A0A077ZES3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZES3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 64 aa.

						>A0A077ZES3_TRITR|A0A077ZES3
MQEDWNNREFINVFSVNVKKIADFLTSFELSCRHKFALMNEKLNALEKKIDFLEASVSSTVYLR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	83.7	Confident	95.7	Very high	191 Å²	191	126.4 Å²	126.4	94%	0.941	59%	0.586	S	S	*	*				0	-54.3	0	-158.8	175.6	-172.1	0	0	111.5	E3 D4 W5	M1-E3 VanDerWaalsContact C-N 3.32Å; M1-E3 PolarHBondContact O-N 3.25Å; M1-D4 PolarHBondContact O-N 3.43Å; M1-W5 VanDerWaalsContact O-CD1 3.31Å; M1-W5 PolarHBondContact O-N 2.99Å
2	Q	93.7	Very high	95.9	Very high	127 Å²	127	122.8 Å²	122.8	59%	0.593	57%	0.574	S	S	*	*	H	α-helix	trans	-57.7	-38.8	179.4	-171.2	60.7	39.9	0	0	114.3	D4 W5 N6	Q2-D4 PolarHBondContact O-N 2.76Å; Q2-W5 WeakPolarHBondContact O-CB 3.42Å; Q2-W5 PolarHBondContact O-N 3.39Å; Q2-N6 PolarHBondContact NE2-OD1 3.02Å; Q2-N6 VanDerWaalsContact O-CG 3.3Å; Q2-N6 PolarHBondContact O-N 3.48Å; Q2-N6 PolarHBondContact O-OD1 2.74Å
3	E	95.7	Very high	96.1	Very high	144 Å²	144	118.3 Å²	118.3	67%	0.673	56%	0.56	S	S	*	*	H	α-helix	trans	-62.8	-41	178.7	-170.9	-178.4	177.4	0	0	112.8	M1 W5 N6 N7	M1-E3 VanDerWaalsContact C-N 3.32Å; M1-E3 PolarHBondContact O-N 3.25Å; E3-W5 VanDerWaalsContact C-N 3.32Å; E3-W5 PolarHBondContact O-N 3.26Å; E3-N6 PolarHBondContact O-N 3.18Å; E3-N7 WeakPolarHBondContact O-CB 3.38Å; E3-N7 VanDerWaalsContact O-CG 3.3Å; E3-N7 PolarHBondContact O-N 3.32Å
4	D	96.7	Very high	96.2	Very high	76 Å²	76	118.9 Å²	118.9	41%	0.406	56%	0.56	S	S	.	*	H	α-helix	trans	-62.6	-40.1	175.4	-176	50.8	0	0	0	111.2	M1 Q2 N7 R8	M1-D4 PolarHBondContact O-N 3.43Å; Q2-D4 PolarHBondContact O-N 2.76Å; D4-N7 PolarHBondContact O-N 3.11Å; D4-R8 WeakPolarHBondContact O-CB 3.09Å; D4-R8 VanDerWaalsContact O-CG 3.26Å; D4-R8 WeakPolarHBondContact O-CG 3.35Å; D4-R8 PolarHBondContact O-N 2.9Å; D4-R8 IonicContact OD1-NE 2.91Å; D4-R8 PolarHBondContact OD1-NE 3.42Å; D4-R8 IonicContact OD1-NH2 3.88Å; D4-R8 IonicContact OD2-CZ 3.18Å; D4-R8 IonicContact OD2-NE 3.4Å; D4-R8 PolarHBondContact OD2-NE 2.97Å; D4-R8 IonicContact OD2-NH2 2.77Å; D4-R8 PolarHBondContact OD2-NH2 3.19Å
5	W	97.5	Very high	96.4	Very high	157 Å²	157	115.9 Å²	115.9	60%	0.595	56%	0.556	S	S	*	*	H	α-helix	trans	-60	-47.1	172.2	-79.7	102.3	0	0	0	112.3	M1 Q2 E3 N7 R8 E9	M1-W5 VanDerWaalsContact O-CD1 3.31Å; M1-W5 PolarHBondContact O-N 2.99Å; Q2-W5 WeakPolarHBondContact O-CB 3.42Å; Q2-W5 PolarHBondContact O-N 3.39Å; E3-W5 VanDerWaalsContact C-N 3.32Å; E3-W5 PolarHBondContact O-N 3.26Å; W5-N7 VanDerWaalsContact C-N 3.33Å; W5-N7 PolarHBondContact O-N 2.89Å; W5-R8 PolarHBondContact O-N 3.28Å; W5-E9 WeakPolarHBondContact O-CB 3.21Å; W5-E9 PolarHBondContact O-N 2.92Å
6	N	97	Very high	96.5	Very high	90 Å²	90	112.3 Å²	112.3	48%	0.481	54%	0.544	S	S	.	.	H	α-helix	trans	-63.7	-40.3	179.9	-65.5	-9	0	0	0	111.5	Q2 E3 E9 F10	Q2-N6 PolarHBondContact NE2-OD1 3.02Å; Q2-N6 VanDerWaalsContact O-CG 3.3Å; Q2-N6 PolarHBondContact O-N 3.48Å; Q2-N6 PolarHBondContact O-OD1 2.74Å; E3-N6 PolarHBondContact O-N 3.18Å; N6-E9 PolarHBondContact O-N 2.92Å; N6-F10 WeakPolarHBondContact O-CB 3.42Å; N6-F10 PolarHBondContact O-N 3.24Å
7	N	97.4	Very high	96.6	Very high	83 Å²	83	110.1 Å²	110.1	44%	0.444	54%	0.536	S	S	.	.	H	α-helix	trans	-66.3	-43.1	177.8	-71.5	-16.9	0	0	0	111.8	E3 D4 W5 F10 I11	E3-N7 WeakPolarHBondContact O-CB 3.38Å; E3-N7 VanDerWaalsContact O-CG 3.3Å; E3-N7 PolarHBondContact O-N 3.32Å; D4-N7 PolarHBondContact O-N 3.11Å; W5-N7 VanDerWaalsContact C-N 3.33Å; W5-N7 PolarHBondContact O-N 2.89Å; N7-F10 PolarHBondContact O-N 3.11Å; N7-I11 WeakPolarHBondContact O-CG1 3.33Å; N7-I11 PolarHBondContact O-N 3.22Å
