A0A077ZEE4_TRITR Loading...

Protein FAM36A

AlphaFold DB , UniProt , Accession A0A077ZEE4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 105 aa.

						>A0A077ZEE4_TRITR|A0A077ZEE4
MTTEEDKPNSEQKTTGIWRLLKEPCFVRCQCYGILGAFFVCLGTFGLTGSAAKVHRFGSITYFVVSSSSYSYCYFEKVTMERNVEELREIIHQVHQEQKLDQNDS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.2	Very low	44.1	Very low	240 Å²	240	151.2 Å²	151.2	100%	1.182	79%	0.791	S	S	*	*				0	96.3	0	-114.8	168.1	175.1	0	0	106.9
2	T	45.7	Very low	44.3	Very low	147 Å²	147	151.8 Å²	151.8	90%	0.902	79%	0.787	S	S	*	*			trans	-104.4	92.5	170.3	38.3	0	0	0	0	105.9
3	T	44.3	Very low	44.3	Very low	134 Å²	134	154 Å²	154	82%	0.822	79%	0.787	S	S	*	*			trans	-66.7	137.9	169.5	-18.9	0	0	0	0	108.4
4	E	57.5	Low	44.5	Very low	178 Å²	178	148.4 Å²	148.4	83%	0.832	76%	0.764	S	S	*	*			trans	-51.5	177.4	168.6	-79.7	167.9	80.1	0	0	113.8
5	E	42.4	Very low	44.9	Very low	188 Å²	188	146.3 Å²	146.3	88%	0.879	76%	0.761	S	S	*	*			trans	88.8	116.8	-179.6	-50.4	-173.5	124.6	0	0	110.7
6	D	42	Very low	45.4	Very low	131 Å²	131	140.1 Å²	140.1	70%	0.701	74%	0.744	S	S	*	*				-174.2	109	50.1	-168.6	-108.5	0	0	0	106.9	P8	D6-P8 WeakPolarHBondContact OD1-CD 3.44Å; D6-P8 WeakPolarHBondContact OD1-CG 3.49Å; D6-P8 WeakPolarHBondContact OD2-CD 3.49Å; D6-P8 WeakPolarHBondContact OD2-CG 3.39Å
7	K	38.1	Very low	45.7	Very low	200 Å²	200	139.1 Å²	139.1	87%	0.87	74%	0.737	S	S	*	*			trans	-132.6	67	150.6	-153.9	176.7	-173.4	-179.8	0	109.9
8	P	40.2	Very low	45.9	Very low	75 Å²	75	141.3 Å²	141.3	49%	0.487	73%	0.734	S	S	.	*			trans	-71.1	133	170.3	32.7	-32.9	0	0	0	108.2	D6	D6-P8 WeakPolarHBondContact OD1-CD 3.44Å; D6-P8 WeakPolarHBondContact OD1-CG 3.49Å; D6-P8 WeakPolarHBondContact OD2-CD 3.49Å; D6-P8 WeakPolarHBondContact OD2-CG 3.39Å
9	N	46.6	Very low	46.1	Very low	116 Å²	116	144.6 Å²	144.6	62%	0.62	74%	0.736	S	S	*	*	S	Bend		75.7	42.3	125.1	-149.3	-0.8	0	0	0	118.1
10	S	47	Very low	46.2	Very low	97 Å²	97	141.4 Å²	141.4	68%	0.678	72%	0.72	S	S	*	*	S	Bend	trans	-107	-23.1	159.3	73.6	0	0	0	0	114.5
11	E	45.8	Very low	46.4	Very low	157 Å²	157	138.4 Å²	138.4	73%	0.734	71%	0.705	S	S	*	*	S	Bend	trans	-84.6	-13.7	179	-77.9	-162.5	99	0	0	114.2	K22	E11-K22 IonicContact OE1-NZ 3.94Å
12	Q	46.1	Very low	47	Very low	158 Å²	158	134.6 Å²	134.6	74%	0.738	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	-11.4	-169.2	-148.7	175	-23.7	0	0	114
13	K	44	Very low	47.5	Very low	181 Å²	181	131.5 Å²	131.5	79%	0.787	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.1	9.3	-172.6	-130.5	-177.3	-177.2	-176.9	0	115.6	T15	K13-T15 PolarHBondContact O-N 3.32Å
14	T	47.6	Very low	48.2	Very low	76 Å²	76	129.6 Å²	129.6	47%	0.466	65%	0.647	S	S	.	*			trans	-89.9	63.9	164	20.8	0	0	0	0	109.5	G16 W18	T14-G16 PolarHBondContact O-N 3.04Å; T14-W18 HydrophobicContact CG2-CB 4Å; T14-W18 HydrophobicContact CG2-CG 3.89Å
15	T	50.8	Low	48.3	Very low	117 Å²	117	122.4 Å²	122.4	72%	0.718	62%	0.616	S	S	*	*			trans	-62.8	120.2	-179.1	31.7	0	0	0	0	111.7	K13 I17	K13-T15 PolarHBondContact O-N 3.32Å; T15-I17 PolarHBondContact O-N 3.22Å
16	G	51.9	Low	49.3	Very low	47 Å²	47	116.6 Å²	116.6	49%	0.485	59%	0.588	S	S	.	*	S	Bend	trans	87.8	-79.5	165.8	0	0	0	0	0	115.3	T14 L20	T14-G16 PolarHBondContact O-N 3.04Å; G16-L20 WeakPolarHBondContact O-CD1 3.49Å; G16-L20 PolarHBondContact O-N 2.96Å
17	I	51.5	Low	50.5	Low	122 Å²	122	113.3 Å²	113.3	63%	0.626	57%	0.573	S	S	*	*	H	α-helix	trans	-76.4	-39.4	-161.6	-53	171.2	0	0	0	111.8	T15 L20 L21	T15-I17 PolarHBondContact O-N 3.22Å; I17-L20 WeakPolarHBondContact O-CB 3.48Å; I17-L20 PolarHBondContact O-N 3.25Å; I17-L21 HydrophobicContact CG2-CD1 4.02Å; I17-L21 WeakPolarHBondContact O-CD1 3.48Å; I17-L21 PolarHBondContact O-N 3.37Å
18	W	47.8	Very low	51.6	Low	180 Å²	180	110.2 Å²	110.2	68%	0.682	56%	0.556	S	S	*	*	H	α-helix	trans	-70.7	-31.5	178.7	-86	90	0	0	0	113.1	T14 L20 L21 K22	T14-W18 HydrophobicContact CG2-CB 4Å; T14-W18 HydrophobicContact CG2-CG 3.89Å; W18-L20 VanDerWaalsContact C-N 3.34Å; W18-L21 PolarHBondContact O-N 3.5Å; W18-K22 WeakPolarHBondContact O-CB 3.46Å; W18-K22 PolarHBondContact O-N 2.98Å
19	R	50.4	Low	52.8	Low	204 Å²	204	107.2 Å²	107.2	77%	0.77	54%	0.536	S	S	*	.	H	α-helix	trans	-65.5	-41.3	174.5	-143.6	-173.1	-134.2	-168.1	3.6	110.8	K22 E23	R19-K22 PolarHBondContact O-N 3.44Å; R19-E23 PolarHBondContact O-N 3.08Å
20	L	49	Very low	53.7	Low	79 Å²	79	104.7 Å²	104.7	41%	0.414	52%	0.521	S	S	.	.	H	α-helix	trans	-59.4	-49.1	170.5	-81	150.5	0	0	0	111	G16 I17 W18 K22 E23 F26	G16-L20 WeakPolarHBondContact O-CD1 3.49Å; G16-L20 PolarHBondContact O-N 2.96Å; I17-L20 WeakPolarHBondContact O-CB 3.48Å; I17-L20 PolarHBondContact O-N 3.25Å; W18-L20 VanDerWaalsContact C-N 3.34Å; L20-K22 VanDerWaalsContact C-N 3.29Å; L20-K22 PolarHBondContact O-N 2.97Å; L20-E23 WeakPolarHBondContact O-CB 3.46Å; L20-E23 PolarHBondContact O-N 3.17Å; L20-F26 HydrophobicContact CB-CD1 4.15Å; L20-F26 HydrophobicContact CB-CD2 4.32Å; L20-F26 HydrophobicContact CB-CE1 4.42Å; L20-F26 HydrophobicContact CB-CG 4.1Å; L20-F26 HydrophobicContact CD2-CD2 3.86Å; L20-F26 HydrophobicContact CD2-CE2 4.21Å; L20-F26 HydrophobicContact CD2-CG 4.34Å; L20-F26 WeakPolarHBondContact O-CB 3.23Å
21	L	50.6	Low	54.9	Low	79 Å²	79	103.3 Å²	103.3	41%	0.414	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-31.1	176.6	-85.4	143.2	0	0	0	114.2	I17 W18 E23 F26 V27	I17-L21 HydrophobicContact CG2-CD1 4.02Å; I17-L21 WeakPolarHBondContact O-CD1 3.48Å; I17-L21 PolarHBondContact O-N 3.37Å; W18-L21 PolarHBondContact O-N 3.5Å; L21-E23 PolarHBondContact O-N 3.25Å; L21-F26 HydrophobicContact CG-CD1 4.44Å; L21-V27 HydrophobicContact CD2-CG2 4.36Å; L21-V27 WeakPolarHBondContact O-CG2 3.33Å
22	K	48.9	Very low	56.1	Low	160 Å²	160	102.3 Å²	102.3	70%	0.696	50%	0.501	S	S	*	.	H	α-helix	trans	-73.7	-20.9	176.9	-161.7	171.5	-177.8	173.4	0	111.8	E11 W18 R19 L20 P24	E11-K22 IonicContact OE1-NZ 3.94Å; W18-K22 WeakPolarHBondContact O-CB 3.46Å; W18-K22 PolarHBondContact O-N 2.98Å; R19-K22 PolarHBondContact O-N 3.44Å; L20-K22 VanDerWaalsContact C-N 3.29Å; L20-K22 PolarHBondContact O-N 2.97Å; K22-P24 VanDerWaalsContact O-CD 3.31Å; K22-P24 WeakPolarHBondContact O-CD 3.42Å
