A0A077ZF86_TRITR Loading...

NADH dehydrogenase (Ubiquinone) 1 beta

AlphaFold DB , UniProt , Accession A0A077ZF86, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 106 aa.

						>A0A077ZF86_TRITR|A0A077ZF86
MSGNDSGHHVHEPFEVPSYKEYTHDRGNEDYQRYLRRLSRFGLKDPWARNYVHAADKRILTMWQKVKELLFSGFWVGAGYALIGITITELYYNKKRKAITSEAEDD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44	Very low	54.2	Low	255 Å²	255	141.5 Å²	141.5	100%	1.256	81%	0.813	S	S	*	*				0	95.5	0	-69	156.4	126.3	0	0	106.7
2	S	46.9	Very low	55.4	Low	114 Å²	114	144 Å²	144	80%	0.797	81%	0.812	S	S	*	*			trans	-123.5	108.3	177.2	-169.3	0	0	0	0	105.9
3	G	46.3	Very low	57	Low	67 Å²	67	142.2 Å²	142.2	69%	0.691	81%	0.81	S	S	*	*			trans	-77.3	128.5	178.7	0	0	0	0	0	110
4	N	58.6	Low	58.5	Low	147 Å²	147	144.1 Å²	144.1	79%	0.786	81%	0.805	S	S	*	*			trans	-89.2	105.1	168.4	-73.5	0	0	0	0	107.6	S6	N4-S6 PolarHBondContact O-N 3.39Å
5	D	53	Low	60	Low	164 Å²	164	146.9 Å²	146.9	88%	0.877	81%	0.81	S	S	*	*			trans	-73	109.7	170.8	-71.5	-40.9	0	0	0	109.7	G7	D5-G7 PolarHBondContact O-N 3.09Å
6	S	56.4	Low	61.3	Low	114 Å²	114	144.2 Å²	144.2	80%	0.797	80%	0.798	S	S	*	*			trans	-67.9	93.5	173.7	-50.6	0	0	0	0	109.9	N4 H8	N4-S6 PolarHBondContact O-N 3.39Å; S6-H8 PolarHBondContact O-N 3.48Å; S6-H8 VanDerWaalsContact O-N 3.14Å
7	G	49.9	Very low	62.4	Low	60 Å²	60	139.5 Å²	139.5	62%	0.619	78%	0.775	S	S	*	*			trans	-55.9	113.8	175.8	0	0	0	0	0	112.4	D5 H9	D5-G7 PolarHBondContact O-N 3.09Å; G7-H9 PolarHBondContact O-N 2.82Å; G7-H9 VanDerWaalsContact O-N 3.13Å; G7-H9 PolarHBondContact O-ND1 3.46Å
8	H	56.5	Low	63.5	Low	179 Å²	179	134.8 Å²	134.8	83%	0.829	75%	0.754	S	S	*	*			trans	-50.3	113.7	163.7	-88.9	-95	0	0	0	109.3	S6 V10	S6-H8 PolarHBondContact O-N 3.48Å; S6-H8 VanDerWaalsContact O-N 3.14Å; H8-V10 PolarHBondContact O-N 3.46Å
9	H	61	Low	64.4	Low	166 Å²	166	135.9 Å²	135.9	77%	0.769	75%	0.746	S	S	*	*			trans	-67.1	88.4	169.4	3.4	-68.8	0	0	0	107	G7 H11	G7-H9 PolarHBondContact O-N 2.82Å; G7-H9 VanDerWaalsContact O-N 3.13Å; G7-H9 PolarHBondContact O-ND1 3.46Å; H9-H11 VanDerWaalsContact C-N 3.26Å; H9-H11 PolarHBondContact O-N 3.06Å
10	V	59.3	Low	65.3	Low	126 Å²	126	136.3 Å²	136.3	76%	0.764	74%	0.74	S	S	*	*			trans	-67.2	96	163.4	-178.9	0	0	0	0	104.9	H8 E12	H8-V10 PolarHBondContact O-N 3.46Å; V10-E12 PolarHBondContact O-N 3.22Å; V10-E12 VanDerWaalsContact O-N 3.15Å
11	H	64.3	Low	65.8	Low	164 Å²	164	133.8 Å²	133.8	76%	0.759	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-52.7	122.3	164	-79.4	-80.7	0	0	0	106.9	H9	H9-H11 VanDerWaalsContact C-N 3.26Å; H9-H11 PolarHBondContact O-N 3.06Å
12	E	68.5	Low	67.2	Low	172 Å²	172	124.8 Å²	124.8	80%	0.804	68%	0.676	S	S	*	*	P	Polyproline II helix	trans	-46.7	139.4	169.8	-65.6	178	178.7	0	0	108.6	V10 F14	V10-E12 PolarHBondContact O-N 3.22Å; V10-E12 VanDerWaalsContact O-N 3.15Å; E12-F14 PolarHBondContact O-N 3.36Å
13	P	75.9	Confident	68.3	Low	121 Å²	121	122.6 Å²	122.6	79%	0.786	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-56.1	118.2	-178.9	23.7	-32.3	0	0	0	107.9	E15	P13-E15 PolarHBondContact O-N 3.48Å
14	F	79.1	Confident	69.3	Low	168 Å²	168	122.7 Å²	122.7	74%	0.737	64%	0.64	S	S	*	*	P	Polyproline II helix	trans	-55	125.8	-179.1	70	-81.7	0	0	0	109	E12 V16	E12-F14 PolarHBondContact O-N 3.36Å; F14-V16 HydrophobicContact CD2-CG2 4Å; F14-V16 HydrophobicContact CE2-CB 4.45Å; F14-V16 HydrophobicContact CE2-CG2 3.39Å; F14-V16 HydrophobicContact CZ-CG2 3.98Å; F14-V16 PolarHBondContact O-N 3.24Å; F14-V16 VanDerWaalsContact O-N 3.16Å
15	E	80.9	Confident	69.5	Low	187 Å²	187	121.2 Å²	121.2	87%	0.874	63%	0.633	S	S	*	*			trans	-71.7	112.5	175.4	-169.6	175.2	177.8	0	0	108.3	P13 P17	P13-E15 PolarHBondContact O-N 3.48Å; E15-P17 WeakPolarHBondContact O-CD 3.46Å
16	V	79.8	Confident	70	Confident	103 Å²	103	116 Å²	116	62%	0.624	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-67.9	122.9	177.9	-178.3	0	0	0	0	108.4	F14	F14-V16 HydrophobicContact CD2-CG2 4Å; F14-V16 HydrophobicContact CE2-CB 4.45Å; F14-V16 HydrophobicContact CE2-CG2 3.39Å; F14-V16 HydrophobicContact CZ-CG2 3.98Å; F14-V16 PolarHBondContact O-N 3.24Å; F14-V16 VanDerWaalsContact O-N 3.16Å
17	P	80.1	Confident	70.3	Confident	64 Å²	64	114 Å²	114	42%	0.416	60%	0.598	S	S	.	*	P	Polyproline II helix	trans	-57.6	147.5	176.1	-23.5	33	0	0	0	111.7	E15 Y19 Y22	E15-P17 WeakPolarHBondContact O-CD 3.46Å; P17-Y19 PolarHBondContact O-N 3.1Å; P17-Y22 HydrophobicContact CB-CE2 4.39Å