8	R	97.8	Very high	96.7	Very high	156 Å²	156	108.2 Å²	108.2	59%	0.589	53%	0.531	S	S	*	.	H	α-helix	trans	-62.3	-42.6	175.7	-72.3	175.4	-168.1	-145.3	8.8	111.9	D4 W5 I11 N12	D4-R8 WeakPolarHBondContact O-CB 3.09Å; D4-R8 VanDerWaalsContact O-CG 3.26Å; D4-R8 WeakPolarHBondContact O-CG 3.35Å; D4-R8 PolarHBondContact O-N 2.9Å; D4-R8 IonicContact OD1-NE 2.91Å; D4-R8 PolarHBondContact OD1-NE 3.42Å; D4-R8 IonicContact OD1-NH2 3.88Å; D4-R8 IonicContact OD2-CZ 3.18Å; D4-R8 IonicContact OD2-NE 3.4Å; D4-R8 PolarHBondContact OD2-NE 2.97Å; D4-R8 IonicContact OD2-NH2 2.77Å; D4-R8 PolarHBondContact OD2-NH2 3.19Å; W5-R8 PolarHBondContact O-N 3.28Å; R8-I11 PolarHBondContact O-N 3.12Å; R8-N12 WeakPolarHBondContact O-CB 3.47Å; R8-N12 PolarHBondContact O-N 2.94Å
9	E	97.6	Very high	96.8	Very high	110 Å²	110	109.6 Å²	109.6	51%	0.514	53%	0.534	S	S	.	.	H	α-helix	trans	-65	-42.2	177.7	-177.2	57.7	-163.3	0	0	111.6	W5 N6 I11 N12 V13	W5-E9 WeakPolarHBondContact O-CB 3.21Å; W5-E9 PolarHBondContact O-N 2.92Å; N6-E9 PolarHBondContact O-N 2.92Å; E9-I11 PolarHBondContact O-N 3.02Å; E9-N12 PolarHBondContact O-N 3.46Å; E9-V13 HydrophobicContact CG-CG2 4.42Å; E9-V13 WeakPolarHBondContact O-CG2 3.26Å; E9-V13 PolarHBondContact O-N 2.9Å; E9-V13 WeakPolarHBondContact OE1-CG2 3.4Å
10	F	97.7	Very high	96.9	Very high	145 Å²	145	110.5 Å²	110.5	64%	0.636	54%	0.535	S	S	*	.	H	α-helix	trans	-58.1	-48.1	174.6	177	-96.7	0	0	0	112.1	N6 N7 N12 V13 F14	N6-F10 WeakPolarHBondContact O-CB 3.42Å; N6-F10 PolarHBondContact O-N 3.24Å; N7-F10 PolarHBondContact O-N 3.11Å; F10-N12 VanDerWaalsContact C-N 3.32Å; F10-N12 PolarHBondContact O-N 3.13Å; F10-V13 PolarHBondContact O-N 3.01Å; F10-F14 WeakPolarHBondContact O-CB 3.36Å; F10-F14 PolarHBondContact O-N 3.23Å
11	I	97.9	Very high	97	Very high	111 Å²	111	110.2 Å²	110.2	57%	0.569	54%	0.535	S	S	*	.	H	α-helix	trans	-61.6	-42.1	177.6	-68	168	0	0	0	110.7	N7 R8 E9 F14 S15	N7-I11 WeakPolarHBondContact O-CG1 3.33Å; N7-I11 PolarHBondContact O-N 3.22Å; R8-I11 PolarHBondContact O-N 3.12Å; E9-I11 PolarHBondContact O-N 3.02Å; I11-F14 PolarHBondContact O-N 3.48Å; I11-S15 WeakPolarHBondContact O-CB 3.34Å; I11-S15 PolarHBondContact O-N 2.84Å
12	N	98.2	Very high	97.7	Very high	84 Å²	84	103.4 Å²	103.4	45%	0.449	51%	0.509	S	S	.	.	H	α-helix	trans	-62.8	-49.8	178.4	-178.8	50.6	0	0	0	111.7	R8 E9 F10 F14 S15 V16	R8-N12 WeakPolarHBondContact O-CB 3.47Å; R8-N12 PolarHBondContact O-N 2.94Å; E9-N12 PolarHBondContact O-N 3.46Å; F10-N12 VanDerWaalsContact C-N 3.32Å; F10-N12 PolarHBondContact O-N 3.13Å; N12-F14 VanDerWaalsContact C-N 3.31Å; N12-F14 PolarHBondContact O-N 3.04Å; N12-S15 PolarHBondContact O-N 3.01Å; N12-V16 WeakPolarHBondContact O-CB 3.44Å; N12-V16 VanDerWaalsContact O-CG2 3.31Å; N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.43Å
13	V	98.3	Very high	98	Very high	64 Å²	64	101.4 Å²	101.4	39%	0.388	50%	0.503	S	S	.	.	H	α-helix	trans	-58.9	-43.8	176.8	171.2	0	0	0	0	111	E9 F10 V16 N17	E9-V13 HydrophobicContact CG-CG2 4.42Å; E9-V13 WeakPolarHBondContact O-CG2 3.26Å; E9-V13 PolarHBondContact O-N 2.9Å; E9-V13 WeakPolarHBondContact OE1-CG2 3.4Å; F10-V13 PolarHBondContact O-N 3.01Å; V13-V16 PolarHBondContact O-N 3.31Å; V13-N17 WeakPolarHBondContact O-CB 3.41Å; V13-N17 VanDerWaalsContact O-CG 3.25Å; V13-N17 PolarHBondContact O-N 2.9Å; V13-N17 PolarHBondContact O-ND2 2.88Å
14	F	98	Very high	98.1	Very high	127 Å²	127	100.7 Å²	100.7	56%	0.557	50%	0.497	S	S	*	.	H	α-helix	trans	-61.7	-48.1	176.5	-175.2	-95.9	0	0	0	111.7	F10 I11 N12 V16 N17 V18	F10-F14 WeakPolarHBondContact O-CB 3.36Å; F10-F14 PolarHBondContact O-N 3.23Å; I11-F14 PolarHBondContact O-N 3.48Å; N12-F14 VanDerWaalsContact C-N 3.31Å; N12-F14 PolarHBondContact O-N 3.04Å; F14-V16 PolarHBondContact O-N 3.29Å; F14-N17 PolarHBondContact O-N 3.22Å; F14-N17 VanDerWaalsContact O-N 3.16Å; F14-V18 HydrophobicContact CD1-CG2 4.05Å; F14-V18 HydrophobicContact CE1-CG2 3.65Å; F14-V18 HydrophobicContact CZ-CG2 3.93Å; F14-V18 WeakPolarHBondContact O-CG2 3.5Å; F14-V18 PolarHBondContact O-N 2.98Å
15	S	98.5	Very high	98.2	Very high	73 Å²	73	101.6 Å²	101.6	51%	0.51	50%	0.502	S	S	.	.	H	α-helix	trans	-59.3	-44.3	178.1	-175	0	0	0	0	112.2	I11 N12 N17 V18 K19	I11-S15 WeakPolarHBondContact O-CB 3.34Å; I11-S15 PolarHBondContact O-N 2.84Å; N12-S15 PolarHBondContact O-N 3.01Å; S15-N17 VanDerWaalsContact C-N 3.33Å; S15-N17 PolarHBondContact O-N 3.34Å; S15-V18 PolarHBondContact O-N 2.94Å; S15-K19 PolarHBondContact O-N 3.3Å