23	E	55.7	Low	57.3	Low	83 Å²	83	94.8 Å²	94.8	39%	0.388	47%	0.466	S	S	.	.	S	Bend	trans	-78	110.9	175.1	-139.5	147.9	-168.5	0	0	108.1	R19 L20 L21 C25 F26 K77	R19-E23 PolarHBondContact O-N 3.08Å; L20-E23 WeakPolarHBondContact O-CB 3.46Å; L20-E23 PolarHBondContact O-N 3.17Å; L21-E23 PolarHBondContact O-N 3.25Å; E23-C25 PolarHBondContact O-N 2.87Å; E23-F26 PolarHBondContact O-N 3.07Å; E23-K77 IonicContact OE1-NZ 2.86Å; E23-K77 PolarHBondContact OE1-NZ 2.9Å
24	P	58.7	Low	58.9	Low	93 Å²	93	91.2 Å²	91.2	60%	0.604	45%	0.454	S	S	*	.	H	α-helix	trans	-57.5	-23.2	-173	22.9	-33.8	0	0	0	112.2	K22 R28	K22-P24 VanDerWaalsContact O-CD 3.31Å; K22-P24 WeakPolarHBondContact O-CD 3.42Å; P24-R28 WeakPolarHBondContact O-CB 3.49Å; P24-R28 WeakPolarHBondContact O-CG 3.49Å; P24-R28 PolarHBondContact O-N 2.89Å
25	C	59.6	Low	60.4	Low	28 Å²	28	92.9 Å²	92.9	19%	0.189	46%	0.459	C	S	.	.	H	α-helix	trans	-60.6	-46.3	171.5	-85.7	0	0	0	0	114.1	E23 V27 R28 C29 C73	E23-C25 PolarHBondContact O-N 2.87Å; C25-V27 PolarHBondContact O-N 2.92Å; C25-R28 PolarHBondContact O-N 3.04Å; C25-C29 WeakPolarHBondContact O-CB 3.47Å; C25-C29 PolarHBondContact O-N 3.33Å; C25-C29 PolarHBondContact O-SG 3.28Å; C25-C73 WeakPolarHBondContact CA-SG 3.14Å; C25-C73 HydrophobicContact CB-CB 3.76Å; C25-C73 WeakPolarHBondContact CB-SG 3.47Å; C25-C73 WeakPolarHBondContact SG-CB 3.41Å; C25-C73 PolarHBondContact SG-O 2.67Å; C25-C73 CovalentContact SG-SG 2.03Å; C25-C73 PolarHBondContact SG-SG 3.23Å
26	F	63.8	Low	61.6	Low	66 Å²	66	88.3 Å²	88.3	29%	0.289	44%	0.435	S	S	.	.	H	α-helix	trans	-66.1	-42	-176.6	-174.6	-103.2	0	0	0	111.3	L20 L21 E23 C29 Q30	L20-F26 HydrophobicContact CB-CD1 4.15Å; L20-F26 HydrophobicContact CB-CD2 4.32Å; L20-F26 HydrophobicContact CB-CE1 4.42Å; L20-F26 HydrophobicContact CB-CG 4.1Å; L20-F26 HydrophobicContact CD2-CD2 3.86Å; L20-F26 HydrophobicContact CD2-CE2 4.21Å; L20-F26 HydrophobicContact CD2-CG 4.34Å; L20-F26 WeakPolarHBondContact O-CB 3.23Å; L21-F26 HydrophobicContact CG-CD1 4.44Å; E23-F26 PolarHBondContact O-N 3.07Å; F26-C29 PolarHBondContact O-N 3.4Å; F26-Q30 HydrophobicContact CD1-CG 4.25Å; F26-Q30 HydrophobicContact CE1-CG 3.89Å; F26-Q30 HydrophobicContact CE2-CG 4.37Å; F26-Q30 HydrophobicContact CZ-CG 3.96Å; F26-Q30 WeakPolarHBondContact O-CG 3.34Å; F26-Q30 PolarHBondContact O-N 2.94Å
27	V	66.1	Low	62.7	Low	61 Å²	61	86.7 Å²	86.7	37%	0.37	42%	0.418	S	S	.	.	H	α-helix	trans	-62.9	-46.7	176.7	179.3	0	0	0	0	110.5	L21 C25 C29 Q30 C31	L21-V27 HydrophobicContact CD2-CG2 4.36Å; L21-V27 WeakPolarHBondContact O-CG2 3.33Å; C25-V27 PolarHBondContact O-N 2.92Å; V27-C29 PolarHBondContact O-N 2.9Å; V27-Q30 PolarHBondContact O-N 3.33Å; V27-C31 WeakPolarHBondContact O-CB 3.31Å; V27-C31 PolarHBondContact O-N 3.15Å; V27-C31 PolarHBondContact O-SG 3.43Å
28	R	62.5	Low	64.1	Low	136 Å²	136	86.8 Å²	86.8	51%	0.513	41%	0.414	S	S	.	.	H	α-helix	trans	-59.2	-47.1	174.7	-77.1	-178.5	179.1	-173.6	0.3	111.3	P24 C25 Q30 C31 Y32 E76	P24-R28 WeakPolarHBondContact O-CB 3.49Å; P24-R28 WeakPolarHBondContact O-CG 3.49Å; P24-R28 PolarHBondContact O-N 2.89Å; C25-R28 PolarHBondContact O-N 3.04Å; R28-Q30 VanDerWaalsContact C-N 3.33Å; R28-Q30 PolarHBondContact O-N 3.25Å; R28-C31 PolarHBondContact O-N 3.47Å; R28-Y32 HydrophobicContact CB-CD2 4.28Å; R28-Y32 HydrophobicContact CB-CE2 4.15Å; R28-Y32 WeakPolarHBondContact O-CD2 3.2Å; R28-Y32 PolarHBondContact O-N 3.35Å; R28-E76 IonicContact NH1-OE2 3.88Å
29	C	64	Low	65.7	Low	12 Å²	12	86 Å²	86	8%	0.081	42%	0.415	C	S	.	.	H	α-helix	trans	-57.6	-45.8	178.7	-69.9	0	0	0	0	112.1	C25 F26 V27 Y32 G33 S69 Y70	C25-C29 WeakPolarHBondContact O-CB 3.47Å; C25-C29 PolarHBondContact O-N 3.33Å; C25-C29 PolarHBondContact O-SG 3.28Å; F26-C29 PolarHBondContact O-N 3.4Å; V27-C29 PolarHBondContact O-N 2.9Å; C29-Y32 PolarHBondContact O-N 2.96Å; C29-G33 PolarHBondContact O-N 3.22Å; C29-S69 PolarHBondContact SG-O 3.22Å; C29-S69 VanDerWaalsContact SG-O 3.34Å; C29-Y70 VanDerWaalsContact SG-CA 3.57Å
30	Q	65.3	Low	67.1	Low	63 Å²	63	78.4 Å²	78.4	29%	0.294	39%	0.392	S	S	.	.	H	α-helix	trans	-67.1	-41.4	178	-70.4	-75.8	51.9	0	0	111.6	F26 V27 R28 G33 I34 Y62	F26-Q30 HydrophobicContact CD1-CG 4.25Å; F26-Q30 HydrophobicContact CE1-CG 3.89Å; F26-Q30 HydrophobicContact CE2-CG 4.37Å; F26-Q30 HydrophobicContact CZ-CG 3.96Å; F26-Q30 WeakPolarHBondContact O-CG 3.34Å; F26-Q30 PolarHBondContact O-N 2.94Å; V27-Q30 PolarHBondContact O-N 3.33Å; R28-Q30 VanDerWaalsContact C-N 3.33Å; R28-Q30 PolarHBondContact O-N 3.25Å; Q30-G33 PolarHBondContact O-N 3.06Å; Q30-I34 WeakPolarHBondContact O-CB 3.22Å; Q30-I34 WeakPolarHBondContact O-CD1 3.39Å; Q30-I34 WeakPolarHBondContact O-CG1 3.49Å; Q30-I34 PolarHBondContact O-N 3.45Å; Q30-Y62 PolarHBondContact OE1-OH 3.29Å
31	C	72.4	Confident	68.5	Low	68 Å²	68	76.8 Å²	76.8	46%	0.459	39%	0.386	S	S	.	.	H	α-helix	trans	-61.4	-45.9	175.6	-76.4	0	0	0	0	112.3	V27 R28 I34 L35	V27-C31 WeakPolarHBondContact O-CB 3.31Å; V27-C31 PolarHBondContact O-N 3.15Å; V27-C31 PolarHBondContact O-SG 3.43Å; R28-C31 PolarHBondContact O-N 3.47Å; C31-I34 PolarHBondContact O-N 3.02Å; C31-L35 WeakPolarHBondContact O-CB 3.46Å; C31-L35 WeakPolarHBondContact O-CG 3.36Å; C31-L35 PolarHBondContact O-N 3.27Å
32	Y	71.9	Confident	70	Confident	136 Å²	136	77.6 Å²	77.6	53%	0.533	39%	0.39	S	S	.	.	H	α-helix	trans	-66.6	-42.1	176.8	-73.7	-65	0	0	0	111.8	R28 C29 I34 L35 G36 V65 S69	R28-Y32 HydrophobicContact CB-CD2 4.28Å; R28-Y32 HydrophobicContact CB-CE2 4.15Å; R28-Y32 WeakPolarHBondContact O-CD2 3.2Å; R28-Y32 PolarHBondContact O-N 3.35Å; C29-Y32 PolarHBondContact O-N 2.96Å; Y32-I34 PolarHBondContact O-N 3.41Å; Y32-L35 PolarHBondContact O-N 2.9Å; Y32-G36 PolarHBondContact O-N 3.45Å; Y32-V65 VanDerWaalsContact O-CG1 3.29Å; Y32-V65 WeakPolarHBondContact O-CG1 3.45Å; Y32-S69 WeakPolarHBondContact CB-OG 2.94Å