18	S	82.4	Confident	71.4	Confident	55 Å²	55	111.9 Å²	111.9	39%	0.385	57%	0.572	S	S	.	*	P	Polyproline II helix	trans	-62.7	131.5	-176.5	-178.8	0	0	0	0	111.2	K20 E21	S18-K20 PolarHBondContact O-N 3.12Å; S18-E21 VanDerWaalsContact O-CB 3.27Å; S18-E21 WeakPolarHBondContact O-CB 3.49Å; S18-E21 WeakPolarHBondContact O-CG 3.06Å; S18-E21 PolarHBondContact O-N 2.88Å
19	Y	80.4	Confident	72.4	Confident	157 Å²	157	109.7 Å²	109.7	62%	0.616	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-56.5	-22.3	177.6	72.6	-86.9	0	0	0	113.4	P17 E21 Y22	P17-Y19 PolarHBondContact O-N 3.1Å; Y19-E21 PolarHBondContact O-N 3.43Å; Y19-Y22 PolarHBondContact O-N 3.28Å
20	K	82.2	Confident	73.3	Confident	142 Å²	142	105.6 Å²	105.6	62%	0.617	55%	0.546	S	S	*	.	G	3₁₀ helix	trans	-67.8	-21.5	178	-65.5	-177.4	179.7	177	0	112.7	S18 Y22 T23	S18-K20 PolarHBondContact O-N 3.12Å; K20-Y22 VanDerWaalsContact C-N 3.29Å; K20-Y22 PolarHBondContact O-N 3.49Å; K20-T23 PolarHBondContact O-OG1 3.31Å
21	E	76.8	Confident	74.4	Confident	85 Å²	85	100.6 Å²	100.6	40%	0.397	51%	0.514	S	S	.	.	G	3₁₀ helix	trans	-70.1	-29.2	178.3	-66.6	-174.1	-150.1	0	0	112.6	S18 Y19 T23 R26	S18-E21 VanDerWaalsContact O-CB 3.27Å; S18-E21 WeakPolarHBondContact O-CB 3.49Å; S18-E21 WeakPolarHBondContact O-CG 3.06Å; S18-E21 PolarHBondContact O-N 2.88Å; Y19-E21 PolarHBondContact O-N 3.43Å; E21-T23 VanDerWaalsContact C-N 3.31Å; E21-T23 PolarHBondContact O-N 2.96Å; E21-T23 VanDerWaalsContact O-N 3.1Å; E21-R26 VanDerWaalsContact O-CD 3.25Å; E21-R26 WeakPolarHBondContact O-CD 3.39Å; E21-R26 VanDerWaalsContact O-CZ 3.27Å; E21-R26 PolarHBondContact O-NE 3.04Å; E21-R26 PolarHBondContact O-NH1 3.39Å; E21-R26 IonicContact OE2-CZ 3.84Å; E21-R26 IonicContact OE2-NH1 3.56Å; E21-R26 IonicContact OE2-NH2 3.03Å; E21-R26 PolarHBondContact OE2-NH2 3.28Å
22	Y	72.1	Confident	75.4	Confident	65 Å²	65	95.8 Å²	95.8	26%	0.255	49%	0.491	S	S	.	.			trans	-89.2	65.9	-178.3	-58.5	-75.2	0	0	0	110.8	P17 Y19 K20 R49 V52 H53	P17-Y22 HydrophobicContact CB-CE2 4.39Å; Y19-Y22 PolarHBondContact O-N 3.28Å; K20-Y22 VanDerWaalsContact C-N 3.29Å; K20-Y22 PolarHBondContact O-N 3.49Å; Y22-R49 WeakPolarHBondContact O-CD 3.42Å; Y22-R49 WeakPolarHBondContact O-CG 3.48Å; Y22-V52 HydrophobicContact CD1-CG1 4.44Å; Y22-H53 HydrophobicContact CD1-CB 3.82Å; Y22-H53 HydrophobicContact CE1-CB 3.42Å; Y22-H53 VanDerWaalsContact CE1-CB 3.42Å
23	T	71.8	Confident	76.2	Confident	69 Å²	69	93.3 Å²	93.3	42%	0.423	48%	0.475	S	S	.	.			trans	-82.6	149.7	173.1	-56.8	0	0	0	0	110.3	K20 E21 D25 R26	K20-T23 PolarHBondContact O-OG1 3.31Å; E21-T23 VanDerWaalsContact C-N 3.31Å; E21-T23 PolarHBondContact O-N 2.96Å; E21-T23 VanDerWaalsContact O-N 3.1Å; T23-D25 HydrophobicContact CG2-CB 4.4Å; T23-D25 PolarHBondContact O-N 3.02Å; T23-R26 WeakPolarHBondContact O-CB 3.47Å; T23-R26 PolarHBondContact O-N 3.37Å
24	H	66.2	Low	76.8	Confident	68 Å²	68	92.6 Å²	92.6	32%	0.315	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.4	-20.5	177.1	-54.9	107.1	0	0	0	113.4	L35	H24-L35 HydrophobicContact CB-CD1 4.4Å
25	D	63.2	Low	77.3	Confident	117 Å²	117	86.5 Å²	86.5	63%	0.626	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	8.2	-178.9	-61.3	-37.7	0	0	0	114.6	T23 G27 Q32	T23-D25 HydrophobicContact CG2-CB 4.4Å; T23-D25 PolarHBondContact O-N 3.02Å; D25-G27 PolarHBondContact O-N 3.08Å; D25-Q32 PolarHBondContact OD1-NE2 3.34Å; D25-Q32 VanDerWaalsContact OD1-NE2 3.14Å
26	R	64.1	Low	77.7	Confident	54 Å²	54	84 Å²	84	20%	0.204	42%	0.415	C	S	.	.	S	Bend	trans	-73.8	74.7	-178.8	-148.4	-173.4	-160.8	168.1	4.4	111.4	E21 T23 N28 V52 D56	E21-R26 VanDerWaalsContact O-CD 3.25Å; E21-R26 WeakPolarHBondContact O-CD 3.39Å; E21-R26 VanDerWaalsContact O-CZ 3.27Å; E21-R26 PolarHBondContact O-NE 3.04Å; E21-R26 PolarHBondContact O-NH1 3.39Å; E21-R26 IonicContact OE2-CZ 3.84Å; E21-R26 IonicContact OE2-NH1 3.56Å; E21-R26 IonicContact OE2-NH2 3.03Å; E21-R26 PolarHBondContact OE2-NH2 3.28Å; T23-R26 WeakPolarHBondContact O-CB 3.47Å; T23-R26 PolarHBondContact O-N 3.37Å; R26-N28 PolarHBondContact O-N 3.33Å; R26-V52 HydrophobicContact CB-CG1 4.06Å; R26-D56 WeakPolarHBondContact CD-OD2 3.29Å; R26-D56 IonicContact NE-OD2 3.79Å
27	G	62.2	Low	78.2	Confident	71 Å²	71	85.8 Å²	85.8	73%	0.732	41%	0.41	S	S	*	.	S	Bend	trans	61.9	1.2	158.7	0	0	0	0	0	118.4	D25	D25-G27 PolarHBondContact O-N 3.08Å
28	N	72.6	Confident	78.8	Confident	17 Å²	17	84.1 Å²	84.1	9%	0.091	40%	0.397	C	S	.	.			trans	-101.9	92.8	-179.9	-170.7	-7.5	0	0	0	112.1	R26 D30 Y31 Q32 A55	R26-N28 PolarHBondContact O-N 3.33Å; N28-D30 PolarHBondContact O-N 3.42Å; N28-D30 WeakPolarHBondContact OD1-CB 3.33Å; N28-D30 PolarHBondContact OD1-N 3.08Å; N28-Y31 WeakPolarHBondContact O-CB 3.4Å; N28-Y31 PolarHBondContact O-N 3Å; N28-Y31 VanDerWaalsContact O-N 3.09Å; N28-Y31 PolarHBondContact OD1-N 3.31Å; N28-Q32 PolarHBondContact O-N 3.1Å; N28-A55 VanDerWaalsContact ND2-C 3.34Å; N28-A55 WeakPolarHBondContact ND2-CB 3.37Å; N28-A55 PolarHBondContact ND2-O 3.37Å