16	V	98.6	Very high	98.3	Very high	58 Å²	58	98 Å²	98	35%	0.352	50%	0.497	S	S	.	.	H	α-helix	trans	-61.1	-41.7	175.8	169.4	0	0	0	0	111.2	N12 V13 F14 K19 K20	N12-V16 WeakPolarHBondContact O-CB 3.44Å; N12-V16 VanDerWaalsContact O-CG2 3.31Å; N12-V16 WeakPolarHBondContact O-CG2 3.34Å; N12-V16 PolarHBondContact O-N 3.43Å; V13-V16 PolarHBondContact O-N 3.31Å; F14-V16 PolarHBondContact O-N 3.29Å; V16-K19 PolarHBondContact O-N 3.46Å; V16-K20 HydrophobicContact CG1-CD 4.22Å; V16-K20 WeakPolarHBondContact O-CG 3.43Å; V16-K20 PolarHBondContact O-N 3.47Å
17	N	98.5	Very high	98.4	Very high	76 Å²	76	97.3 Å²	97.3	41%	0.406	50%	0.499	S	S	.	.	H	α-helix	trans	-68.5	-40.7	178.6	-71.8	-20.9	0	0	0	112.3	V13 F14 S15 K19 K20 I21	V13-N17 WeakPolarHBondContact O-CB 3.41Å; V13-N17 VanDerWaalsContact O-CG 3.25Å; V13-N17 PolarHBondContact O-N 2.9Å; V13-N17 PolarHBondContact O-ND2 2.88Å; F14-N17 PolarHBondContact O-N 3.22Å; F14-N17 VanDerWaalsContact O-N 3.16Å; S15-N17 VanDerWaalsContact C-N 3.33Å; S15-N17 PolarHBondContact O-N 3.34Å; N17-K19 VanDerWaalsContact C-N 3.32Å; N17-K19 PolarHBondContact O-N 3.45Å; N17-K20 PolarHBondContact O-N 2.9Å; N17-I21 WeakPolarHBondContact O-CG1 3.4Å; N17-I21 PolarHBondContact O-N 2.89Å
18	V	98.7	Very high	98.4	Very high	75 Å²	75	98.5 Å²	98.5	46%	0.455	50%	0.501	S	S	.	.	H	α-helix	trans	-59.4	-44.8	172.8	171.6	0	0	0	0	110.5	F14 S15 K20 I21 A22	F14-V18 HydrophobicContact CD1-CG2 4.05Å; F14-V18 HydrophobicContact CE1-CG2 3.65Å; F14-V18 HydrophobicContact CZ-CG2 3.93Å; F14-V18 WeakPolarHBondContact O-CG2 3.5Å; F14-V18 PolarHBondContact O-N 2.98Å; S15-V18 PolarHBondContact O-N 2.94Å; V18-K20 PolarHBondContact O-N 3.2Å; V18-I21 PolarHBondContact O-N 3.01Å; V18-A22 PolarHBondContact O-N 3.1Å
19	K	98.6	Very high	98.5	Very high	136 Å²	136	95.1 Å²	95.1	59%	0.591	49%	0.492	S	S	*	.	H	α-helix	trans	-60.5	-45.9	176.5	-175	176	179.5	178	0	112.1	S15 V16 N17 I21 A22 D23	S15-K19 PolarHBondContact O-N 3.3Å; V16-K19 PolarHBondContact O-N 3.46Å; N17-K19 VanDerWaalsContact C-N 3.32Å; N17-K19 PolarHBondContact O-N 3.45Å; K19-I21 VanDerWaalsContact C-N 3.3Å; K19-I21 PolarHBondContact O-N 3.49Å; K19-A22 WeakPolarHBondContact O-CB 3.35Å; K19-A22 PolarHBondContact O-N 2.96Å; K19-A22 VanDerWaalsContact O-N 3.11Å; K19-D23 VanDerWaalsContact O-CG 3.31Å; K19-D23 PolarHBondContact O-N 3.27Å
20	K	98.7	Very high	98.5	Very high	126 Å²	126	94.5 Å²	94.5	55%	0.548	49%	0.491	S	S	.	.	H	α-helix	trans	-58.9	-40.1	176.7	-74.9	172.9	179.2	175.2	0	112.5	V16 N17 V18 F24	V16-K20 HydrophobicContact CG1-CD 4.22Å; V16-K20 WeakPolarHBondContact O-CG 3.43Å; V16-K20 PolarHBondContact O-N 3.47Å; N17-K20 PolarHBondContact O-N 2.9Å; V18-K20 PolarHBondContact O-N 3.2Å; K20-F24 WeakPolarHBondContact O-CB 3.46Å; K20-F24 PolarHBondContact O-N 3.03Å
21	I	98.8	Very high	98.6	Very high	105 Å²	105	89.7 Å²	89.7	54%	0.538	48%	0.476	S	S	.	.	H	α-helix	trans	-64.6	-44	175.3	-66.9	166.9	0	0	0	110.1	N17 V18 K19 F24 L25	N17-I21 WeakPolarHBondContact O-CG1 3.4Å; N17-I21 PolarHBondContact O-N 2.89Å; V18-I21 PolarHBondContact O-N 3.01Å; K19-I21 VanDerWaalsContact C-N 3.3Å; K19-I21 PolarHBondContact O-N 3.49Å; I21-F24 PolarHBondContact O-N 2.89Å; I21-L25 HydrophobicContact CG2-CD1 4.05Å; I21-L25 HydrophobicContact CG2-CG 4.41Å; I21-L25 VanDerWaalsContact O-CG 3.31Å; I21-L25 WeakPolarHBondContact O-CG 3.41Å; I21-L25 PolarHBondContact O-N 3.42Å
22	A	98.8	Very high	98.6	Very high	48 Å²	48	86 Å²	86	40%	0.397	46%	0.46	S	S	.	.	H	α-helix	trans	-60.3	-48.8	176.4	0	0	0	0	0	111.8	V18 K19 F24 L25 T26	V18-A22 PolarHBondContact O-N 3.1Å; K19-A22 WeakPolarHBondContact O-CB 3.35Å; K19-A22 PolarHBondContact O-N 2.96Å; K19-A22 VanDerWaalsContact O-N 3.11Å; A22-F24 VanDerWaalsContact C-N 3.3Å; A22-F24 PolarHBondContact O-N 3.09Å; A22-L25 PolarHBondContact O-N 3.28Å; A22-L25 VanDerWaalsContact O-N 3.12Å; A22-T26 PolarHBondContact O-N 2.97Å; A22-T26 PolarHBondContact O-OG1 3.41Å