33	G	71.2	Confident	71.4	Confident	0 Å²	0	72 Å²	72	0%	0	38%	0.378	C	S	.	.	H	α-helix	trans	-56.7	-46.8	173.6	0	0	0	0	0	112.7	C29 Q30 A37	C29-G33 PolarHBondContact O-N 3.22Å; Q30-G33 PolarHBondContact O-N 3.06Å; G33-A37 WeakPolarHBondContact O-CB 3.21Å; G33-A37 PolarHBondContact O-N 3.49Å
34	I	77.2	Confident	72.5	Confident	105 Å²	105	69.2 Å²	69.2	54%	0.538	37%	0.367	S	S	.	.	H	α-helix	trans	-66.9	-46.1	177.5	-67.5	163.5	0	0	0	110.9	Q30 C31 Y32 A37 F38	Q30-I34 WeakPolarHBondContact O-CB 3.22Å; Q30-I34 WeakPolarHBondContact O-CD1 3.39Å; Q30-I34 WeakPolarHBondContact O-CG1 3.49Å; Q30-I34 PolarHBondContact O-N 3.45Å; C31-I34 PolarHBondContact O-N 3.02Å; Y32-I34 PolarHBondContact O-N 3.41Å; I34-A37 PolarHBondContact O-N 3.08Å; I34-F38 WeakPolarHBondContact O-CB 3.42Å; I34-F38 PolarHBondContact O-N 2.89Å
35	L	78.5	Confident	73.4	Confident	111 Å²	111	70.7 Å²	70.7	58%	0.581	36%	0.364	S	S	*	.	H	α-helix	trans	-61.2	-46.2	178.5	-84.9	161.1	0	0	0	111.9	C31 Y32 F38 F39	C31-L35 WeakPolarHBondContact O-CB 3.46Å; C31-L35 WeakPolarHBondContact O-CG 3.36Å; C31-L35 PolarHBondContact O-N 3.27Å; Y32-L35 PolarHBondContact O-N 2.9Å; L35-F38 PolarHBondContact O-N 2.89Å; L35-F39 PolarHBondContact O-N 3.38Å
36	G	75.5	Confident	74.5	Confident	21 Å²	21	72.6 Å²	72.6	22%	0.216	39%	0.389	C	S	.	.	H	α-helix	trans	-64.4	-44.9	177.6	0	0	0	0	0	112.3	Y32 F38 F39 V40	Y32-G36 PolarHBondContact O-N 3.45Å; G36-F38 VanDerWaalsContact C-N 3.35Å; G36-F38 PolarHBondContact O-N 3.46Å; G36-F39 PolarHBondContact O-N 2.93Å; G36-V40 PolarHBondContact O-N 3.27Å
37	A	76.5	Confident	75.2	Confident	14 Å²	14	76.9 Å²	76.9	12%	0.116	41%	0.414	C	S	.	.	H	α-helix	trans	-62.2	-41.9	174.9	0	0	0	0	0	111.7	G33 I34 V40 C41 Y62	G33-A37 WeakPolarHBondContact O-CB 3.21Å; G33-A37 PolarHBondContact O-N 3.49Å; I34-A37 PolarHBondContact O-N 3.08Å; A37-V40 PolarHBondContact O-N 3.5Å; A37-C41 VanDerWaalsContact O-CB 3.27Å; A37-C41 WeakPolarHBondContact O-CB 3.04Å; A37-C41 PolarHBondContact O-N 3.4Å; A37-C41 PolarHBondContact O-SG 3.43Å; A37-Y62 HydrophobicContact CB-CD2 4.36Å
38	F	79.4	Confident	75.9	Confident	124 Å²	124	76.7 Å²	76.7	54%	0.544	41%	0.413	S	S	.	.	H	α-helix	trans	-62	-44.9	177.7	-172.2	-105.1	0	0	0	111.6	I34 L35 G36 V40 C41 L42	I34-F38 WeakPolarHBondContact O-CB 3.42Å; I34-F38 PolarHBondContact O-N 2.89Å; L35-F38 PolarHBondContact O-N 2.89Å; G36-F38 VanDerWaalsContact C-N 3.35Å; G36-F38 PolarHBondContact O-N 3.46Å; F38-V40 PolarHBondContact O-N 3.39Å; F38-C41 PolarHBondContact O-N 3.22Å; F38-L42 HydrophobicContact CD1-CD1 3.78Å; F38-L42 HydrophobicContact CD1-CG 4.4Å; F38-L42 HydrophobicContact CE1-CD1 3.32Å; F38-L42 HydrophobicContact CE1-CG 4.14Å; F38-L42 HydrophobicContact CZ-CD1 3.76Å; F38-L42 HydrophobicContact CZ-CD2 4.47Å; F38-L42 HydrophobicContact CZ-CG 4.24Å; F38-L42 WeakPolarHBondContact O-CG 3.46Å; F38-L42 PolarHBondContact O-N 3.04Å
39	F	82.9	Confident	76.5	Confident	163 Å²	163	73.1 Å²	73.1	72%	0.715	42%	0.418	S	S	*	.	H	α-helix	trans	-63.7	-42.5	179.1	-139.9	-94.6	0	0	0	112.1	L35 G36 L42 G43	L35-F39 PolarHBondContact O-N 3.38Å; G36-F39 PolarHBondContact O-N 2.93Å; F39-L42 PolarHBondContact O-N 3.42Å; F39-G43 PolarHBondContact O-N 2.9Å
40	V	78.6	Confident	77.2	Confident	45 Å²	45	74.6 Å²	74.6	27%	0.273	43%	0.429	S	S	.	.	H	α-helix	trans	-70.5	-38.6	176.2	174.1	0	0	0	0	111.9	G36 A37 F38 L42 G43 T44 F57 T61	G36-V40 PolarHBondContact O-N 3.27Å; A37-V40 PolarHBondContact O-N 3.5Å; F38-V40 PolarHBondContact O-N 3.39Å; V40-L42 PolarHBondContact O-N 2.91Å; V40-G43 PolarHBondContact O-N 3.32Å; V40-T44 HydrophobicContact CG1-CG2 3.83Å; V40-T44 WeakPolarHBondContact O-CB 3.34Å; V40-T44 WeakPolarHBondContact O-CG2 3.48Å; V40-T44 PolarHBondContact O-N 2.84Å; V40-T44 PolarHBondContact O-OG1 3.34Å; V40-F57 HydrophobicContact CG1-CB 4.38Å; V40-T61 HydrophobicContact CB-CG2 3.86Å; V40-T61 HydrophobicContact CG1-CG2 4.39Å; V40-T61 WeakPolarHBondContact CG1-OG1 3.13Å; V40-T61 HydrophobicContact CG2-CG2 3.46Å; V40-T61 VanDerWaalsContact CG2-CG2 3.46Å
41	C	78.6	Confident	77.8	Confident	44 Å²	44	75 Å²	75	30%	0.297	44%	0.442	S	S	.	.	H	α-helix	trans	-58.9	-47.4	174.2	-79.9	0	0	0	0	111	A37 F38 T44 F45 V54	A37-C41 VanDerWaalsContact O-CB 3.27Å; A37-C41 WeakPolarHBondContact O-CB 3.04Å; A37-C41 PolarHBondContact O-N 3.4Å; A37-C41 PolarHBondContact O-SG 3.43Å; F38-C41 PolarHBondContact O-N 3.22Å; C41-T44 PolarHBondContact O-OG1 2.78Å; C41-F45 WeakPolarHBondContact O-CB 3.18Å; C41-F45 PolarHBondContact O-N 2.86Å; C41-V54 HydrophobicContact CB-CG1 4.16Å
42	L	81.9	Confident	78.2	Confident	96 Å²	96	75.1 Å²	75.1	50%	0.503	45%	0.448	S	S	.	.	H	α-helix	trans	-63.1	-46.6	176.4	-72.1	179.1	0	0	0	112.4	F38 F39 V40 F45 G46	F38-L42 HydrophobicContact CD1-CD1 3.78Å; F38-L42 HydrophobicContact CD1-CG 4.4Å; F38-L42 HydrophobicContact CE1-CD1 3.32Å; F38-L42 HydrophobicContact CE1-CG 4.14Å; F38-L42 HydrophobicContact CZ-CD1 3.76Å; F38-L42 HydrophobicContact CZ-CD2 4.47Å; F38-L42 HydrophobicContact CZ-CG 4.24Å; F38-L42 WeakPolarHBondContact O-CG 3.46Å; F38-L42 PolarHBondContact O-N 3.04Å; F39-L42 PolarHBondContact O-N 3.42Å; V40-L42 PolarHBondContact O-N 2.91Å; L42-F45 PolarHBondContact O-N 3.22Å; L42-G46 PolarHBondContact O-N 2.74Å
43	G	79.7	Confident	78.6	Confident	43 Å²	43	74.1 Å²	74.1	44%	0.443	45%	0.447	S	S	.	.	H	α-helix	trans	-62.9	-48.6	179.8	0	0	0	0	0	112.5	F39 V40 G46 L47	F39-G43 PolarHBondContact O-N 2.9Å; V40-G43 PolarHBondContact O-N 3.32Å; G43-G46 PolarHBondContact O-N 3.25Å; G43-L47 WeakPolarHBondContact O-CB 3.35Å; G43-L47 PolarHBondContact O-N 2.98Å
44	T	77.7	Confident	79	Confident	25 Å²	25	74.9 Å²	74.9	15%	0.153	45%	0.451	C	S	.	.	H	α-helix	trans	-69.9	-35	178.9	55.7	0	0	0	0	112.4	V40 C41 L47 T48 F57	V40-T44 HydrophobicContact CG1-CG2 3.83Å; V40-T44 WeakPolarHBondContact O-CB 3.34Å; V40-T44 WeakPolarHBondContact O-CG2 3.48Å; V40-T44 PolarHBondContact O-N 2.84Å; V40-T44 PolarHBondContact O-OG1 3.34Å; C41-T44 PolarHBondContact O-OG1 2.78Å; T44-L47 PolarHBondContact O-N 3.25Å; T44-T48 PolarHBondContact O-N 3.37Å; T44-T48 PolarHBondContact O-OG1 2.87Å; T44-F57 HydrophobicContact CG2-CB 3.99Å; T44-F57 HydrophobicContact CG2-CD2 4.41Å; T44-F57 HydrophobicContact CG2-CG 4.22Å