29	E	78.4	Confident	79.2	Confident	133 Å²	133	85 Å²	85	62%	0.621	40%	0.403	S	S	*	.	H	α-helix	trans	-55.8	-34.6	175.5	-64	-177.5	-179.4	0	0	113.6	Y31 R33	E29-Y31 VanDerWaalsContact C-N 3.33Å; E29-R33 VanDerWaalsContact O-CB 3.26Å; E29-R33 WeakPolarHBondContact O-CB 3.31Å; E29-R33 PolarHBondContact O-N 3.44Å
30	D	78.8	Confident	79.8	Confident	79 Å²	79	87.2 Å²	87.2	42%	0.422	41%	0.411	S	S	.	.	H	α-helix	trans	-69.3	-37.3	179.4	-65.9	-41.5	0	0	0	110.6	N28 R33 Y34 K57	N28-D30 PolarHBondContact O-N 3.42Å; N28-D30 WeakPolarHBondContact OD1-CB 3.33Å; N28-D30 PolarHBondContact OD1-N 3.08Å; D30-R33 WeakPolarHBondContact O-CB 3.48Å; D30-R33 PolarHBondContact O-N 3.04Å; D30-Y34 PolarHBondContact O-N 2.91Å; D30-K57 VanDerWaalsContact OD2-CE 3.24Å; D30-K57 WeakPolarHBondContact OD2-CE 3.26Å; D30-K57 IonicContact OD2-NZ 2.7Å; D30-K57 PolarHBondContact OD2-NZ 3.44Å
31	Y	82.6	Confident	80.3	Confident	22 Å²	22	88.3 Å²	88.3	9%	0.086	42%	0.416	C	S	.	.	H	α-helix	trans	-69.2	-44.4	177.2	-165.8	-115.2	0	0	0	112.1	N28 E29 R33 Y34 L35 A48 V52 A55	N28-Y31 WeakPolarHBondContact O-CB 3.4Å; N28-Y31 PolarHBondContact O-N 3Å; N28-Y31 VanDerWaalsContact O-N 3.09Å; N28-Y31 PolarHBondContact OD1-N 3.31Å; E29-Y31 VanDerWaalsContact C-N 3.33Å; Y31-R33 VanDerWaalsContact C-N 3.25Å; Y31-R33 PolarHBondContact O-N 3.48Å; Y31-Y34 HydrophobicContact CD2-CD1 4.39Å; Y31-Y34 HydrophobicContact CE2-CD1 4.03Å; Y31-Y34 WeakPolarHBondContact O-CB 3.37Å; Y31-Y34 PolarHBondContact O-N 3.02Å; Y31-Y34 VanDerWaalsContact O-N 3.12Å; Y31-L35 HydrophobicContact CD1-CD1 4.09Å; Y31-L35 HydrophobicContact CD1-CG 4.5Å; Y31-L35 HydrophobicContact CE1-CD1 3.8Å; Y31-L35 HydrophobicContact CE1-CG 4.23Å; Y31-L35 WeakPolarHBondContact O-CG 3.24Å; Y31-L35 PolarHBondContact O-N 2.99Å; Y31-A48 HydrophobicContact CE1-CB 4.49Å; Y31-A48 WeakPolarHBondContact CE1-O 3.45Å; Y31-A48 VanDerWaalsContact CZ-O 3.28Å; Y31-A48 WeakPolarHBondContact OH-CA 3.25Å; Y31-A48 WeakPolarHBondContact OH-CB 3.39Å; Y31-A48 PolarHBondContact OH-O 3Å; Y31-V52 HydrophobicContact CD1-CG2 4.35Å; Y31-V52 HydrophobicContact CE1-CG2 3.87Å; Y31-A55 HydrophobicContact CD2-CB 4.1Å; Y31-A55 HydrophobicContact CG-CB 4.23Å
32	Q	84.3	Confident	81	Confident	62 Å²	62	87.7 Å²	87.7	29%	0.29	43%	0.432	S	S	.	.	H	α-helix	trans	-62.6	-34.1	171.5	-69	-174.9	-9.1	0	0	112.1	D25 N28 L35 R36	D25-Q32 PolarHBondContact OD1-NE2 3.34Å; D25-Q32 VanDerWaalsContact OD1-NE2 3.14Å; N28-Q32 PolarHBondContact O-N 3.1Å; Q32-L35 PolarHBondContact O-N 3.5Å; Q32-R36 WeakPolarHBondContact O-CB 3.2Å; Q32-R36 WeakPolarHBondContact O-CG 3.36Å; Q32-R36 PolarHBondContact O-N 3.45Å; Q32-R36 PolarHBondContact O-NE 2.95Å
33	R	87	Confident	81.9	Confident	121 Å²	121	89.5 Å²	89.5	46%	0.457	45%	0.446	S	S	.	.	H	α-helix	trans	-65.3	-39.7	173.2	-172.2	-176.7	-68.9	-171.6	-1.8	111.3	E29 D30 Y31 R36 R37	E29-R33 VanDerWaalsContact O-CB 3.26Å; E29-R33 WeakPolarHBondContact O-CB 3.31Å; E29-R33 PolarHBondContact O-N 3.44Å; D30-R33 WeakPolarHBondContact O-CB 3.48Å; D30-R33 PolarHBondContact O-N 3.04Å; Y31-R33 VanDerWaalsContact C-N 3.25Å; Y31-R33 PolarHBondContact O-N 3.48Å; R33-R36 PolarHBondContact O-N 3.45Å; R33-R37 WeakPolarHBondContact O-CG 3.24Å; R33-R37 PolarHBondContact O-N 3.15Å
34	Y	88.2	Confident	82.7	Confident	106 Å²	106	95.3 Å²	95.3	42%	0.416	47%	0.465	S	S	.	.	H	α-helix	trans	-61.6	-50.3	172.6	167.2	-103	0	0	0	111.7	D30 Y31 R36 R37 L38	D30-Y34 PolarHBondContact O-N 2.91Å; Y31-Y34 HydrophobicContact CD2-CD1 4.39Å; Y31-Y34 HydrophobicContact CE2-CD1 4.03Å; Y31-Y34 WeakPolarHBondContact O-CB 3.37Å; Y31-Y34 PolarHBondContact O-N 3.02Å; Y31-Y34 VanDerWaalsContact O-N 3.12Å; Y34-R36 VanDerWaalsContact C-N 3.31Å; Y34-R36 PolarHBondContact O-N 3Å; Y34-R37 WeakPolarHBondContact O-CA 3.5Å; Y34-R37 WeakPolarHBondContact O-CB 3.31Å; Y34-R37 PolarHBondContact O-N 3.42Å; Y34-L38 PolarHBondContact O-N 3.5Å
35	L	88.3	Confident	83.7	Confident	40 Å²	40	93.6 Å²	93.6	21%	0.209	46%	0.459	C	S	.	.	H	α-helix	trans	-60.8	-39.2	178	-65	178	0	0	0	112.2	H24 Y31 Q32 R37 L38 S39 A48	H24-L35 HydrophobicContact CB-CD1 4.4Å; Y31-L35 HydrophobicContact CD1-CD1 4.09Å; Y31-L35 HydrophobicContact CD1-CG 4.5Å; Y31-L35 HydrophobicContact CE1-CD1 3.8Å; Y31-L35 HydrophobicContact CE1-CG 4.23Å; Y31-L35 WeakPolarHBondContact O-CG 3.24Å; Y31-L35 PolarHBondContact O-N 2.99Å; Q32-L35 PolarHBondContact O-N 3.5Å; L35-R37 VanDerWaalsContact C-N 3.34Å; L35-R37 PolarHBondContact O-N 3.35Å; L35-L38 PolarHBondContact O-N 3.14Å; L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.3Å; L35-A48 HydrophobicContact CD1-CB 4.41Å; L35-A48 HydrophobicContact CD2-CB 3.71Å