23	D	98.8	Very high	98.6	Very high	85 Å²	85	89.7 Å²	89.7	46%	0.455	47%	0.467	S	S	.	.	H	α-helix	trans	-61	-38.9	178.9	-67.1	-20.3	0	0	0	111.6	K19 S27	K19-D23 VanDerWaalsContact O-CG 3.31Å; K19-D23 PolarHBondContact O-N 3.27Å; D23-S27 WeakPolarHBondContact O-CB 3.46Å; D23-S27 PolarHBondContact O-N 3.49Å; D23-S27 PolarHBondContact O-OG 3.38Å
24	F	98.8	Very high	98.6	Very high	129 Å²	129	92.3 Å²	92.3	57%	0.566	48%	0.475	S	S	*	.	H	α-helix	trans	-62.5	-48.6	172.6	169.3	-99.3	0	0	0	111.5	K20 I21 A22 T26 S27 F28	K20-F24 WeakPolarHBondContact O-CB 3.46Å; K20-F24 PolarHBondContact O-N 3.03Å; I21-F24 PolarHBondContact O-N 2.89Å; A22-F24 VanDerWaalsContact C-N 3.3Å; A22-F24 PolarHBondContact O-N 3.09Å; F24-T26 VanDerWaalsContact C-N 3.33Å; F24-T26 PolarHBondContact O-N 3.5Å; F24-S27 PolarHBondContact O-N 3.39Å; F24-F28 HydrophobicContact CE1-CB 4.47Å; F24-F28 HydrophobicContact CZ-CB 4.42Å; F24-F28 HydrophobicContact CZ-CD2 4.34Å; F24-F28 WeakPolarHBondContact O-CB 3.46Å; F24-F28 PolarHBondContact O-N 3.37Å
25	L	98.9	Very high	98.7	Very high	96 Å²	96	92.2 Å²	92.2	50%	0.503	47%	0.474	S	S	.	.	H	α-helix	trans	-62.7	-39.3	-179.4	-71.7	174.1	0	0	0	111.9	I21 A22 F28 E29	I21-L25 HydrophobicContact CG2-CD1 4.05Å; I21-L25 HydrophobicContact CG2-CG 4.41Å; I21-L25 VanDerWaalsContact O-CG 3.31Å; I21-L25 WeakPolarHBondContact O-CG 3.41Å; I21-L25 PolarHBondContact O-N 3.42Å; A22-L25 PolarHBondContact O-N 3.28Å; A22-L25 VanDerWaalsContact O-N 3.12Å; L25-F28 PolarHBondContact O-N 2.9Å; L25-E29 WeakPolarHBondContact O-CB 3.37Å; L25-E29 PolarHBondContact O-N 2.87Å
26	T	98.6	Very high	98.7	Very high	80 Å²	80	95.4 Å²	95.4	49%	0.491	48%	0.479	S	S	.	.	H	α-helix	trans	-63.6	-47.6	173.9	-59.9	0	0	0	0	111.5	A22 F24 F28 E29 L30	A22-T26 PolarHBondContact O-N 2.97Å; A22-T26 PolarHBondContact O-OG1 3.41Å; F24-T26 VanDerWaalsContact C-N 3.33Å; F24-T26 PolarHBondContact O-N 3.5Å; T26-F28 VanDerWaalsContact C-N 3.29Å; T26-F28 PolarHBondContact O-N 3.5Å; T26-E29 PolarHBondContact O-N 2.98Å; T26-L30 HydrophobicContact CG2-CD1 4.49Å; T26-L30 WeakPolarHBondContact O-CG 3.48Å; T26-L30 PolarHBondContact O-N 3.45Å; T26-L30 VanDerWaalsContact O-N 3.09Å
27	S	98.6	Very high	98.7	Very high	76 Å²	76	94.9 Å²	94.9	53%	0.531	48%	0.481	S	S	.	.	H	α-helix	trans	-64.6	-36.7	178.5	-57.2	0	0	0	0	112.1	D23 F24 S31	D23-S27 WeakPolarHBondContact O-CB 3.46Å; D23-S27 PolarHBondContact O-N 3.49Å; D23-S27 PolarHBondContact O-OG 3.38Å; F24-S27 PolarHBondContact O-N 3.39Å; S27-S31 WeakPolarHBondContact O-CB 3.48Å; S27-S31 PolarHBondContact O-N 2.99Å
28	F	98.7	Very high	98.7	Very high	109 Å²	109	94.7 Å²	94.7	48%	0.478	48%	0.479	S	S	.	.	H	α-helix	trans	-66.2	-45.2	176.5	-178.9	-103.1	0	0	0	111.6	F24 L25 T26 L30 S31 C32	F24-F28 HydrophobicContact CE1-CB 4.47Å; F24-F28 HydrophobicContact CZ-CB 4.42Å; F24-F28 HydrophobicContact CZ-CD2 4.34Å; F24-F28 WeakPolarHBondContact O-CB 3.46Å; F24-F28 PolarHBondContact O-N 3.37Å; L25-F28 PolarHBondContact O-N 2.9Å; T26-F28 VanDerWaalsContact C-N 3.29Å; T26-F28 PolarHBondContact O-N 3.5Å; F28-L30 PolarHBondContact O-N 3.28Å; F28-S31 PolarHBondContact O-N 3.46Å; F28-C32 VanDerWaalsContact CZ-SG 3.57Å; F28-C32 WeakPolarHBondContact O-CB 3.44Å; F28-C32 PolarHBondContact O-N 3.26Å; F28-C32 PolarHBondContact O-SG 3.26Å; F28-C32 VanDerWaalsContact O-SG 3.37Å
29	E	98.6	Very high	98.7	Very high	85 Å²	85	96.9 Å²	96.9	40%	0.397	49%	0.486	S	S	.	.	H	α-helix	trans	-57.4	-49.1	175.3	179.2	-96.1	163.9	0	0	111.4	L25 T26 S31 C32 R33	L25-E29 WeakPolarHBondContact O-CB 3.37Å; L25-E29 PolarHBondContact O-N 2.87Å; T26-E29 PolarHBondContact O-N 2.98Å; E29-S31 PolarHBondContact O-N 2.87Å; E29-C32 PolarHBondContact O-N 2.97Å; E29-R33 WeakPolarHBondContact O-CG 3.45Å; E29-R33 PolarHBondContact O-N 3.01Å; E29-R33 WeakPolarHBondContact OE1-CD 3.47Å; E29-R33 IonicContact OE1-NH1 3.49Å; E29-R33 PolarHBondContact OE1-NH1 3.44Å
30	L	98.6	Very high	98.7	Very high	96 Å²	96	94.6 Å²	94.6	50%	0.503	48%	0.48	S	S	.	.	H	α-helix	trans	-60	-45	176.1	-69.2	174.8	0	0	0	112.5	T26 F28 C32 R33 H34	T26-L30 HydrophobicContact CG2-CD1 4.49Å; T26-L30 WeakPolarHBondContact O-CG 3.48Å; T26-L30 PolarHBondContact O-N 3.45Å; T26-L30 VanDerWaalsContact O-N 3.09Å; F28-L30 PolarHBondContact O-N 3.28Å; L30-C32 PolarHBondContact O-N 2.86Å; L30-R33 PolarHBondContact O-N 3.4Å; L30-H34 PolarHBondContact O-N 3.25Å