45	F	79	Confident	79.1	Confident	123 Å²	123	76.7 Å²	76.7	54%	0.539	46%	0.457	S	S	.	.	H	α-helix	trans	-64.6	-44.5	174.7	-173.4	-95.9	0	0	0	110.9	C41 L42 L47 G49 V54	C41-F45 WeakPolarHBondContact O-CB 3.18Å; C41-F45 PolarHBondContact O-N 2.86Å; L42-F45 PolarHBondContact O-N 3.22Å; F45-L47 VanDerWaalsContact C-N 3.32Å; F45-L47 PolarHBondContact O-N 3.48Å; F45-G49 WeakPolarHBondContact O-CA 3.2Å; F45-G49 PolarHBondContact O-N 3.38Å; F45-V54 HydrophobicContact CB-CG1 4.48Å; F45-V54 HydrophobicContact CB-CG2 3.91Å; F45-V54 HydrophobicContact CD2-CG2 4.19Å
46	G	81.8	Confident	79.3	Confident	68 Å²	68	80.5 Å²	80.5	70%	0.701	46%	0.464	S	S	*	.	H	α-helix	trans	-61.9	-36.9	173.4	0	0	0	0	0	113.4	L42 G43	L42-G46 PolarHBondContact O-N 2.74Å; G43-G46 PolarHBondContact O-N 3.25Å
47	L	78.3	Confident	79.6	Confident	157 Å²	157	84.9 Å²	84.9	82%	0.822	48%	0.477	S	S	*	.	H	α-helix	trans	-82.2	-39.8	-176.3	-135	104.1	0	0	0	114.1	G43 T44 F45	G43-L47 WeakPolarHBondContact O-CB 3.35Å; G43-L47 PolarHBondContact O-N 2.98Å; T44-L47 PolarHBondContact O-N 3.25Å; F45-L47 VanDerWaalsContact C-N 3.32Å; F45-L47 PolarHBondContact O-N 3.48Å
48	T	80.9	Confident	79.7	Confident	57 Å²	57	84.5 Å²	84.5	35%	0.35	48%	0.475	S	S	.	.	H	α-helix	trans	-110.3	-16.4	-170.7	54	0	0	0	0	114.5	T44 S50 K53	T44-T48 PolarHBondContact O-N 3.37Å; T44-T48 PolarHBondContact O-OG1 2.87Å; T48-S50 PolarHBondContact O-N 2.85Å; T48-K53 HydrophobicContact CG2-CD 4.38Å
49	G	75.6	Confident	79.7	Confident	60 Å²	60	81.5 Å²	81.5	62%	0.619	47%	0.469	S	S	*	.			trans	57.9	9.3	-178.9	0	0	0	0	0	115.1	F45	F45-G49 WeakPolarHBondContact O-CA 3.2Å; F45-G49 PolarHBondContact O-N 3.38Å
50	S	78.8	Confident	79.8	Confident	44 Å²	44	78.7 Å²	78.7	31%	0.308	46%	0.461	S	S	.	.			trans	-121.1	107.9	-168.9	-170.1	0	0	0	0	110.9	T48 A52 K53 V54	T48-S50 PolarHBondContact O-N 2.85Å; S50-A52 PolarHBondContact O-N 2.88Å; S50-A52 VanDerWaalsContact O-N 3.16Å; S50-K53 PolarHBondContact O-N 3.49Å; S50-K53 VanDerWaalsContact O-N 3.08Å; S50-V54 WeakPolarHBondContact O-CG2 3.39Å; S50-V54 PolarHBondContact O-N 3.32Å; S50-V54 VanDerWaalsContact O-N 3.12Å
51	A	76.3	Confident	79.9	Confident	70 Å²	70	77.7 Å²	77.7	58%	0.579	46%	0.455	S	S	*	.	H	α-helix	trans	-55.1	-35.3	-176.7	0	0	0	0	0	113.6	K53 V54 H55	A51-K53 PolarHBondContact O-N 2.03Å; A51-V54 PolarHBondContact O-N 3.07Å; A51-H55 WeakPolarHBondContact O-CB 3.37Å; A51-H55 PolarHBondContact O-N 3.37Å
52	A	82.6	Confident	79.9	Confident	71 Å²	71	80.2 Å²	80.2	59%	0.587	46%	0.459	S	S	*	.	H	α-helix	trans	-64.7	-38.6	179.3	0	0	0	0	0	113	S50 R56	S50-A52 PolarHBondContact O-N 2.88Å; S50-A52 VanDerWaalsContact O-N 3.16Å; A52-R56 PolarHBondContact O-N 3.32Å
53	K	78.5	Confident	79.9	Confident	116 Å²	116	82.9 Å²	82.9	50%	0.504	47%	0.466	S	S	.	.	H	α-helix	trans	-72.6	-44.2	176.1	-70	176.6	-176.5	159.8	0	110.3	T48 S50 A51 H55 R56 F57	T48-K53 HydrophobicContact CG2-CD 4.38Å; S50-K53 PolarHBondContact O-N 3.49Å; S50-K53 VanDerWaalsContact O-N 3.08Å; A51-K53 PolarHBondContact O-N 2.03Å; K53-H55 VanDerWaalsContact C-N 3.27Å; K53-H55 PolarHBondContact O-N 3.34Å; K53-R56 PolarHBondContact O-N 3.29Å; K53-R56 VanDerWaalsContact O-N 3.14Å; K53-F57 HydrophobicContact CB-CD2 4.45Å; K53-F57 VanDerWaalsContact O-CD2 3.23Å; K53-F57 WeakPolarHBondContact O-CD2 3.33Å; K53-F57 PolarHBondContact O-N 3.43Å
54	V	80.5	Confident	80	Confident	15 Å²	15	84.5 Å²	84.5	9%	0.091	47%	0.468	C	S	.	.	H	α-helix	trans	-55.4	-43.8	176.9	176.2	0	0	0	0	111.1	C41 F45 S50 A51 R56 F57 G58	C41-V54 HydrophobicContact CB-CG1 4.16Å; F45-V54 HydrophobicContact CB-CG1 4.48Å; F45-V54 HydrophobicContact CB-CG2 3.91Å; F45-V54 HydrophobicContact CD2-CG2 4.19Å; S50-V54 WeakPolarHBondContact O-CG2 3.39Å; S50-V54 PolarHBondContact O-N 3.32Å; S50-V54 VanDerWaalsContact O-N 3.12Å; A51-V54 PolarHBondContact O-N 3.07Å; V54-R56 PolarHBondContact O-N 3.49Å; V54-F57 PolarHBondContact O-N 2.83Å; V54-G58 WeakPolarHBondContact O-CA 3.4Å; V54-G58 PolarHBondContact O-N 2.89Å
55	H	79.6	Confident	80.1	Confident	143 Å²	143	85 Å²	85	66%	0.662	47%	0.47	S	S	*	.	H	α-helix	trans	-63.8	-41	178.8	-168.3	-83.8	0	0	0	112.8	A51 K53 S59	A51-H55 WeakPolarHBondContact O-CB 3.37Å; A51-H55 PolarHBondContact O-N 3.37Å; K53-H55 VanDerWaalsContact C-N 3.27Å; K53-H55 PolarHBondContact O-N 3.34Å; H55-S59 WeakPolarHBondContact O-CB 3.47Å; H55-S59 PolarHBondContact O-N 3.34Å; H55-S59 PolarHBondContact O-OG 2.89Å
56	R	82.4	Confident	80.1	Confident	191 Å²	191	80.3 Å²	80.3	72%	0.721	45%	0.453	S	S	*	.	H	α-helix	trans	-66.3	-45	176.4	-74.9	-173.1	177.7	167.8	0.4	112.3	A52 K53 V54 S59 I60	A52-R56 PolarHBondContact O-N 3.32Å; K53-R56 PolarHBondContact O-N 3.29Å; K53-R56 VanDerWaalsContact O-N 3.14Å; V54-R56 PolarHBondContact O-N 3.49Å; R56-S59 PolarHBondContact O-OG 3.38Å; R56-S59 VanDerWaalsContact O-OG 3.1Å; R56-I60 WeakPolarHBondContact O-CD1 3.32Å; R56-I60 VanDerWaalsContact O-CG1 3.26Å; R56-I60 WeakPolarHBondContact O-CG1 3.28Å; R56-I60 PolarHBondContact O-N 3.19Å
57	F	82.1	Confident	80.1	Confident	113 Å²	113	80 Å²	80	50%	0.496	44%	0.44	S	S	.	.	H	α-helix	trans	-67.9	-39.1	177.2	-78.5	-71.4	0	0	0	111.8	V40 T44 K53 V54 T61	V40-F57 HydrophobicContact CG1-CB 4.38Å; T44-F57 HydrophobicContact CG2-CB 3.99Å; T44-F57 HydrophobicContact CG2-CD2 4.41Å; T44-F57 HydrophobicContact CG2-CG 4.22Å; K53-F57 HydrophobicContact CB-CD2 4.45Å; K53-F57 VanDerWaalsContact O-CD2 3.23Å; K53-F57 WeakPolarHBondContact O-CD2 3.33Å; K53-F57 PolarHBondContact O-N 3.43Å; V54-F57 PolarHBondContact O-N 2.83Å; F57-T61 VanDerWaalsContact O-CB 3.26Å; F57-T61 WeakPolarHBondContact O-CB 3.35Å; F57-T61 PolarHBondContact O-N 3.38Å; F57-T61 PolarHBondContact O-OG1 2.95Å