36	R	89.3	Confident	84.9	Confident	135 Å²	135	93.2 Å²	93.2	51%	0.509	46%	0.462	S	S	.	.	H	α-helix	trans	-65.3	-32.7	172.9	-78.6	-174.8	-66.4	-154.9	-2.2	113.4	Q32 R33 Y34 S39 R40	Q32-R36 WeakPolarHBondContact O-CB 3.2Å; Q32-R36 WeakPolarHBondContact O-CG 3.36Å; Q32-R36 PolarHBondContact O-N 3.45Å; Q32-R36 PolarHBondContact O-NE 2.95Å; R33-R36 PolarHBondContact O-N 3.45Å; Y34-R36 VanDerWaalsContact C-N 3.31Å; Y34-R36 PolarHBondContact O-N 3Å; R36-S39 WeakPolarHBondContact CA-OG 3.45Å; R36-S39 PolarHBondContact O-OG 3.34Å; R36-R40 VanDerWaalsContact O-CG 3.31Å; R36-R40 WeakPolarHBondContact O-CG 3.28Å; R36-R40 PolarHBondContact O-N 2.85Å
37	R	91.4	Very high	86	Confident	140 Å²	140	98.2 Å²	98.2	53%	0.528	48%	0.481	S	S	.	.	H	α-helix	trans	-69.6	-43.1	173.6	-75.1	173.5	-174.9	174	0.7	110.4	R33 Y34 L35 S39 R40 F41	R33-R37 WeakPolarHBondContact O-CG 3.24Å; R33-R37 PolarHBondContact O-N 3.15Å; Y34-R37 WeakPolarHBondContact O-CA 3.5Å; Y34-R37 WeakPolarHBondContact O-CB 3.31Å; Y34-R37 PolarHBondContact O-N 3.42Å; L35-R37 VanDerWaalsContact C-N 3.34Å; L35-R37 PolarHBondContact O-N 3.35Å; R37-S39 VanDerWaalsContact C-N 3.33Å; R37-S39 PolarHBondContact O-N 2.94Å; R37-R40 WeakPolarHBondContact O-CB 3.48Å; R37-R40 PolarHBondContact O-N 2.84Å; R37-F41 WeakPolarHBondContact O-CD2 3.35Å
38	L	92.1	Very high	87	Confident	28 Å²	28	95 Å²	95	15%	0.147	45%	0.447	C	S	.	.	H	α-helix	trans	-63.2	-41.7	178.6	-164.6	67.3	0	0	0	111.5	Y34 L35 R40 F41 G42 L43 D45	Y34-L38 PolarHBondContact O-N 3.5Å; L35-L38 PolarHBondContact O-N 3.14Å; L38-R40 PolarHBondContact O-N 2.71Å; L38-F41 PolarHBondContact O-N 3.39Å; L38-G42 PolarHBondContact O-N 3.26Å; L38-L43 CarbonylContact C-O 3.29Å; L38-L43 VanDerWaalsContact C-O 3.29Å; L38-L43 HydrophobicContact CD1-CB 3.54Å; L38-L43 HydrophobicContact CD1-CD2 4.01Å; L38-L43 HydrophobicContact CD1-CG 4.42Å; L38-L43 HydrophobicContact CD2-CB 4.3Å; L38-L43 HydrophobicContact CG-CB 3.56Å; L38-L43 WeakPolarHBondContact CG-O 2.82Å; L38-L43 PolarHBondContact O-N 3.08Å; L38-L43 VanDerWaalsContact O-N 3.16Å; L38-D45 HydrophobicContact CD2-CB 3.55Å
39	S	90.7	Very high	87.5	Confident	73 Å²	73	100.4 Å²	100.4	51%	0.51	47%	0.466	S	S	.	.	H	α-helix	trans	-63.9	-28.3	176.9	73.2	0	0	0	0	113.1	L35 R36 R37 F41 G42 L43	L35-S39 WeakPolarHBondContact O-CB 3.47Å; L35-S39 PolarHBondContact O-N 3.3Å; R36-S39 WeakPolarHBondContact CA-OG 3.45Å; R36-S39 PolarHBondContact O-OG 3.34Å; R37-S39 VanDerWaalsContact C-N 3.33Å; R37-S39 PolarHBondContact O-N 2.94Å; S39-F41 PolarHBondContact O-N 3.4Å; S39-G42 PolarHBondContact O-N 2.99Å; S39-L43 PolarHBondContact N-O 3.35Å
40	R	92.8	Very high	87.8	Confident	205 Å²	205	97.9 Å²	97.9	77%	0.774	46%	0.458	S	S	*	.	H	α-helix	trans	-65.2	-24.8	173.6	-72.5	168.9	-176.5	-171.2	-2.1	112.7	R36 R37 L38 G42	R36-R40 VanDerWaalsContact O-CG 3.31Å; R36-R40 WeakPolarHBondContact O-CG 3.28Å; R36-R40 PolarHBondContact O-N 2.85Å; R37-R40 WeakPolarHBondContact O-CB 3.48Å; R37-R40 PolarHBondContact O-N 2.84Å; L38-R40 PolarHBondContact O-N 2.71Å; R40-G42 VanDerWaalsContact C-N 3.34Å
41	F	92.7	Very high	87.9	Confident	164 Å²	164	99.9 Å²	99.9	72%	0.719	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91	2.9	173.8	-63	-73	0	0	0	112.8	R37 L38 S39 L43	R37-F41 WeakPolarHBondContact O-CD2 3.35Å; L38-F41 PolarHBondContact O-N 3.39Å; S39-F41 PolarHBondContact O-N 3.4Å; F41-L43 HydrophobicContact CB-CD1 3.94Å; F41-L43 VanDerWaalsContact O-CD1 3.24Å; F41-L43 WeakPolarHBondContact O-CD1 3.3Å; F41-L43 PolarHBondContact O-N 3.1Å
42	G	91.6	Very high	87.8	Confident	72 Å²	72	99 Å²	99	74%	0.742	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	73	10.7	-173.6	0	0	0	0	0	113.8	L38 S39 R40	L38-G42 PolarHBondContact O-N 3.26Å; S39-G42 PolarHBondContact O-N 2.99Å; R40-G42 VanDerWaalsContact C-N 3.34Å
43	L	92	Very high	87.4	Confident	104 Å²	104	100.5 Å²	100.5	55%	0.545	46%	0.464	S	S	.	.			trans	-93.3	143.9	177.6	-83.9	73.9	0	0	0	110.3	L38 S39 F41	L38-L43 CarbonylContact C-O 3.29Å; L38-L43 VanDerWaalsContact C-O 3.29Å; L38-L43 HydrophobicContact CD1-CB 3.54Å; L38-L43 HydrophobicContact CD1-CD2 4.01Å; L38-L43 HydrophobicContact CD1-CG 4.42Å; L38-L43 HydrophobicContact CD2-CB 4.3Å; L38-L43 HydrophobicContact CG-CB 3.56Å; L38-L43 WeakPolarHBondContact CG-O 2.82Å; L38-L43 PolarHBondContact O-N 3.08Å; L38-L43 VanDerWaalsContact O-N 3.16Å; S39-L43 PolarHBondContact N-O 3.35Å; F41-L43 HydrophobicContact CB-CD1 3.94Å; F41-L43 VanDerWaalsContact O-CD1 3.24Å; F41-L43 WeakPolarHBondContact O-CD1 3.3Å; F41-L43 PolarHBondContact O-N 3.1Å