31	S	98.7	Very high	98.7	Very high	45 Å²	45	94.4 Å²	94.4	32%	0.315	48%	0.482	S	S	.	.	H	α-helix	trans	-60.3	-45.6	176.3	157.7	0	0	0	0	111.6	S27 F28 E29 H34 K35	S27-S31 WeakPolarHBondContact O-CB 3.48Å; S27-S31 PolarHBondContact O-N 2.99Å; F28-S31 PolarHBondContact O-N 3.46Å; E29-S31 PolarHBondContact O-N 2.87Å; S31-H34 PolarHBondContact O-N 3.34Å; S31-K35 WeakPolarHBondContact O-CG 3.37Å; S31-K35 PolarHBondContact O-N 3.2Å
32	C	98.7	Very high	98.7	Very high	33 Å²	33	96.4 Å²	96.4	22%	0.223	49%	0.487	C	S	.	.	H	α-helix	trans	-62.7	-45.5	177.8	-74.8	0	0	0	0	111.4	F28 E29 L30 H34 K35 F36	F28-C32 VanDerWaalsContact CZ-SG 3.57Å; F28-C32 WeakPolarHBondContact O-CB 3.44Å; F28-C32 PolarHBondContact O-N 3.26Å; F28-C32 PolarHBondContact O-SG 3.26Å; F28-C32 VanDerWaalsContact O-SG 3.37Å; E29-C32 PolarHBondContact O-N 2.97Å; L30-C32 PolarHBondContact O-N 2.86Å; C32-H34 VanDerWaalsContact C-N 3.34Å; C32-H34 PolarHBondContact O-N 3.37Å; C32-K35 PolarHBondContact O-N 3.12Å; C32-F36 HydrophobicContact CB-CD2 4.49Å; C32-F36 HydrophobicContact CB-CE2 4.27Å; C32-F36 WeakPolarHBondContact O-CB 3.45Å; C32-F36 WeakPolarHBondContact O-CD2 2.94Å; C32-F36 WeakPolarHBondContact O-CG 3.39Å; C32-F36 PolarHBondContact O-N 2.92Å
33	R	98.8	Very high	98.7	Very high	162 Å²	162	98.4 Å²	98.4	61%	0.611	49%	0.49	S	S	*	.	H	α-helix	trans	-58.2	-44.4	175.8	-78.2	-175.9	61	177.5	-1	112.6	E29 L30 F36 A37	E29-R33 WeakPolarHBondContact O-CG 3.45Å; E29-R33 PolarHBondContact O-N 3.01Å; E29-R33 WeakPolarHBondContact OE1-CD 3.47Å; E29-R33 IonicContact OE1-NH1 3.49Å; E29-R33 PolarHBondContact OE1-NH1 3.44Å; L30-R33 PolarHBondContact O-N 3.4Å; R33-F36 PolarHBondContact O-N 2.79Å; R33-A37 WeakPolarHBondContact O-CB 3.43Å; R33-A37 PolarHBondContact O-N 2.94Å
34	H	98.7	Very high	98.7	Very high	118 Å²	118	97.3 Å²	97.3	55%	0.546	48%	0.484	S	S	.	.	H	α-helix	trans	-63.4	-46.1	177	178.9	64.1	0	0	0	111.8	L30 S31 C32 F36 A37 L38	L30-H34 PolarHBondContact O-N 3.25Å; S31-H34 PolarHBondContact O-N 3.34Å; C32-H34 VanDerWaalsContact C-N 3.34Å; C32-H34 PolarHBondContact O-N 3.37Å; H34-F36 PolarHBondContact O-N 2.9Å; H34-A37 PolarHBondContact O-N 3.3Å; H34-L38 WeakPolarHBondContact NE2-CD1 3.47Å; H34-L38 WeakPolarHBondContact O-CG 3.2Å; H34-L38 PolarHBondContact O-N 3.49Å
35	K	98.8	Very high	98.7	Very high	126 Å²	126	93.5 Å²	93.5	55%	0.548	48%	0.476	S	S	.	.	H	α-helix	trans	-62.3	-41.9	177.8	-71.7	175.9	-175	179.9	0	112.2	S31 C32 L38 M39	S31-K35 WeakPolarHBondContact O-CG 3.37Å; S31-K35 PolarHBondContact O-N 3.2Å; C32-K35 PolarHBondContact O-N 3.12Å; K35-L38 PolarHBondContact O-N 3.11Å; K35-M39 WeakPolarHBondContact O-CG 3.4Å; K35-M39 PolarHBondContact O-N 2.97Å
36	F	98.8	Very high	98.7	Very high	140 Å²	140	93.8 Å²	93.8	61%	0.614	48%	0.478	S	S	*	.	H	α-helix	trans	-65.2	-39.8	175.6	-71.9	-43.6	0	0	0	112.4	C32 R33 H34 L38 M39 N40	C32-F36 HydrophobicContact CB-CD2 4.49Å; C32-F36 HydrophobicContact CB-CE2 4.27Å; C32-F36 WeakPolarHBondContact O-CB 3.45Å; C32-F36 WeakPolarHBondContact O-CD2 2.94Å; C32-F36 WeakPolarHBondContact O-CG 3.39Å; C32-F36 PolarHBondContact O-N 2.92Å; R33-F36 PolarHBondContact O-N 2.79Å; H34-F36 PolarHBondContact O-N 2.9Å; F36-L38 PolarHBondContact O-N 3.36Å; F36-M39 HydrophobicContact CD1-SD 4.39Å; F36-M39 PolarHBondContact O-N 3.36Å; F36-N40 WeakPolarHBondContact O-CB 3.48Å; F36-N40 PolarHBondContact O-N 3.43Å
37	A	98.8	Very high	98.7	Very high	47 Å²	47	94.4 Å²	94.4	39%	0.388	48%	0.475	S	S	.	.	H	α-helix	trans	-59.3	-47	174.1	0	0	0	0	0	111.6	R33 H34 M39 N40 E41	R33-A37 WeakPolarHBondContact O-CB 3.43Å; R33-A37 PolarHBondContact O-N 2.94Å; H34-A37 PolarHBondContact O-N 3.3Å; A37-M39 VanDerWaalsContact C-N 3.34Å; A37-M39 PolarHBondContact O-N 3.37Å; A37-N40 WeakPolarHBondContact O-CB 3.33Å; A37-N40 PolarHBondContact O-N 3.46Å; A37-E41 WeakPolarHBondContact O-CG 3.37Å; A37-E41 PolarHBondContact O-N 2.93Å