58	G	77.7	Confident	80.1	Confident	7 Å²	7	75.9 Å²	75.9	7%	0.072	42%	0.424	C	S	.	.	H	α-helix	trans	-62.1	-45.3	176.6	0	0	0	0	0	112.3	V54 T61 Y62	V54-G58 WeakPolarHBondContact O-CA 3.4Å; V54-G58 PolarHBondContact O-N 2.89Å; G58-T61 PolarHBondContact O-N 3.48Å; G58-Y62 VanDerWaalsContact O-CB 3.29Å; G58-Y62 WeakPolarHBondContact O-CB 3.37Å; G58-Y62 PolarHBondContact O-N 3.25Å
59	S	79.8	Confident	79.9	Confident	60 Å²	60	73.9 Å²	73.9	42%	0.42	41%	0.413	S	S	.	.	H	α-helix	trans	-67.5	-42.1	178.9	67.9	0	0	0	0	112.8	H55 R56 Y62 F63	H55-S59 WeakPolarHBondContact O-CB 3.47Å; H55-S59 PolarHBondContact O-N 3.34Å; H55-S59 PolarHBondContact O-OG 2.89Å; R56-S59 PolarHBondContact O-OG 3.38Å; R56-S59 VanDerWaalsContact O-OG 3.1Å; S59-Y62 PolarHBondContact O-N 3.44Å; S59-F63 PolarHBondContact O-N 2.91Å
60	I	84.4	Confident	79.9	Confident	104 Å²	104	78.2 Å²	78.2	53%	0.533	41%	0.412	S	S	.	.	H	α-helix	trans	-62.7	-46	175.5	-66.1	167	0	0	0	109.9	R56 F63 V64	R56-I60 WeakPolarHBondContact O-CD1 3.32Å; R56-I60 VanDerWaalsContact O-CG1 3.26Å; R56-I60 WeakPolarHBondContact O-CG1 3.28Å; R56-I60 PolarHBondContact O-N 3.19Å; I60-F63 PolarHBondContact O-N 3.46Å; I60-V64 HydrophobicContact CG2-CG2 4.41Å; I60-V64 WeakPolarHBondContact O-CG2 3.31Å; I60-V64 PolarHBondContact O-N 2.96Å
61	T	80.9	Confident	79.9	Confident	25 Å²	25	79.5 Å²	79.5	15%	0.153	42%	0.421	C	S	.	.	H	α-helix	trans	-62.4	-46	177.9	-58.8	0	0	0	0	111.1	V40 F57 G58 F63 V64 V65	V40-T61 HydrophobicContact CB-CG2 3.86Å; V40-T61 HydrophobicContact CG1-CG2 4.39Å; V40-T61 WeakPolarHBondContact CG1-OG1 3.13Å; V40-T61 HydrophobicContact CG2-CG2 3.46Å; V40-T61 VanDerWaalsContact CG2-CG2 3.46Å; F57-T61 VanDerWaalsContact O-CB 3.26Å; F57-T61 WeakPolarHBondContact O-CB 3.35Å; F57-T61 PolarHBondContact O-N 3.38Å; F57-T61 PolarHBondContact O-OG1 2.95Å; G58-T61 PolarHBondContact O-N 3.48Å; T61-F63 VanDerWaalsContact C-N 3.26Å; T61-F63 PolarHBondContact O-N 2.83Å; T61-V64 PolarHBondContact O-N 3.34Å; T61-V65 HydrophobicContact CG2-CG2 3.81Å; T61-V65 WeakPolarHBondContact O-CB 3.49Å; T61-V65 VanDerWaalsContact O-CG2 3.27Å; T61-V65 WeakPolarHBondContact O-CG2 3.42Å; T61-V65 PolarHBondContact O-N 2.86Å
62	Y	80	Confident	79.8	Confident	96 Å²	96	82.8 Å²	82.8	38%	0.376	42%	0.419	S	S	.	.	H	α-helix	trans	-55	-45.6	176.3	174.7	-101.3	0	0	0	110.9	Q30 A37 G58 S59 S66	Q30-Y62 PolarHBondContact OE1-OH 3.29Å; A37-Y62 HydrophobicContact CB-CD2 4.36Å; G58-Y62 VanDerWaalsContact O-CB 3.29Å; G58-Y62 WeakPolarHBondContact O-CB 3.37Å; G58-Y62 PolarHBondContact O-N 3.25Å; S59-Y62 PolarHBondContact O-N 3.44Å; Y62-S66 WeakPolarHBondContact CE2-OG 3.36Å; Y62-S66 WeakPolarHBondContact O-CB 3.48Å; Y62-S66 PolarHBondContact O-N 3.49Å; Y62-S66 PolarHBondContact O-OG 2.91Å
63	F	81.6	Confident	79.4	Confident	152 Å²	152	79.9 Å²	79.9	67%	0.667	39%	0.394	S	S	*	.	H	α-helix	trans	-63.3	-47.6	178	-172.7	-98.3	0	0	0	112.2	S59 I60 T61 S67	S59-F63 PolarHBondContact O-N 2.91Å; I60-F63 PolarHBondContact O-N 3.46Å; T61-F63 VanDerWaalsContact C-N 3.26Å; T61-F63 PolarHBondContact O-N 2.83Å; F63-S67 VanDerWaalsContact O-CB 3.28Å; F63-S67 WeakPolarHBondContact O-CB 3.28Å; F63-S67 PolarHBondContact O-N 2.87Å
64	V	82	Confident	79.3	Confident	77 Å²	77	81.2 Å²	81.2	47%	0.467	40%	0.397	S	S	.	.	H	α-helix	trans	-63.7	-48.8	179.7	173.3	0	0	0	0	111.2	I60 T61 S67 S68	I60-V64 HydrophobicContact CG2-CG2 4.41Å; I60-V64 WeakPolarHBondContact O-CG2 3.31Å; I60-V64 PolarHBondContact O-N 2.96Å; T61-V64 PolarHBondContact O-N 3.34Å; V64-S67 PolarHBondContact O-N 2.82Å; V64-S68 WeakPolarHBondContact O-CB 3.49Å; V64-S68 PolarHBondContact O-N 3Å; V64-S68 PolarHBondContact O-OG 3.07Å; V64-S68 VanDerWaalsContact O-OG 3.07Å
65	V	79.9	Confident	79.2	Confident	35 Å²	35	87.2 Å²	87.2	21%	0.212	42%	0.422	C	S	.	.	H	α-helix	trans	-67.7	-39.6	-178.6	-179.9	0	0	0	0	110.9	Y32 T61 S67 S68 S69	Y32-V65 VanDerWaalsContact O-CG1 3.29Å; Y32-V65 WeakPolarHBondContact O-CG1 3.45Å; T61-V65 HydrophobicContact CG2-CG2 3.81Å; T61-V65 WeakPolarHBondContact O-CB 3.49Å; T61-V65 VanDerWaalsContact O-CG2 3.27Å; T61-V65 WeakPolarHBondContact O-CG2 3.42Å; T61-V65 PolarHBondContact O-N 2.86Å; V65-S67 VanDerWaalsContact C-N 3.34Å; V65-S68 PolarHBondContact O-N 3.31Å; V65-S69 VanDerWaalsContact O-CB 3.24Å; V65-S69 WeakPolarHBondContact O-CB 3.4Å; V65-S69 PolarHBondContact O-N 2.93Å; V65-S69 PolarHBondContact O-OG 3.04Å
66	S	78.5	Confident	78.8	Confident	25 Å²	25	83.6 Å²	83.6	18%	0.175	41%	0.406	C	S	.	.	H	α-helix	trans	-62.6	-43.3	174.7	-59.8	0	0	0	0	111.2	Y62 Y70	Y62-S66 WeakPolarHBondContact CE2-OG 3.36Å; Y62-S66 WeakPolarHBondContact O-CB 3.48Å; Y62-S66 PolarHBondContact O-N 3.49Å; Y62-S66 PolarHBondContact O-OG 2.91Å; S66-Y70 WeakPolarHBondContact O-CB 3.34Å; S66-Y70 PolarHBondContact O-N 3.32Å
67	S	81.2	Confident	78.5	Confident	61 Å²	61	78.3 Å²	78.3	43%	0.427	39%	0.388	S	S	.	.	H	α-helix	trans	-64.6	-48	177	-176.2	0	0	0	0	111.9	F63 V64 V65 S69 Y70 S71	F63-S67 VanDerWaalsContact O-CB 3.28Å; F63-S67 WeakPolarHBondContact O-CB 3.28Å; F63-S67 PolarHBondContact O-N 2.87Å; V64-S67 PolarHBondContact O-N 2.82Å; V65-S67 VanDerWaalsContact C-N 3.34Å; S67-S69 VanDerWaalsContact C-N 3.34Å; S67-S69 PolarHBondContact O-N 3.37Å; S67-Y70 WeakPolarHBondContact O-CB 3.37Å; S67-Y70 PolarHBondContact O-N 2.93Å; S67-S71 PolarHBondContact O-N 3.06Å; S67-S71 PolarHBondContact O-OG 2.88Å
68	S	79.2	Confident	78.4	Confident	71 Å²	71	74.7 Å²	74.7	50%	0.497	38%	0.375	S	S	.	.	H	α-helix	trans	-61.5	-41.6	177.3	-64.6	0	0	0	0	112.3	V64 V65 Y70 S71 Y72	V64-S68 WeakPolarHBondContact O-CB 3.49Å; V64-S68 PolarHBondContact O-N 3Å; V64-S68 PolarHBondContact O-OG 3.07Å; V64-S68 VanDerWaalsContact O-OG 3.07Å; V65-S68 PolarHBondContact O-N 3.31Å; S68-Y70 VanDerWaalsContact C-N 3.35Å; S68-S71 PolarHBondContact O-N 2.88Å; S68-Y72 WeakPolarHBondContact O-CB 3.05Å; S68-Y72 PolarHBondContact O-N 2.68Å