44	K	87.8	Confident	86.9	Confident	191 Å²	191	98.2 Å²	98.2	83%	0.83	47%	0.471	S	S	*	.			trans	-123.7	129.3	170.8	-176.7	179	-179.7	-179.1	0	108.2	P46	K44-P46 VanDerWaalsContact O-CD 3.3Å; K44-P46 WeakPolarHBondContact O-CD 3.38Å
45	D	87.7	Confident	86	Confident	32 Å²	32	94.3 Å²	94.3	17%	0.171	46%	0.461	C	S	.	.			trans	-86.1	112.6	175	179	7.8	0	0	0	109.7	L38 W47 A48	L38-D45 HydrophobicContact CD2-CB 3.55Å; D45-W47 VanDerWaalsContact C-N 3.26Å; D45-W47 PolarHBondContact O-N 2.92Å; D45-W47 WeakPolarHBondContact OD1-CA 3.27Å; D45-W47 WeakPolarHBondContact OD1-CB 3.38Å; D45-W47 PolarHBondContact OD1-N 3.35Å; D45-A48 HydrophobicContact CB-CB 4.18Å; D45-A48 VanDerWaalsContact O-CB 3.29Å; D45-A48 WeakPolarHBondContact O-CB 3.28Å; D45-A48 PolarHBondContact O-N 2.93Å
46	P	87.9	Confident	85	Confident	108 Å²	108	93.4 Å²	93.4	70%	0.701	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71	-22.3	177	29.7	-33.8	0	0	0	112.8	K44 A48	K44-P46 VanDerWaalsContact O-CD 3.3Å; K44-P46 WeakPolarHBondContact O-CD 3.38Å; P46-A48 PolarHBondContact O-N 3.25Å
47	W	87.2	Confident	83.7	Confident	160 Å²	160	91.6 Å²	91.6	61%	0.606	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.2	5.9	178.3	-63.8	95.6	0	0	0	112.6	D45 R49 N50 Y51	D45-W47 VanDerWaalsContact C-N 3.26Å; D45-W47 PolarHBondContact O-N 2.92Å; D45-W47 WeakPolarHBondContact OD1-CA 3.27Å; D45-W47 WeakPolarHBondContact OD1-CB 3.38Å; D45-W47 PolarHBondContact OD1-N 3.35Å; W47-R49 PolarHBondContact O-N 3.46Å; W47-N50 HydrophobicContact CE3-CB 4.13Å; W47-N50 VanDerWaalsContact O-CB 3.3Å; W47-N50 WeakPolarHBondContact O-CB 3.36Å; W47-N50 PolarHBondContact O-N 2.87Å; W47-Y51 HydrophobicContact CB-CD2 4.2Å; W47-Y51 HydrophobicContact CB-CE2 3.75Å; W47-Y51 WeakPolarHBondContact O-CD2 3.38Å; W47-Y51 PolarHBondContact O-N 3.13Å
48	A	84.4	Confident	82.3	Confident	2 Å²	2	94 Å²	94	2%	0.017	46%	0.461	C	S	.	.	T	Hydrogen-bonded Turn	trans	-56.1	-33.9	-173.5	0	0	0	0	0	112.4	Y31 L35 D45 P46 V52	Y31-A48 HydrophobicContact CE1-CB 4.49Å; Y31-A48 WeakPolarHBondContact CE1-O 3.45Å; Y31-A48 VanDerWaalsContact CZ-O 3.28Å; Y31-A48 WeakPolarHBondContact OH-CA 3.25Å; Y31-A48 WeakPolarHBondContact OH-CB 3.39Å; Y31-A48 PolarHBondContact OH-O 3Å; L35-A48 HydrophobicContact CD1-CB 4.41Å; L35-A48 HydrophobicContact CD2-CB 3.71Å; D45-A48 HydrophobicContact CB-CB 4.18Å; D45-A48 VanDerWaalsContact O-CB 3.29Å; D45-A48 WeakPolarHBondContact O-CB 3.28Å; D45-A48 PolarHBondContact O-N 2.93Å; P46-A48 PolarHBondContact O-N 3.25Å; A48-V52 WeakPolarHBondContact O-CG2 3.34Å
49	R	81.9	Confident	80.7	Confident	131 Å²	131	98.2 Å²	98.2	49%	0.494	48%	0.482	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.2	-35.6	177.9	-154.2	175.3	-51	-176.2	9.1	113.3	Y22 W47 Y51 V52	Y22-R49 WeakPolarHBondContact O-CD 3.42Å; Y22-R49 WeakPolarHBondContact O-CG 3.48Å; W47-R49 PolarHBondContact O-N 3.46Å; R49-Y51 VanDerWaalsContact C-N 3.26Å; R49-Y51 PolarHBondContact O-N 2.84Å; R49-V52 PolarHBondContact O-N 3.28Å
50	N	85.4	Confident	79.3	Confident	81 Å²	81	98.4 Å²	98.4	43%	0.433	48%	0.477	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.5	-38	-177.9	-170.7	55.7	0	0	0	110.6	W47 H53	W47-N50 HydrophobicContact CE3-CB 4.13Å; W47-N50 VanDerWaalsContact O-CB 3.3Å; W47-N50 WeakPolarHBondContact O-CB 3.36Å; W47-N50 PolarHBondContact O-N 2.87Å; N50-H53 PolarHBondContact O-CE1 2.89Å; N50-H53 PolarHBondContact O-ND1 3.01Å
51	Y	80.3	Confident	78.3	Confident	120 Å²	120	91.8 Å²	91.8	47%	0.471	46%	0.46	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.1	-4.1	-177.6	-61.9	-67.5	0	0	0	115	W47 R49 H53 A54 A55	W47-Y51 HydrophobicContact CB-CD2 4.2Å; W47-Y51 HydrophobicContact CB-CE2 3.75Å; W47-Y51 WeakPolarHBondContact O-CD2 3.38Å; W47-Y51 PolarHBondContact O-N 3.13Å; R49-Y51 VanDerWaalsContact C-N 3.26Å; R49-Y51 PolarHBondContact O-N 2.84Å; Y51-H53 PolarHBondContact O-N 3.27Å; Y51-A54 PolarHBondContact O-N 3.49Å; Y51-A54 VanDerWaalsContact O-N 3.16Å; Y51-A55 WeakPolarHBondContact O-CB 3.38Å; Y51-A55 PolarHBondContact O-N 3.47Å
52	V	81	Confident	77.2	Confident	5 Å²	5	91.4 Å²	91.4	3%	0.03	46%	0.462	C	S	.	.	H	α-helix	trans	-58.4	-39.2	179.9	175.9	0	0	0	0	111	Y22 R26 Y31 A48 R49 A54 A55 D56	Y22-V52 HydrophobicContact CD1-CG1 4.44Å; R26-V52 HydrophobicContact CB-CG1 4.06Å; Y31-V52 HydrophobicContact CD1-CG2 4.35Å; Y31-V52 HydrophobicContact CE1-CG2 3.87Å; A48-V52 WeakPolarHBondContact O-CG2 3.34Å; R49-V52 PolarHBondContact O-N 3.28Å; V52-A54 VanDerWaalsContact C-N 3.33Å; V52-A54 PolarHBondContact O-N 2.83Å; V52-A55 CarbonylContact O-C 3.59Å; V52-A55 PolarHBondContact O-N 3.44Å; V52-D56 WeakPolarHBondContact O-CB 3.37Å; V52-D56 PolarHBondContact O-N 3.13Å
