans	-101.9	0	173.9	-63.9	174.9	0	0	0	109.2	V92	V92-L96 HydrophobicContact CG1-CD1 4.48Å; V92-L96 PolarHBondContact O-N 3.02Å

Retrieved 96 of 96 residues in 68.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).