69	S	75.7	Confident	78.5	Confident	16 Å²	16	76.4 Å²	76.4	11%	0.112	38%	0.384	C	S	.	.	H	α-helix	trans	-66.7	-39.2	178	-55.1	0	0	0	0	111.3	C29 Y32 V65 S67 Y72 C73	C29-S69 PolarHBondContact SG-O 3.22Å; C29-S69 VanDerWaalsContact SG-O 3.34Å; Y32-S69 WeakPolarHBondContact CB-OG 2.94Å; V65-S69 VanDerWaalsContact O-CB 3.24Å; V65-S69 WeakPolarHBondContact O-CB 3.4Å; V65-S69 PolarHBondContact O-N 2.93Å; V65-S69 PolarHBondContact O-OG 3.04Å; S67-S69 VanDerWaalsContact C-N 3.34Å; S67-S69 PolarHBondContact O-N 3.37Å; S69-Y72 PolarHBondContact O-N 2.8Å; S69-C73 WeakPolarHBondContact O-CB 3.19Å; S69-C73 PolarHBondContact O-N 3.39Å
70	Y	75.3	Confident	78.3	Confident	151 Å²	151	79.5 Å²	79.5	59%	0.592	39%	0.393	S	S	*	.	H	α-helix	trans	-61.6	-47.6	174.2	-179.2	-97.7	0	0	0	111.4	C29 S66 S67 S68 Y72 C73 Y74	C29-Y70 VanDerWaalsContact SG-CA 3.57Å; S66-Y70 WeakPolarHBondContact O-CB 3.34Å; S66-Y70 PolarHBondContact O-N 3.32Å; S67-Y70 WeakPolarHBondContact O-CB 3.37Å; S67-Y70 PolarHBondContact O-N 2.93Å; S68-Y70 VanDerWaalsContact C-N 3.35Å; Y70-Y72 VanDerWaalsContact C-N 3.35Å; Y70-Y72 PolarHBondContact O-N 3.22Å; Y70-C73 PolarHBondContact O-N 3Å; Y70-Y74 WeakPolarHBondContact O-CB 3.41Å; Y70-Y74 PolarHBondContact O-N 3.35Å
71	S	79.5	Confident	78.1	Confident	70 Å²	70	80 Å²	80	49%	0.49	39%	0.394	S	S	.	.	H	α-helix	trans	-60	-43.6	175.6	-64.4	0	0	0	0	112.2	S67 S68 F75	S67-S71 PolarHBondContact O-N 3.06Å; S67-S71 PolarHBondContact O-OG 2.88Å; S68-S71 PolarHBondContact O-N 2.88Å; S71-F75 WeakPolarHBondContact O-CB 3.35Å; S71-F75 PolarHBondContact O-N 2.9Å
72	Y	74.7	Confident	78	Confident	139 Å²	139	86.3 Å²	86.3	55%	0.545	41%	0.414	S	S	.	.	H	α-helix	trans	-62.9	-46.1	177.4	-174.7	-91.5	0	0	0	111.6	S68 S69 Y70 F75 E76	S68-Y72 WeakPolarHBondContact O-CB 3.05Å; S68-Y72 PolarHBondContact O-N 2.68Å; S69-Y72 PolarHBondContact O-N 2.8Å; Y70-Y72 VanDerWaalsContact C-N 3.35Å; Y70-Y72 PolarHBondContact O-N 3.22Å; Y72-F75 WeakPolarHBondContact O-CB 3.24Å; Y72-F75 PolarHBondContact O-N 3.48Å; Y72-E76 HydrophobicContact CD1-CG 4.13Å; Y72-E76 HydrophobicContact CE1-CG 3.57Å; Y72-E76 PolarHBondContact O-N 3.43Å; Y72-E76 PolarHBondContact OH-OE1 2.89Å
73	C	73.1	Confident	78	Confident	10 Å²	10	85.7 Å²	85.7	7%	0.068	42%	0.418	C	S	.	.	H	α-helix	trans	-71.3	-34.8	-179	-148.1	0	0	0	0	113	C25 S69 Y70 F75 E76 K77	C25-C73 WeakPolarHBondContact CA-SG 3.14Å; C25-C73 HydrophobicContact CB-CB 3.76Å; C25-C73 WeakPolarHBondContact CB-SG 3.47Å; C25-C73 WeakPolarHBondContact SG-CB 3.41Å; C25-C73 PolarHBondContact SG-O 2.67Å; C25-C73 CovalentContact SG-SG 2.03Å; C25-C73 PolarHBondContact SG-SG 3.23Å; S69-C73 WeakPolarHBondContact O-CB 3.19Å; S69-C73 PolarHBondContact O-N 3.39Å; Y70-C73 PolarHBondContact O-N 3Å; C73-F75 VanDerWaalsContact C-N 3.3Å; C73-E76 PolarHBondContact O-N 3.01Å; C73-K77 WeakPolarHBondContact O-CB 3.33Å; C73-K77 PolarHBondContact O-N 3.41Å
74	Y	76.9	Confident	77.9	Confident	145 Å²	145	81.8 Å²	81.8	57%	0.569	41%	0.406	S	S	*	.	H	α-helix	trans	-60.3	-44.3	171.3	-175.2	-97.3	0	0	0	110.8	Y70 K77 V78	Y70-Y74 WeakPolarHBondContact O-CB 3.41Å; Y70-Y74 PolarHBondContact O-N 3.35Å; Y74-K77 PolarHBondContact O-N 2.81Å; Y74-V78 HydrophobicContact CD1-CG2 4.34Å; Y74-V78 HydrophobicContact CE1-CG2 3.98Å; Y74-V78 WeakPolarHBondContact O-CG2 3.42Å; Y74-V78 PolarHBondContact O-N 3.42Å
75	F	78.7	Confident	77.9	Confident	141 Å²	141	84.4 Å²	84.4	62%	0.618	41%	0.413	S	S	*	.	H	α-helix	trans	-63.1	-45.3	175.8	-173.6	-94.9	0	0	0	112.4	S71 Y72 C73 K77 V78 T79	S71-F75 WeakPolarHBondContact O-CB 3.35Å; S71-F75 PolarHBondContact O-N 2.9Å; Y72-F75 WeakPolarHBondContact O-CB 3.24Å; Y72-F75 PolarHBondContact O-N 3.48Å; C73-F75 VanDerWaalsContact C-N 3.3Å; F75-K77 PolarHBondContact O-N 2.72Å; F75-V78 PolarHBondContact O-N 3.25Å; F75-T79 WeakPolarHBondContact O-CB 3.46Å; F75-T79 PolarHBondContact O-N 2.96Å; F75-T79 PolarHBondContact O-OG1 3.36Å
76	E	72	Confident	77.9	Confident	67 Å²	67	88.3 Å²	88.3	31%	0.313	43%	0.429	S	S	.	.	H	α-helix	trans	-63.4	-39.6	176	-78.1	-148.5	148.2	0	0	112.3	R28 Y72 C73 T79 M80	R28-E76 IonicContact NH1-OE2 3.88Å; Y72-E76 HydrophobicContact CD1-CG 4.13Å; Y72-E76 HydrophobicContact CE1-CG 3.57Å; Y72-E76 PolarHBondContact O-N 3.43Å; Y72-E76 PolarHBondContact OH-OE1 2.89Å; C73-E76 PolarHBondContact O-N 3.01Å; E76-T79 PolarHBondContact O-N 3.42Å; E76-M80 VanDerWaalsContact O-CB 3.28Å; E76-M80 WeakPolarHBondContact O-CB 3.46Å; E76-M80 PolarHBondContact O-N 3.48Å
77	K	75.5	Confident	78.1	Confident	80 Å²	80	91.9 Å²	91.9	35%	0.348	45%	0.446	S	S	.	.	H	α-helix	trans	-60.9	-50.2	176.9	-175.7	177	179.3	176.5	0	110.9	E23 C73 Y74 F75 T79 M80 E81	E23-K77 IonicContact OE1-NZ 2.86Å; E23-K77 PolarHBondContact OE1-NZ 2.9Å; C73-K77 WeakPolarHBondContact O-CB 3.33Å; C73-K77 PolarHBondContact O-N 3.41Å; Y74-K77 PolarHBondContact O-N 2.81Å; F75-K77 PolarHBondContact O-N 2.72Å; K77-T79 VanDerWaalsContact C-N 3.29Å; K77-T79 PolarHBondContact O-N 2.85Å; K77-M80 PolarHBondContact O-N 3.5Å; K77-E81 WeakPolarHBondContact CE-OE1 3.34Å; K77-E81 WeakPolarHBondContact O-CB 3.42Å; K77-E81 WeakPolarHBondContact O-CG 3.03Å; K77-E81 PolarHBondContact O-N 3.32Å
78	V	80.1	Confident	78	Confident	36 Å²	36	97.5 Å²	97.5	22%	0.218	46%	0.458	C	S	.	.	H	α-helix	trans	-62.2	-38.7	178	173	0	0	0	0	111.3	Y74 F75 R82	Y74-V78 HydrophobicContact CD1-CG2 4.34Å; Y74-V78 HydrophobicContact CE1-CG2 3.98Å; Y74-V78 WeakPolarHBondContact O-CG2 3.42Å; Y74-V78 PolarHBondContact O-N 3.42Å; F75-V78 PolarHBondContact O-N 3.25Å; V78-R82 PolarHBondContact O-N 3.33Å
79	T	80.1	Confident	78.2	Confident	44 Å²	44	100 Å²	100	27%	0.27	46%	0.461	S	S	.	.	H	α-helix	trans	-69.6	-43.5	178.6	-55.7	0	0	0	0	111.6	F75 E76 K77 R82 N83	F75-T79 WeakPolarHBondContact O-CB 3.46Å; F75-T79 PolarHBondContact O-N 2.96Å; F75-T79 PolarHBondContact O-OG1 3.36Å; E76-T79 PolarHBondContact O-N 3.42Å; K77-T79 VanDerWaalsContact C-N 3.29Å; K77-T79 PolarHBondContact O-N 2.85Å; T79-R82 PolarHBondContact O-N 3.4Å; T79-N83 WeakPolarHBondContact O-CB 3.12Å; T79-N83 PolarHBondContact O-N 3.41Å; T79-N83 PolarHBondContact O-ND2 2.86Å; T79-N83 PolarHBondContact O-OD1 3.49Å