38	L	98.7	Very high	98.7	Very high	71 Å²	71	98 Å²	98	37%	0.372	48%	0.481	S	S	.	.	H	α-helix	trans	-62.2	-39.1	176.3	-69.6	178.7	0	0	0	112.9	H34 K35 F36 K42	H34-L38 WeakPolarHBondContact NE2-CD1 3.47Å; H34-L38 WeakPolarHBondContact O-CG 3.2Å; H34-L38 PolarHBondContact O-N 3.49Å; K35-L38 PolarHBondContact O-N 3.11Å; F36-L38 PolarHBondContact O-N 3.36Å; L38-K42 WeakPolarHBondContact O-CG 3.47Å; L38-K42 PolarHBondContact O-N 2.85Å; L38-K42 VanDerWaalsContact O-N 3.1Å
39	M	98.7	Very high	98.7	Very high	122 Å²	122	99.3 Å²	99.3	60%	0.601	49%	0.487	S	S	*	.	H	α-helix	trans	-64.6	-42.5	175.2	-74.2	175.8	67	0	0	111.3	K35 F36 A37 K42 L43	K35-M39 WeakPolarHBondContact O-CG 3.4Å; K35-M39 PolarHBondContact O-N 2.97Å; F36-M39 HydrophobicContact CD1-SD 4.39Å; F36-M39 PolarHBondContact O-N 3.36Å; A37-M39 VanDerWaalsContact C-N 3.34Å; A37-M39 PolarHBondContact O-N 3.37Å; M39-K42 PolarHBondContact O-N 3.37Å; M39-L43 WeakPolarHBondContact O-CB 3.39Å; M39-L43 PolarHBondContact O-N 3.46Å
40	N	98.7	Very high	98.7	Very high	87 Å²	87	99.6 Å²	99.6	47%	0.465	49%	0.49	S	S	.	.	H	α-helix	trans	-64.5	-41.9	177.9	-165.5	65.3	0	0	0	111.8	F36 A37 K42 L43 N44	F36-N40 WeakPolarHBondContact O-CB 3.48Å; F36-N40 PolarHBondContact O-N 3.43Å; A37-N40 WeakPolarHBondContact O-CB 3.33Å; A37-N40 PolarHBondContact O-N 3.46Å; N40-K42 VanDerWaalsContact C-N 3.34Å; N40-K42 PolarHBondContact O-N 2.89Å; N40-L43 PolarHBondContact O-N 2.94Å; N40-N44 PolarHBondContact ND2-ND2 3.39Å; N40-N44 WeakPolarHBondContact O-CB 3.37Å; N40-N44 PolarHBondContact O-N 2.99Å; N40-N44 PolarHBondContact O-ND2 2.87Å; N40-N44 PolarHBondContact O-OD1 3.27Å
41	E	98.8	Very high	98.7	Very high	122 Å²	122	99.7 Å²	99.7	57%	0.57	49%	0.491	S	S	*	.	H	α-helix	trans	-59.7	-43.8	173.9	-74.5	173.7	-176.5	0	0	112.1	A37 A45	A37-E41 WeakPolarHBondContact O-CG 3.37Å; A37-E41 PolarHBondContact O-N 2.93Å; E41-A45 WeakPolarHBondContact O-CB 3.2Å; E41-A45 PolarHBondContact O-N 3.02Å
42	K	98.7	Very high	98.6	Very high	148 Å²	148	104.3 Å²	104.3	64%	0.643	51%	0.506	S	S	*	.	H	α-helix	trans	-64.9	-42.1	176.1	-73.8	177.7	-179.6	-177.6	0	112.1	L38 M39 N40 A45 L46	L38-K42 WeakPolarHBondContact O-CG 3.47Å; L38-K42 PolarHBondContact O-N 2.85Å; L38-K42 VanDerWaalsContact O-N 3.1Å; M39-K42 PolarHBondContact O-N 3.37Å; N40-K42 VanDerWaalsContact C-N 3.34Å; N40-K42 PolarHBondContact O-N 2.89Å; K42-A45 PolarHBondContact O-N 3.42Å; K42-L46 WeakPolarHBondContact O-CG 3.42Å; K42-L46 PolarHBondContact O-N 2.92Å
43	L	98.8	Very high	98.6	Very high	90 Å²	90	107.9 Å²	107.9	47%	0.471	52%	0.522	S	S	.	.	H	α-helix	trans	-61.1	-51.9	177.2	-176.5	63.4	0	0	0	110.5	M39 N40 A45 L46 E47	M39-L43 WeakPolarHBondContact O-CB 3.39Å; M39-L43 PolarHBondContact O-N 3.46Å; N40-L43 PolarHBondContact O-N 2.94Å; L43-A45 PolarHBondContact O-N 3.34Å; L43-L46 WeakPolarHBondContact O-CA 3.45Å; L43-L46 WeakPolarHBondContact O-CB 3.42Å; L43-L46 PolarHBondContact O-N 3.43Å; L43-E47 WeakPolarHBondContact O-CG 3.39Å; L43-E47 PolarHBondContact O-N 3.23Å
44	N	98.7	Very high	98.5	Very high	62 Å²	62	105.8 Å²	105.8	33%	0.332	52%	0.519	S	S	.	.	H	α-helix	trans	-57	-37.4	177	-67.4	-16.6	0	0	0	112.4	N40 K48	N40-N44 PolarHBondContact ND2-ND2 3.39Å; N40-N44 WeakPolarHBondContact O-CB 3.37Å; N40-N44 PolarHBondContact O-N 2.99Å; N40-N44 PolarHBondContact O-ND2 2.87Å; N40-N44 PolarHBondContact O-OD1 3.27Å; N44-K48 WeakPolarHBondContact O-CG 3.34Å; N44-K48 PolarHBondContact O-N 2.77Å; N44-K48 VanDerWaalsContact O-N 3.13Å
45	A	98.8	Very high	98.4	Very high	48 Å²	48	103 Å²	103	40%	0.397	52%	0.516	S	S	.	.	H	α-helix	trans	-69.5	-35.2	176.9	0	0	0	0	0	112.4	E41 K42 L43 K49	E41-A45 WeakPolarHBondContact O-CB 3.2Å; E41-A45 PolarHBondContact O-N 3.02Å; K42-A45 PolarHBondContact O-N 3.42Å; L43-A45 PolarHBondContact O-N 3.34Å; A45-K49 WeakPolarHBondContact O-CG 3.41Å; A45-K49 PolarHBondContact O-N 2.93Å