53	H	76.6	Confident	76.4	Confident	92 Å²	92	95.8 Å²	95.8	43%	0.426	46%	0.456	S	S	.	.	H	α-helix	trans	-63.4	-37.4	-179.9	75.4	-88.1	0	0	0	112.8	Y22 N50 Y51 A55	Y22-H53 HydrophobicContact CD1-CB 3.82Å; Y22-H53 HydrophobicContact CE1-CB 3.42Å; Y22-H53 VanDerWaalsContact CE1-CB 3.42Å; N50-H53 PolarHBondContact O-CE1 2.89Å; N50-H53 PolarHBondContact O-ND1 3.01Å; Y51-H53 PolarHBondContact O-N 3.27Å; H53-A55 VanDerWaalsContact C-N 3.34Å
54	A	75.8	Confident	75.7	Confident	73 Å²	73	95.2 Å²	95.2	60%	0.603	45%	0.451	S	S	*	.	H	α-helix	trans	-74.5	-30.7	178.7	0	0	0	0	0	111.6	Y51 V52	Y51-A54 PolarHBondContact O-N 3.49Å; Y51-A54 VanDerWaalsContact O-N 3.16Å; V52-A54 VanDerWaalsContact C-N 3.33Å; V52-A54 PolarHBondContact O-N 2.83Å
55	A	69	Low	75.1	Confident	25 Å²	25	91.3 Å²	91.3	21%	0.207	43%	0.434	C	S	.	.	H	α-helix	trans	-83.4	-21.4	179.2	0	0	0	0	0	112.1	N28 Y31 Y51 V52 H53 K57	N28-A55 VanDerWaalsContact ND2-C 3.34Å; N28-A55 WeakPolarHBondContact ND2-CB 3.37Å; N28-A55 PolarHBondContact ND2-O 3.37Å; Y31-A55 HydrophobicContact CD2-CB 4.1Å; Y31-A55 HydrophobicContact CG-CB 4.23Å; Y51-A55 WeakPolarHBondContact O-CB 3.38Å; Y51-A55 PolarHBondContact O-N 3.47Å; V52-A55 CarbonylContact O-C 3.59Å; V52-A55 PolarHBondContact O-N 3.44Å; H53-A55 VanDerWaalsContact C-N 3.34Å; A55-K57 PolarHBondContact O-N 3.24Å
56	D	68.2	Low	74.9	Confident	21 Å²	21	93.1 Å²	93.1	11%	0.112	45%	0.446	C	S	.	.			trans	-60.5	112.7	-177.7	-163.2	-11.9	0	0	0	110.7	R26 V52 R58 I59	R26-D56 WeakPolarHBondContact CD-OD2 3.29Å; R26-D56 IonicContact NE-OD2 3.79Å; V52-D56 WeakPolarHBondContact O-CB 3.37Å; V52-D56 PolarHBondContact O-N 3.13Å; D56-R58 PolarHBondContact O-N 3.02Å; D56-R58 WeakPolarHBondContact OD1-CG 3.42Å; D56-R58 IonicContact OD1-NE 3.88Å; D56-R58 WeakPolarHBondContact OD2-CD 3.48Å; D56-R58 IonicContact OD2-NE 3.85Å; D56-I59 PolarHBondContact O-N 3.15Å
57	K	62.1	Low	74.7	Confident	97 Å²	97	92.1 Å²	92.1	42%	0.422	43%	0.431	S	S	.	.	G	3₁₀ helix	trans	-68.7	3.1	-174.3	-68.3	-174	-179.9	-174.1	0	113.7	D30 A55 I59 L60	D30-K57 VanDerWaalsContact OD2-CE 3.24Å; D30-K57 WeakPolarHBondContact OD2-CE 3.26Å; D30-K57 IonicContact OD2-NZ 2.7Å; D30-K57 PolarHBondContact OD2-NZ 3.44Å; A55-K57 PolarHBondContact O-N 3.24Å; K57-I59 PolarHBondContact O-N 3.03Å; K57-L60 PolarHBondContact O-N 2.98Å
58	R	61.5	Low	74.5	Confident	190 Å²	190	90.1 Å²	90.1	72%	0.717	43%	0.428	S	S	*	.	G	3₁₀ helix	trans	-56.1	-25.7	169.9	-70.7	175.8	-172.2	-136.5	-3.5	112.2	D56 L60	D56-R58 PolarHBondContact O-N 3.02Å; D56-R58 WeakPolarHBondContact OD1-CG 3.42Å; D56-R58 IonicContact OD1-NE 3.88Å; D56-R58 WeakPolarHBondContact OD2-CD 3.48Å; D56-R58 IonicContact OD2-NE 3.85Å; R58-L60 PolarHBondContact O-N 2.97Å; R58-L60 VanDerWaalsContact O-N 3.11Å
59	I	58.9	Low	74.5	Confident	116 Å²	116	96.8 Å²	96.8	60%	0.595	46%	0.462	S	S	*	.	G	3₁₀ helix	trans	-87.8	42.5	-178.2	-56.1	162.7	0	0	0	112	D56 K57 K65	D56-I59 PolarHBondContact O-N 3.15Å; K57-I59 PolarHBondContact O-N 3.03Å; I59-K65 WeakPolarHBondContact O-CE 3.27Å
60	L	60.8	Low	74.6	Confident	77 Å²	77	96.4 Å²	96.4	40%	0.403	47%	0.469	S	S	.	.			trans	77.3	117.5	179.4	-51.6	154.4	0	0	0	114.2	K57 R58 Q64 K65	K57-L60 PolarHBondContact O-N 2.98Å; R58-L60 PolarHBondContact O-N 2.97Å; R58-L60 VanDerWaalsContact O-N 3.11Å; L60-Q64 HydrophobicContact CB-CB 4.28Å; L60-Q64 HydrophobicContact CD2-CB 4.17Å; L60-K65 HydrophobicContact CB-CG 3.8Å; L60-K65 HydrophobicContact CD1-CG 4.32Å
61	T	71	Confident	74.7	Confident	66 Å²	66	97.9 Å²	97.9	41%	0.405	47%	0.472	S	S	.	.			trans	-56.9	142.1	167.4	-58.1	0	0	0	0	108.9	W63 Q64 K65	T61-W63 HydrophobicContact CG2-CB 4.25Å; T61-W63 PolarHBondContact O-N 2.97Å; T61-Q64 WeakPolarHBondContact O-CA 3.3Å; T61-Q64 VanDerWaalsContact O-CB 3.29Å; T61-Q64 WeakPolarHBondContact O-CB 3.48Å; T61-Q64 PolarHBondContact O-N 3.34Å; T61-K65 PolarHBondContact O-N 3.49Å; T61-K65 VanDerWaalsContact O-N 3.11Å
62	M	70.9	Confident	74.5	Confident	156 Å²	156	96.8 Å²	96.8	77%	0.768	48%	0.482	S	S	*	.	H	α-helix	trans	-50	-35.6	-179.9	-169.5	178.7	-75.2	0	0	112.6	K65 V66	M62-K65 PolarHBondContact O-N 2.81Å; M62-V66 WeakPolarHBondContact O-CG2 3.48Å; M62-V66 PolarHBondContact O-N 3.44Å