80	M	76	Confident	78.6	Confident	124 Å²	124	103.5 Å²	103.5	61%	0.611	48%	0.478	S	S	*	.	H	α-helix	trans	-62	-44.2	175	-95.9	-84.5	-161.6	0	0	111.8	E76 K77 R82 N83 V84	E76-M80 VanDerWaalsContact O-CB 3.28Å; E76-M80 WeakPolarHBondContact O-CB 3.46Å; E76-M80 PolarHBondContact O-N 3.48Å; K77-M80 PolarHBondContact O-N 3.5Å; M80-R82 VanDerWaalsContact C-N 3.31Å; M80-R82 PolarHBondContact O-N 2.89Å; M80-N83 PolarHBondContact O-N 3.06Å; M80-V84 WeakPolarHBondContact O-CB 3.43Å; M80-V84 WeakPolarHBondContact O-CG2 3.26Å; M80-V84 PolarHBondContact O-N 3.1Å
81	E	80	Confident	78.9	Confident	115 Å²	115	101 Å²	101	54%	0.537	47%	0.474	S	S	.	.	H	α-helix	trans	-58.6	-44.2	178.1	-77.8	175.7	173.2	0	0	111.1	K77 V84 E85	K77-E81 WeakPolarHBondContact CE-OE1 3.34Å; K77-E81 WeakPolarHBondContact O-CB 3.42Å; K77-E81 WeakPolarHBondContact O-CG 3.03Å; K77-E81 PolarHBondContact O-N 3.32Å; E81-V84 PolarHBondContact O-N 3.21Å; E81-E85 WeakPolarHBondContact O-CB 3.26Å; E81-E85 PolarHBondContact O-N 2.95Å; E81-E85 VanDerWaalsContact O-N 3.08Å
82	R	78.6	Confident	79	Confident	157 Å²	157	103.9 Å²	103.9	59%	0.592	48%	0.479	S	S	*	.	H	α-helix	trans	-63.7	-48.3	173.8	-72.3	-172.8	-177.3	129.8	1.4	113	V78 T79 M80 V84 E85 E86	V78-R82 PolarHBondContact O-N 3.33Å; T79-R82 PolarHBondContact O-N 3.4Å; M80-R82 VanDerWaalsContact C-N 3.31Å; M80-R82 PolarHBondContact O-N 2.89Å; R82-V84 VanDerWaalsContact C-N 3.27Å; R82-V84 PolarHBondContact O-N 3.45Å; R82-E85 WeakPolarHBondContact O-CB 3.27Å; R82-E85 PolarHBondContact O-N 2.86Å; R82-E85 VanDerWaalsContact O-N 3.15Å; R82-E86 PolarHBondContact O-N 2.97Å
83	N	79.5	Confident	79.5	Confident	83 Å²	83	103.2 Å²	103.2	44%	0.444	48%	0.481	S	S	.	.	H	α-helix	trans	-63.2	-35	-179.1	-68.2	-9.1	0	0	0	112	T79 M80 L87	T79-N83 WeakPolarHBondContact O-CB 3.12Å; T79-N83 PolarHBondContact O-N 3.41Å; T79-N83 PolarHBondContact O-ND2 2.86Å; T79-N83 PolarHBondContact O-OD1 3.49Å; M80-N83 PolarHBondContact O-N 3.06Å; N83-L87 WeakPolarHBondContact O-CB 3.29Å; N83-L87 PolarHBondContact O-N 3.36Å
84	V	79.5	Confident	79.9	Confident	71 Å²	71	106.1 Å²	106.1	43%	0.43	50%	0.499	S	S	.	.	H	α-helix	trans	-71.4	-35.4	176.9	170.1	0	0	0	0	111.2	M80 E81 R82 R88	M80-V84 WeakPolarHBondContact O-CB 3.43Å; M80-V84 WeakPolarHBondContact O-CG2 3.26Å; M80-V84 PolarHBondContact O-N 3.1Å; E81-V84 PolarHBondContact O-N 3.21Å; R82-V84 VanDerWaalsContact C-N 3.27Å; R82-V84 PolarHBondContact O-N 3.45Å; V84-R88 WeakPolarHBondContact O-CB 3.39Å; V84-R88 WeakPolarHBondContact O-CG 3.32Å; V84-R88 PolarHBondContact O-N 3.41Å
85	E	82.9	Confident	80	Confident	131 Å²	131	103.7 Å²	103.7	61%	0.612	49%	0.492	S	S	*	.	H	α-helix	trans	-65.3	-49.6	174.6	-164.7	162.7	-153.3	0	0	110.7	E81 R82 L87 R88 E89	E81-E85 WeakPolarHBondContact O-CB 3.26Å; E81-E85 PolarHBondContact O-N 2.95Å; E81-E85 VanDerWaalsContact O-N 3.08Å; R82-E85 WeakPolarHBondContact O-CB 3.27Å; R82-E85 PolarHBondContact O-N 2.86Å; R82-E85 VanDerWaalsContact O-N 3.15Å; E85-L87 PolarHBondContact O-N 3.14Å; E85-R88 WeakPolarHBondContact O-CB 3.47Å; E85-R88 PolarHBondContact O-N 3.38Å; E85-E89 WeakPolarHBondContact O-CG 3.34Å; E85-E89 PolarHBondContact O-N 2.96Å
86	E	80.1	Confident	80.1	Confident	117 Å²	117	103.3 Å²	103.3	55%	0.547	49%	0.493	S	S	.	.	H	α-helix	trans	-58.7	-44.6	173.7	-70.1	179.9	-175.6	0	0	111.9	R82 R88 E89 I90	R82-E86 PolarHBondContact O-N 2.97Å; E86-R88 VanDerWaalsContact C-N 3.34Å; E86-R88 PolarHBondContact O-N 3.48Å; E86-E89 PolarHBondContact O-N 3.45Å; E86-I90 VanDerWaalsContact O-CG1 3.31Å; E86-I90 WeakPolarHBondContact O-CG1 3.37Å; E86-I90 PolarHBondContact O-N 3.29Å
87	L	80.8	Confident	80.3	Confident	100 Å²	100	106.2 Å²	106.2	52%	0.524	51%	0.506	S	S	.	.	H	α-helix	trans	-67.6	-34.9	179.8	-161.6	73.7	0	0	0	112	N83 E85 I90 I91	N83-L87 WeakPolarHBondContact O-CB 3.29Å; N83-L87 PolarHBondContact O-N 3.36Å; E85-L87 PolarHBondContact O-N 3.14Å; L87-I90 PolarHBondContact O-N 2.82Å; L87-I91 HydrophobicContact CD2-CD1 4.33Å; L87-I91 HydrophobicContact CG-CD1 4.01Å; L87-I91 WeakPolarHBondContact O-CB 3.29Å; L87-I91 WeakPolarHBondContact O-CD1 3.13Å; L87-I91 WeakPolarHBondContact O-CG1 3.22Å; L87-I91 PolarHBondContact O-N 3.45Å
88	R	79.8	Confident	80.3	Confident	180 Å²	180	108.5 Å²	108.5	68%	0.679	52%	0.518	S	S	*	.	H	α-helix	trans	-63.6	-42.2	173.6	-91.6	-170.1	-170.8	-177.3	5.1	111.6	V84 E85 E86 I91 H92	V84-R88 WeakPolarHBondContact O-CB 3.39Å; V84-R88 WeakPolarHBondContact O-CG 3.32Å; V84-R88 PolarHBondContact O-N 3.41Å; E85-R88 WeakPolarHBondContact O-CB 3.47Å; E85-R88 PolarHBondContact O-N 3.38Å; E86-R88 VanDerWaalsContact C-N 3.34Å; E86-R88 PolarHBondContact O-N 3.48Å; R88-I91 PolarHBondContact O-N 2.88Å; R88-H92 WeakPolarHBondContact O-CB 3.41Å; R88-H92 PolarHBondContact O-N 3.48Å
89	E	83.8	Confident	80	Confident	122 Å²	122	112.9 Å²	112.9	57%	0.57	53%	0.534	S	S	*	.	H	α-helix	trans	-62.6	-46.3	177	-70.6	-176.1	170	0	0	110.9	E85 E86 I91 H92 Q93	E85-E89 WeakPolarHBondContact O-CG 3.34Å; E85-E89 PolarHBondContact O-N 2.96Å; E86-E89 PolarHBondContact O-N 3.45Å; E89-I91 PolarHBondContact O-N 3.33Å; E89-H92 PolarHBondContact O-N 2.92Å; E89-Q93 WeakPolarHBondContact O-CG 3.44Å; E89-Q93 PolarHBondContact O-N 2.75Å
90	I	83.1	Confident	79.7	Confident	91 Å²	91	116.7 Å²	116.7	47%	0.467	55%	0.552	S	S	.	*	H	α-helix	trans	-61.9	-45.9	177.1	-63.9	165	0	0	0	111	E86 L87 H92 Q93 V94	E86-I90 VanDerWaalsContact O-CG1 3.31Å; E86-I90 WeakPolarHBondContact O-CG1 3.37Å; E86-I90 PolarHBondContact O-N 3.29Å; L87-I90 PolarHBondContact O-N 2.82Å; I90-H92 VanDerWaalsContact C-N 3.3Å; I90-H92 PolarHBondContact O-N 2.68Å; I90-Q93 PolarHBondContact O-N 2.81Å; I90-V94 HydrophobicContact CG2-CG2 4.26Å; I90-V94 WeakPolarHBondContact O-CG2 3.36Å; I90-V94 PolarHBondContact O-N 3.5Å
91	I	82.9	Confident	79.5	Confident	99 Å²	99	116.3 Å²	116.3	51%	0.508	55%	0.552	S	S	.	*	H	α-helix	trans	-62.2	-39.3	178	-71	165.6	0	0	0	110.9	L87 R88 E89 H95	L87-I91 HydrophobicContact CD2-CD1 4.33Å; L87-I91 HydrophobicContact CG-CD1 4.01Å; L87-I91 WeakPolarHBondContact O-CB 3.29Å; L87-I91 WeakPolarHBondContact O-CD1 3.13Å; L87-I91 WeakPolarHBondContact O-CG1 3.22Å; L87-I91 PolarHBondContact O-N 3.45Å; R88-I91 PolarHBondContact O-N 2.88Å; E89-I91 PolarHBondContact O-N 3.33Å; I91-H95 WeakPolarHBondContact O-CB 3.23Å; I91-H95 PolarHBondContact O-N 2.94Å