46	L	98.8	Very high	98.2	Very high	102 Å²	102	99 Å²	99	53%	0.534	50%	0.504	S	S	.	.	H	α-helix	trans	-71.1	-43.2	174.9	-72	172.5	0	0	0	111.5	K42 L43 K48 K49 I50	K42-L46 WeakPolarHBondContact O-CG 3.42Å; K42-L46 PolarHBondContact O-N 2.92Å; L43-L46 WeakPolarHBondContact O-CA 3.45Å; L43-L46 WeakPolarHBondContact O-CB 3.42Å; L43-L46 PolarHBondContact O-N 3.43Å; L46-K48 PolarHBondContact O-N 2.91Å; L46-K49 WeakPolarHBondContact O-CB 3.32Å; L46-K49 PolarHBondContact O-N 3.45Å; L46-K49 VanDerWaalsContact O-N 3.11Å; L46-I50 WeakPolarHBondContact O-CG1 3.31Å; L46-I50 PolarHBondContact O-N 3.44Å
47	E	98.8	Very high	98	Very high	94 Å²	94	96.7 Å²	96.7	44%	0.439	50%	0.502	S	S	.	.	H	α-helix	trans	-55.5	-50.9	175	-71.1	173.3	158.5	0	0	110.9	L43 K49 I50 D51	L43-E47 WeakPolarHBondContact O-CG 3.39Å; L43-E47 PolarHBondContact O-N 3.23Å; E47-K49 VanDerWaalsContact C-N 3.26Å; E47-K49 PolarHBondContact O-N 3.23Å; E47-I50 WeakPolarHBondContact O-CB 3.31Å; E47-I50 PolarHBondContact O-N 3.16Å; E47-D51 PolarHBondContact O-N 3Å
48	K	98.6	Very high	97.8	Very high	151 Å²	151	97.4 Å²	97.4	66%	0.657	50%	0.503	S	S	*	.	H	α-helix	trans	-59.9	-33.7	176.5	-72.4	176.7	-177.2	179.8	0	113.9	N44 L46 F52	N44-K48 WeakPolarHBondContact O-CG 3.34Å; N44-K48 PolarHBondContact O-N 2.77Å; N44-K48 VanDerWaalsContact O-N 3.13Å; L46-K48 PolarHBondContact O-N 2.91Å; K48-F52 WeakPolarHBondContact O-CB 3.5Å; K48-F52 PolarHBondContact O-N 3.4Å; K48-F52 VanDerWaalsContact O-N 3.12Å
49	K	98.4	Very high	97.5	Very high	137 Å²	137	97.1 Å²	97.1	60%	0.596	51%	0.507	S	S	*	.	H	α-helix	trans	-70.1	-39.5	175.7	-78.5	179.4	-179.4	-174.4	0	111.2	A45 L46 E47 F52 L53	A45-K49 WeakPolarHBondContact O-CG 3.41Å; A45-K49 PolarHBondContact O-N 2.93Å; L46-K49 WeakPolarHBondContact O-CB 3.32Å; L46-K49 PolarHBondContact O-N 3.45Å; L46-K49 VanDerWaalsContact O-N 3.11Å; E47-K49 VanDerWaalsContact C-N 3.26Å; E47-K49 PolarHBondContact O-N 3.23Å; K49-F52 PolarHBondContact O-N 3.4Å; K49-L53 WeakPolarHBondContact O-CB 3.36Å; K49-L53 VanDerWaalsContact O-CG 3.26Å; K49-L53 WeakPolarHBondContact O-CG 3.47Å; K49-L53 PolarHBondContact O-N 3.03Å
50	I	98.4	Very high	97	Very high	91 Å²	91	94.9 Å²	94.9	47%	0.467	50%	0.501	S	S	.	.	H	α-helix	trans	-62.2	-50.9	174.6	-69.3	170.1	0	0	0	109.2	L46 E47 F52 L53 E54	L46-I50 WeakPolarHBondContact O-CG1 3.31Å; L46-I50 PolarHBondContact O-N 3.44Å; E47-I50 WeakPolarHBondContact O-CB 3.31Å; E47-I50 PolarHBondContact O-N 3.16Å; I50-F52 VanDerWaalsContact C-N 3.27Å; I50-F52 PolarHBondContact O-N 2.98Å; I50-L53 PolarHBondContact O-N 2.95Å; I50-E54 HydrophobicContact CG2-CG 4.16Å; I50-E54 WeakPolarHBondContact O-CG 3.26Å; I50-E54 PolarHBondContact O-N 3.45Å
51	D	97.9	Very high	96.1	Very high	97 Å²	97	95.1 Å²	95.1	52%	0.519	51%	0.505	S	S	.	.	H	α-helix	trans	-53.8	-44.3	178.2	-65.5	-18.8	0	0	0	112	E47 A55	E47-D51 PolarHBondContact O-N 3Å; D51-A55 WeakPolarHBondContact O-CB 3.47Å; D51-A55 PolarHBondContact O-N 3.45Å
52	F	97.8	Very high	94.9	Very high	142 Å²	142	99 Å²	99	62%	0.623	52%	0.516	S	S	*	.	H	α-helix	trans	-64.2	-42.4	177.2	175.1	-96.1	0	0	0	112.8	K48 K49 I50 S56	K48-F52 WeakPolarHBondContact O-CB 3.5Å; K48-F52 PolarHBondContact O-N 3.4Å; K48-F52 VanDerWaalsContact O-N 3.12Å; K49-F52 PolarHBondContact O-N 3.4Å; I50-F52 VanDerWaalsContact C-N 3.27Å; I50-F52 PolarHBondContact O-N 2.98Å; F52-S56 WeakPolarHBondContact O-CB 3.33Å; F52-S56 PolarHBondContact O-N 3.36Å; F52-S56 PolarHBondContact O-OG 2.97Å
53	L	97.4	Very high	93.4	Very high	108 Å²	108	98.8 Å²	98.8	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-66.7	-43.8	178.4	-73.1	172.1	0	0	0	111.1	K49 I50 S56 V57	K49-L53 WeakPolarHBondContact O-CB 3.36Å; K49-L53 VanDerWaalsContact O-CG 3.26Å; K49-L53 WeakPolarHBondContact O-CG 3.47Å; K49-L53 PolarHBondContact O-N 3.03Å; I50-L53 PolarHBondContact O-N 2.95Å; L53-S56 PolarHBondContact O-N 3.25Å; L53-V57 WeakPolarHBondContact O-CG2 3.36Å; L53-V57 PolarHBondContact O-N 3.19Å
54	E	96.8	Very high	91.5	Very high	119 Å²	119	107.3 Å²	107.3	56%	0.556	55%	0.547	S	S	*	.	H	α-helix	trans	-59	-48.5	175.4	-71	-177.4	161.6	0	0	110.9	I50 S56 V57 S58	I50-E54 HydrophobicContact CG2-CG 4.16Å; I50-E54 WeakPolarHBondContact O-CG 3.26Å; I50-E54 PolarHBondContact O-N 3.45Å; E54-S56 VanDerWaalsContact C-N 3.33Å; E54-S56 PolarHBondContact O-N 3.32Å; E54-V57 PolarHBondContact O-N 2.95Å; E54-S58 PolarHBondContact O-N 3.43Å; E54-S58 PolarHBondContact O-OG 2.88Å