63	W	73.4	Confident	74.7	Confident	164 Å²	164	98.4 Å²	98.4	62%	0.621	50%	0.5	S	S	*	.	H	α-helix	trans	-66.3	-35.2	173.9	-169.6	78.6	0	0	0	114.2	T61 V66 K67	T61-W63 HydrophobicContact CG2-CB 4.25Å; T61-W63 PolarHBondContact O-N 2.97Å; W63-V66 PolarHBondContact O-N 2.78Å; W63-K67 HydrophobicContact CD2-CD 3.96Å; W63-K67 HydrophobicContact CD2-CG 4.31Å; W63-K67 HydrophobicContact CE3-CD 3.66Å; W63-K67 HydrophobicContact CE3-CG 4.42Å; W63-K67 HydrophobicContact CH2-CD 3.89Å; W63-K67 HydrophobicContact CZ2-CD 4.04Å; W63-K67 VanDerWaalsContact CZ2-NZ 3.33Å; W63-K67 HydrophobicContact CZ3-CD 3.62Å; W63-K67 VanDerWaalsContact CZ3-CE 3.47Å; W63-K67 WeakPolarHBondContact O-CB 3.46Å; W63-K67 WeakPolarHBondContact O-CG 3.37Å; W63-K67 PolarHBondContact O-N 2.84Å
64	Q	77.2	Confident	75.2	Confident	92 Å²	92	99.5 Å²	99.5	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-65.6	-42.1	171.4	-70.5	172.3	-38.7	0	0	110.5	L60 T61 V66 K67 E68	L60-Q64 HydrophobicContact CB-CB 4.28Å; L60-Q64 HydrophobicContact CD2-CB 4.17Å; T61-Q64 WeakPolarHBondContact O-CA 3.3Å; T61-Q64 VanDerWaalsContact O-CB 3.29Å; T61-Q64 WeakPolarHBondContact O-CB 3.48Å; T61-Q64 PolarHBondContact O-N 3.34Å; Q64-V66 PolarHBondContact O-N 3.18Å; Q64-K67 PolarHBondContact O-N 2.78Å; Q64-E68 VanDerWaalsContact O-CB 3.27Å; Q64-E68 WeakPolarHBondContact O-CB 3.23Å; Q64-E68 PolarHBondContact O-N 3.16Å
65	K	77	Confident	75.8	Confident	110 Å²	110	105.9 Å²	105.9	48%	0.478	51%	0.512	S	S	.	.	H	α-helix	trans	-62.4	-41.2	174.9	-63.3	-172.5	179.9	-175.7	0	112.4	I59 L60 T61 M62 E68 L69	I59-K65 WeakPolarHBondContact O-CE 3.27Å; L60-K65 HydrophobicContact CB-CG 3.8Å; L60-K65 HydrophobicContact CD1-CG 4.32Å; T61-K65 PolarHBondContact O-N 3.49Å; T61-K65 VanDerWaalsContact O-N 3.11Å; M62-K65 PolarHBondContact O-N 2.81Å; K65-E68 PolarHBondContact O-N 2.89Å; K65-L69 VanDerWaalsContact O-CB 3.3Å; K65-L69 WeakPolarHBondContact O-CB 3.25Å; K65-L69 PolarHBondContact O-N 3.46Å
66	V	83.5	Confident	76.8	Confident	70 Å²	70	109.1 Å²	109.1	42%	0.424	53%	0.529	S	S	.	.	H	α-helix	trans	-65.8	-43.2	175.9	170	0	0	0	0	111	M62 W63 Q64 L69 L70	M62-V66 WeakPolarHBondContact O-CG2 3.48Å; M62-V66 PolarHBondContact O-N 3.44Å; W63-V66 PolarHBondContact O-N 2.78Å; Q64-V66 PolarHBondContact O-N 3.18Å; V66-L69 PolarHBondContact O-N 3.46Å; V66-L70 HydrophobicContact CG1-CD1 3.71Å; V66-L70 HydrophobicContact CG1-CG 4.31Å; V66-L70 WeakPolarHBondContact O-CB 3.39Å; V66-L70 WeakPolarHBondContact O-CG 3.43Å; V66-L70 PolarHBondContact O-N 3.27Å
67	K	83.2	Confident	77.8	Confident	87 Å²	87	109.9 Å²	109.9	38%	0.378	54%	0.543	S	S	.	.	H	α-helix	trans	-62.8	-44.2	175.2	-83.4	-173.1	157.6	-170.6	0	112.1	W63 Q64 L69 L70 F71	W63-K67 HydrophobicContact CD2-CD 3.96Å; W63-K67 HydrophobicContact CD2-CG 4.31Å; W63-K67 HydrophobicContact CE3-CD 3.66Å; W63-K67 HydrophobicContact CE3-CG 4.42Å; W63-K67 HydrophobicContact CH2-CD 3.89Å; W63-K67 HydrophobicContact CZ2-CD 4.04Å; W63-K67 VanDerWaalsContact CZ2-NZ 3.33Å; W63-K67 HydrophobicContact CZ3-CD 3.62Å; W63-K67 VanDerWaalsContact CZ3-CE 3.47Å; W63-K67 WeakPolarHBondContact O-CB 3.46Å; W63-K67 WeakPolarHBondContact O-CG 3.37Å; W63-K67 PolarHBondContact O-N 2.84Å; Q64-K67 PolarHBondContact O-N 2.78Å; K67-L69 VanDerWaalsContact C-N 3.33Å; K67-L70 PolarHBondContact O-N 3.11Å; K67-F71 HydrophobicContact CB-CD2 4.36Å; K67-F71 HydrophobicContact CG-CD2 4.39Å; K67-F71 WeakPolarHBondContact O-CA 3.45Å; K67-F71 VanDerWaalsContact O-CB 3.25Å; K67-F71 WeakPolarHBondContact O-CB 3.37Å; K67-F71 WeakPolarHBondContact O-CD2 2.95Å; K67-F71 PolarHBondContact O-N 3.28Å
68	E	82.4	Confident	79.2	Confident	117 Å²	117	106.8 Å²	106.8	55%	0.547	54%	0.535	S	S	.	.	H	α-helix	trans	-62.9	-43.6	176.6	-169.2	171.4	-171.5	0	0	110	Q64 K65 L70 S72	Q64-E68 VanDerWaalsContact O-CB 3.27Å; Q64-E68 WeakPolarHBondContact O-CB 3.23Å; Q64-E68 PolarHBondContact O-N 3.16Å; K65-E68 PolarHBondContact O-N 2.89Å; E68-L70 PolarHBondContact O-N 2.94Å; E68-S72 VanDerWaalsContact O-CA 3.28Å; E68-S72 WeakPolarHBondContact O-CA 3.43Å; E68-S72 WeakPolarHBondContact O-CB 3.4Å; E68-S72 PolarHBondContact O-N 3.46Å
69	L	85.1	Confident	80.8	Confident	142 Å²	142	99.1 Å²	99.1	74%	0.743	52%	0.515	S	S	*	.	H	α-helix	trans	-62.4	-46	176.2	-172.4	73.4	0	0	0	113	K65 V66 K67	K65-L69 VanDerWaalsContact O-CB 3.3Å; K65-L69 WeakPolarHBondContact O-CB 3.25Å; K65-L69 PolarHBondContact O-N 3.46Å; V66-L69 PolarHBondContact O-N 3.46Å; K67-L69 VanDerWaalsContact C-N 3.33Å
70	L	84.4	Confident	82.5	Confident	123 Å²	123	101.9 Å²	101.9	64%	0.644	52%	0.519	S	S	*	.	H	α-helix	trans	-78.7	-33.7	-175.2	-69.9	175.2	0	0	0	113.3	V66 K67 E68	V66-L70 HydrophobicContact CG1-CD1 3.71Å; V66-L70 HydrophobicContact CG1-CG 4.31Å; V66-L70 WeakPolarHBondContact O-CB 3.39Å; V66-L70 WeakPolarHBondContact O-CG 3.43Å; V66-L70 PolarHBondContact O-N 3.27Å; K67-L70 PolarHBondContact O-N 3.11Å; E68-L70 PolarHBondContact O-N 2.94Å