92	H	81.5	Confident	79.2	Confident	129 Å²	129	118.2 Å²	118.2	60%	0.597	56%	0.561	S	S	*	*	H	α-helix	trans	-64.4	-41	176.4	-109.4	-81.2	0	0	0	112.2	R88 E89 I90 Q96	R88-H92 WeakPolarHBondContact O-CB 3.41Å; R88-H92 PolarHBondContact O-N 3.48Å; E89-H92 PolarHBondContact O-N 2.92Å; I90-H92 VanDerWaalsContact C-N 3.3Å; I90-H92 PolarHBondContact O-N 2.68Å; H92-Q96 WeakPolarHBondContact O-CG 3.36Å; H92-Q96 PolarHBondContact O-N 3.36Å; H92-Q96 VanDerWaalsContact O-N 3.07Å
93	Q	84.6	Confident	78.9	Confident	125 Å²	125	117.7 Å²	117.7	58%	0.584	57%	0.57	S	S	*	*	H	α-helix	trans	-65.3	-50	175.6	-73.2	-176.2	-4.9	0	0	111.5	E89 I90 H95 Q96 E97	E89-Q93 WeakPolarHBondContact O-CG 3.44Å; E89-Q93 PolarHBondContact O-N 2.75Å; I90-Q93 PolarHBondContact O-N 2.81Å; Q93-H95 VanDerWaalsContact C-N 3.3Å; Q93-H95 PolarHBondContact O-N 3.38Å; Q93-Q96 WeakPolarHBondContact O-CB 3.49Å; Q93-Q96 PolarHBondContact O-N 3.48Å; Q93-E97 PolarHBondContact O-N 2.93Å
94	V	81.1	Confident	78.4	Confident	71 Å²	71	120.3 Å²	120.3	43%	0.43	58%	0.584	S	S	.	*	H	α-helix	trans	-60.9	-39.3	178.4	173.8	0	0	0	0	111.4	I90 Q96 E97 Q98	I90-V94 HydrophobicContact CG2-CG2 4.26Å; I90-V94 WeakPolarHBondContact O-CG2 3.36Å; I90-V94 PolarHBondContact O-N 3.5Å; V94-Q96 VanDerWaalsContact C-N 3.31Å; V94-Q96 PolarHBondContact O-N 2.82Å; V94-E97 PolarHBondContact O-N 3.12Å; V94-Q98 WeakPolarHBondContact O-CB 3.27Å; V94-Q98 WeakPolarHBondContact O-CG 3.22Å; V94-Q98 PolarHBondContact O-N 3.16Å
95	H	80.2	Confident	77.6	Confident	94 Å²	94	124.7 Å²	124.7	44%	0.435	62%	0.618	S	S	.	*	H	α-helix	trans	-68.7	-29.6	176.7	-169.5	70.3	0	0	0	112.8	I91 Q93 K99	I91-H95 WeakPolarHBondContact O-CB 3.23Å; I91-H95 PolarHBondContact O-N 2.94Å; Q93-H95 VanDerWaalsContact C-N 3.3Å; Q93-H95 PolarHBondContact O-N 3.38Å; H95-K99 WeakPolarHBondContact NE2-CE 3.4Å; H95-K99 PolarHBondContact NE2-NZ 2.97Å; H95-K99 WeakPolarHBondContact O-CG 3.34Å; H95-K99 PolarHBondContact O-N 3.33Å
96	Q	79	Confident	77.3	Confident	134 Å²	134	124.4 Å²	124.4	63%	0.626	62%	0.619	S	S	*	*	H	α-helix	trans	-74.4	-42.6	172.5	-79.5	-171.5	-16.9	0	0	112	H92 Q93 V94 K99 L100	H92-Q96 WeakPolarHBondContact O-CG 3.36Å; H92-Q96 PolarHBondContact O-N 3.36Å; H92-Q96 VanDerWaalsContact O-N 3.07Å; Q93-Q96 WeakPolarHBondContact O-CB 3.49Å; Q93-Q96 PolarHBondContact O-N 3.48Å; V94-Q96 VanDerWaalsContact C-N 3.31Å; V94-Q96 PolarHBondContact O-N 2.82Å; Q96-K99 PolarHBondContact O-N 3.39Å; Q96-L100 PolarHBondContact O-N 2.66Å; Q96-L100 VanDerWaalsContact O-N 3.08Å
97	E	76.2	Confident	77.2	Confident	127 Å²	127	124.8 Å²	124.8	59%	0.593	62%	0.622	S	S	*	*	H	α-helix	trans	-61.9	-45.6	175.5	-72.5	-169.5	114.5	0	0	111.4	Q93 V94 K99 L100 D101	Q93-E97 PolarHBondContact O-N 2.93Å; V94-E97 PolarHBondContact O-N 3.12Å; E97-K99 VanDerWaalsContact C-N 3.26Å; E97-K99 PolarHBondContact O-N 3.47Å; E97-L100 WeakPolarHBondContact O-CA 3.43Å; E97-L100 WeakPolarHBondContact O-CB 3.37Å; E97-L100 PolarHBondContact O-N 3.08Å; E97-D101 PolarHBondContact O-N 3.32Å
98	Q	77.4	Confident	77	Confident	128 Å²	128	126.2 Å²	126.2	60%	0.598	63%	0.628	S	S	*	*	H	α-helix	trans	-60	-34.4	175.8	-79	-161.9	-33.1	0	0	113.4	V94 L100 Q102	V94-Q98 WeakPolarHBondContact O-CB 3.27Å; V94-Q98 WeakPolarHBondContact O-CG 3.22Å; V94-Q98 PolarHBondContact O-N 3.16Å; Q98-L100 VanDerWaalsContact C-N 3.34Å; Q98-Q102 WeakPolarHBondContact O-CB 3.03Å; Q98-Q102 PolarHBondContact O-N 3.42Å; Q98-Q102 VanDerWaalsContact O-N 3.17Å
99	K	72.9	Confident	76.8	Confident	129 Å²	129	123 Å²	123	56%	0.561	63%	0.625	S	S	*	*	H	α-helix	trans	-71.7	-28.7	174.4	-81.8	-176.2	177.8	171.6	0	112.8	H95 Q96 E97	H95-K99 WeakPolarHBondContact NE2-CE 3.4Å; H95-K99 PolarHBondContact NE2-NZ 2.97Å; H95-K99 WeakPolarHBondContact O-CG 3.34Å; H95-K99 PolarHBondContact O-N 3.33Å; Q96-K99 PolarHBondContact O-N 3.39Å; E97-K99 VanDerWaalsContact C-N 3.26Å; E97-K99 PolarHBondContact O-N 3.47Å
100	L	73.1	Confident	76.4	Confident	124 Å²	124	123.1 Å²	123.1	65%	0.649	63%	0.628	S	S	*	*	H	α-helix	trans	-73	-48.9	176.3	-149.6	94	0	0	0	110.3	Q96 E97 Q98 Q102 N103 D104	Q96-L100 PolarHBondContact O-N 2.66Å; Q96-L100 VanDerWaalsContact O-N 3.08Å; E97-L100 WeakPolarHBondContact O-CA 3.43Å; E97-L100 WeakPolarHBondContact O-CB 3.37Å; E97-L100 PolarHBondContact O-N 3.08Å; Q98-L100 VanDerWaalsContact C-N 3.34Å; L100-Q102 VanDerWaalsContact C-N 3.29Å; L100-Q102 PolarHBondContact O-N 2.91Å; L100-N103 PolarHBondContact O-N 2.85Å; L100-D104 PolarHBondContact O-N 3.44Å
101	D	72.7	Confident	75.9	Confident	115 Å²	115	125.2 Å²	125.2	62%	0.615	64%	0.639	S	S	*	*	H	α-helix	trans	-59.6	-36.9	177.3	-86.8	-54.9	0	0	0	112.7	E97 N103 D104	E97-D101 PolarHBondContact O-N 3.32Å; D101-N103 PolarHBondContact O-N 2.98Å; D101-D104 PolarHBondContact O-N 2.94Å
102	Q	73.3	Confident	75.5	Confident	156 Å²	156	127.1 Å²	127.1	73%	0.729	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.2	-18.7	177.9	-165.7	175.3	-0.7	0	0	113.3	Q98 L100	Q98-Q102 WeakPolarHBondContact O-CB 3.03Å; Q98-Q102 PolarHBondContact O-N 3.42Å; Q98-Q102 VanDerWaalsContact O-N 3.17Å; L100-Q102 VanDerWaalsContact C-N 3.29Å; L100-Q102 PolarHBondContact O-N 2.91Å
103	N	72.1	Confident	75	Confident	145 Å²	145	126.9 Å²	126.9	78%	0.775	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.3	-17.5	178.3	-124.6	11.5	0	0	0	112.8	L100 D101	L100-N103 PolarHBondContact O-N 2.85Å; D101-N103 PolarHBondContact O-N 2.98Å
104	D	69.2	Low	74.2	Confident	139 Å²	139	127.1 Å²	127.1	74%	0.743	66%	0.658	S	S	*	*			trans	-92.2	-3.4	176.3	-90.8	-24.9	0	0	0	113.7	L100 D101	L100-D104 PolarHBondContact O-N 3.44Å; D101-D104 PolarHBondContact O-N 2.94Å
105	S	63	Low	73.6	Confident	163 Å²	163	132.2 Å²	132.2	100%	1.14	68%	0.679	S	S	*	*			trans	-104.3	0	168.9	-74.5	0	0	0	0	112.4

Retrieved 105 of 105 residues in 17.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).