55	A	96.3	Very high	91.2	Very high	59 Å²	59	109.6 Å²	109.6	49%	0.488	56%	0.558	S	S	.	*	H	α-helix	trans	-60.8	-40.2	176.2	0	0	0	0	0	112.9	D51 S58 S59	D51-A55 WeakPolarHBondContact O-CB 3.47Å; D51-A55 PolarHBondContact O-N 3.45Å; A55-S58 PolarHBondContact O-N 3.32Å; A55-S59 WeakPolarHBondContact O-CB 3.33Å; A55-S59 PolarHBondContact O-N 3.33Å
56	S	95.4	Very high	90.8	Very high	42 Å²	42	112.8 Å²	112.8	29%	0.294	57%	0.567	S	S	.	*	H	α-helix	trans	-65.8	-41.2	178.2	-61.4	0	0	0	0	112	F52 L53 E54 T60	F52-S56 WeakPolarHBondContact O-CB 3.33Å; F52-S56 PolarHBondContact O-N 3.36Å; F52-S56 PolarHBondContact O-OG 2.97Å; L53-S56 PolarHBondContact O-N 3.25Å; E54-S56 VanDerWaalsContact C-N 3.33Å; E54-S56 PolarHBondContact O-N 3.32Å; S56-T60 WeakPolarHBondContact O-CB 3.5Å; S56-T60 PolarHBondContact O-N 2.98Å; S56-T60 PolarHBondContact O-OG1 3.04Å
57	V	95	Very high	90.3	Very high	92 Å²	92	113.4 Å²	113.4	56%	0.558	57%	0.568	S	S	*	*	H	α-helix	trans	-66.3	-48.5	175.4	172.1	0	0	0	0	110.2	L53 E54 S59 T60 V61	L53-V57 WeakPolarHBondContact O-CG2 3.36Å; L53-V57 PolarHBondContact O-N 3.19Å; E54-V57 PolarHBondContact O-N 2.95Å; V57-S59 PolarHBondContact O-N 3.44Å; V57-T60 PolarHBondContact O-N 3.38Å; V57-T60 VanDerWaalsContact O-N 3.11Å; V57-V61 HydrophobicContact CG1-CG2 4.31Å; V57-V61 WeakPolarHBondContact O-CG2 3.37Å; V57-V61 PolarHBondContact O-N 3.45Å
58	S	94.1	Very high	89.8	Confident	61 Å²	61	114.6 Å²	114.6	43%	0.427	58%	0.576	S	S	.	*	H	α-helix	trans	-57	-48.2	176.6	-64.7	0	0	0	0	111.6	E54 A55 T60 V61 Y62	E54-S58 PolarHBondContact O-N 3.43Å; E54-S58 PolarHBondContact O-OG 2.88Å; A55-S58 PolarHBondContact O-N 3.32Å; S58-T60 VanDerWaalsContact C-N 3.27Å; S58-T60 PolarHBondContact O-N 2.9Å; S58-V61 PolarHBondContact O-N 3.25Å; S58-Y62 WeakPolarHBondContact O-CD2 3.39Å; S58-Y62 PolarHBondContact O-N 3.48Å
59	S	92	Very high	89.3	Confident	65 Å²	65	112.3 Å²	112.3	46%	0.455	57%	0.571	S	S	.	*	H	α-helix	trans	-60.4	-36.8	177.1	-174.4	0	0	0	0	112.4	A55 V57 L63	A55-S59 WeakPolarHBondContact O-CB 3.33Å; A55-S59 PolarHBondContact O-N 3.33Å; V57-S59 PolarHBondContact O-N 3.44Å; S59-L63 WeakPolarHBondContact O-CB 3.45Å; S59-L63 WeakPolarHBondContact O-CD1 3.49Å; S59-L63 WeakPolarHBondContact O-CG 3.48Å; S59-L63 PolarHBondContact O-N 3.41Å
60	T	88.2	Confident	88.7	Confident	75 Å²	75	110.7 Å²	110.7	46%	0.46	57%	0.569	S	S	.	*	H	α-helix	trans	-70.2	-37	178.2	-58	0	0	0	0	111.8	S56 V57 S58 R64	S56-T60 WeakPolarHBondContact O-CB 3.5Å; S56-T60 PolarHBondContact O-N 2.98Å; S56-T60 PolarHBondContact O-OG1 3.04Å; V57-T60 PolarHBondContact O-N 3.38Å; V57-T60 VanDerWaalsContact O-N 3.11Å; S58-T60 VanDerWaalsContact C-N 3.27Å; S58-T60 PolarHBondContact O-N 2.9Å; T60-R64 PolarHBondContact O-N 3.37Å
61	V	80.9	Confident	88	Confident	93 Å²	93	112.1 Å²	112.1	56%	0.564	58%	0.577	S	S	*	*	H	α-helix	trans	-71.2	-37.6	178.3	173.5	0	0	0	0	111.5	V57 S58 L63	V57-V61 HydrophobicContact CG1-CG2 4.31Å; V57-V61 WeakPolarHBondContact O-CG2 3.37Å; V57-V61 PolarHBondContact O-N 3.45Å; S58-V61 PolarHBondContact O-N 3.25Å; V61-L63 VanDerWaalsContact C-N 3.33Å
62	Y	74	Confident	87.2	Confident	202 Å²	202	113.2 Å²	113.2	79%	0.792	58%	0.581	S	S	*	*	H	α-helix	trans	-75.5	-17.6	176.7	-74.5	-68.7	0	0	0	114.2	S58	S58-Y62 WeakPolarHBondContact O-CD2 3.39Å; S58-Y62 PolarHBondContact O-N 3.48Å
63	L	66.1	Low	86.4	Confident	144 Å²	144	110.8 Å²	110.8	75%	0.754	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	-6.8	177.4	-72.2	172.5	0	0	0	113.9	S59 V61	S59-L63 WeakPolarHBondContact O-CB 3.45Å; S59-L63 WeakPolarHBondContact O-CD1 3.49Å; S59-L63 WeakPolarHBondContact O-CG 3.48Å; S59-L63 PolarHBondContact O-N 3.41Å; V61-L63 VanDerWaalsContact C-N 3.33Å
64	R	60.1	Low	85.3	Confident	270 Å²	270	111.1 Å²	111.1	100%	1.019	58%	0.579	S	S	*	*			trans	-103.8	0	174.2	-79.9	-173.6	174.1	-174.2	-0.3	110.9	T60	T60-R64 PolarHBondContact O-N 3.37Å

Retrieved 64 of 64 residues in 36.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).