71	F	87.1	Confident	84.1	Confident	113 Å²	113	100.8 Å²	100.8	50%	0.496	52%	0.521	S	S	.	.	H	α-helix	trans	-105.9	-1.7	-176.8	-62.9	-77.5	0	0	0	113.5	K67 G73 F74	K67-F71 HydrophobicContact CB-CD2 4.36Å; K67-F71 HydrophobicContact CG-CD2 4.39Å; K67-F71 WeakPolarHBondContact O-CA 3.45Å; K67-F71 VanDerWaalsContact O-CB 3.25Å; K67-F71 WeakPolarHBondContact O-CB 3.37Å; K67-F71 WeakPolarHBondContact O-CD2 2.95Å; K67-F71 PolarHBondContact O-N 3.28Å; F71-G73 PolarHBondContact O-N 2.75Å; F71-F74 HydrophobicContact CB-CB 4.27Å; F71-F74 HydrophobicContact CD1-CB 3.96Å; F71-F74 HydrophobicContact CD1-CD1 4.47Å; F71-F74 HydrophobicContact CD1-CD2 4.3Å; F71-F74 AromaticContact CD1-CG 3.98Å; F71-F74 HydrophobicContact CD1-CG 3.98Å; F71-F74 PolarHBondContact O-N 3.04Å
72	S	76.7	Confident	85.3	Confident	96 Å²	96	103 Å²	103	67%	0.671	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.1	106.5	167.7	173.4	0	0	0	0	108.1	E68	E68-S72 VanDerWaalsContact O-CA 3.28Å; E68-S72 WeakPolarHBondContact O-CA 3.43Å; E68-S72 WeakPolarHBondContact O-CB 3.4Å; E68-S72 PolarHBondContact O-N 3.46Å
73	G	83.8	Confident	86.4	Confident	40 Å²	40	100.5 Å²	100.5	41%	0.412	52%	0.519	S	S	.	.	T	Hydrogen-bonded Turn	trans	92.3	0.8	-177.6	0	0	0	0	0	115.5	F71 W75 V76 G77	F71-G73 PolarHBondContact O-N 2.75Å; G73-W75 VanDerWaalsContact C-N 3.26Å; G73-W75 PolarHBondContact O-N 2.89Å; G73-V76 PolarHBondContact O-N 3.11Å; G73-V76 VanDerWaalsContact O-N 3.13Å; G73-G77 PolarHBondContact O-N 3.49Å
74	F	88.3	Confident	87.4	Confident	114 Å²	114	94.1 Å²	94.1	50%	0.5	50%	0.504	S	S	.	.	H	α-helix	trans	-55.7	-43.2	175.4	177.7	-98.4	0	0	0	111.7	F71 G77 A78	F71-F74 HydrophobicContact CB-CB 4.27Å; F71-F74 HydrophobicContact CD1-CB 3.96Å; F71-F74 HydrophobicContact CD1-CD1 4.47Å; F71-F74 HydrophobicContact CD1-CD2 4.3Å; F71-F74 AromaticContact CD1-CG 3.98Å; F71-F74 HydrophobicContact CD1-CG 3.98Å; F71-F74 PolarHBondContact O-N 3.04Å; F74-G77 PolarHBondContact O-N 3.41Å; F74-A78 WeakPolarHBondContact O-CB 3.24Å; F74-A78 PolarHBondContact O-N 3.48Å
75	W	87.2	Confident	88.3	Confident	208 Å²	208	94 Å²	94	79%	0.788	51%	0.506	S	S	*	.	H	α-helix	trans	-67.1	-36.8	178.2	-71.3	109	0	0	0	113.6	G73 A78 G79	G73-W75 VanDerWaalsContact C-N 3.26Å; G73-W75 PolarHBondContact O-N 2.89Å; W75-A78 PolarHBondContact O-N 3.18Å; W75-G79 PolarHBondContact O-N 3.05Å
76	V	89.8	Confident	89	Confident	92 Å²	92	92.4 Å²	92.4	56%	0.558	51%	0.505	S	S	*	.	H	α-helix	trans	-65.8	-46.4	175.3	178.1	0	0	0	0	109.5	G73 A78 G79 Y80	G73-V76 PolarHBondContact O-N 3.11Å; G73-V76 VanDerWaalsContact O-N 3.13Å; V76-A78 PolarHBondContact O-N 2.96Å; V76-G79 PolarHBondContact O-N 3.16Å; V76-Y80 HydrophobicContact CG1-CD2 3.94Å; V76-Y80 HydrophobicContact CG1-CE2 3.67Å; V76-Y80 VanDerWaalsContact O-CD2 3.24Å; V76-Y80 WeakPolarHBondContact O-CD2 3.37Å; V76-Y80 PolarHBondContact O-N 3.33Å; V76-Y80 VanDerWaalsContact O-N 3.08Å
77	G	89.7	Confident	89.5	Confident	38 Å²	38	94.2 Å²	94.2	39%	0.392	51%	0.511	S	S	.	.	H	α-helix	trans	-60.7	-42.6	175.1	0	0	0	0	0	113	G73 F74 G79 Y80 A81	G73-G77 PolarHBondContact O-N 3.49Å; F74-G77 PolarHBondContact O-N 3.41Å; G77-G79 VanDerWaalsContact C-N 3.32Å; G77-G79 PolarHBondContact O-N 3Å; G77-Y80 PolarHBondContact O-N 2.97Å; G77-A81 WeakPolarHBondContact O-CB 3.41Å; G77-A81 PolarHBondContact O-N 2.95Å
78	A	92.2	Very high	89.9	Confident	31 Å²	31	93.4 Å²	93.4	26%	0.256	51%	0.514	S	S	.	.	H	α-helix	trans	-61.8	-38.9	175.7	0	0	0	0	0	112.2	F74 W75 V76 A81 L82	F74-A78 WeakPolarHBondContact O-CB 3.24Å; F74-A78 PolarHBondContact O-N 3.48Å; W75-A78 PolarHBondContact O-N 3.18Å; V76-A78 PolarHBondContact O-N 2.96Å; A78-A81 PolarHBondContact O-N 3.27Å; A78-L82 WeakPolarHBondContact O-CG 3.35Å; A78-L82 PolarHBondContact O-N 3.37Å
79	G	94.2	Very high	90.2	Very high	30 Å²	30	93.4 Å²	93.4	31%	0.309	51%	0.514	S	S	.	.	H	α-helix	trans	-61.3	-47.4	173.2	0	0	0	0	0	112.5	W75 V76 G77 A81 L82 I83	W75-G79 PolarHBondContact O-N 3.05Å; V76-G79 PolarHBondContact O-N 3.16Å; G77-G79 VanDerWaalsContact C-N 3.32Å; G77-G79 PolarHBondContact O-N 3Å; G79-A81 VanDerWaalsContact C-N 3.33Å; G79-A81 PolarHBondContact O-N 3.03Å; G79-L82 PolarHBondContact O-N 2.64Å; G79-I83 WeakPolarHBondContact O-CG1 3.38Å; G79-I83 PolarHBondContact O-N 3.23Å; G79-I83 VanDerWaalsContact O-N 3.1Å
80	Y	94.7	Very high	90.5	Very high	173 Å²	173	92.1 Å²	92.1	68%	0.678	51%	0.507	S	S	*	.	H	α-helix	trans	-61.9	-39.9	174.8	-79.8	-68.7	0	0	0	112.7	V76 G77 I83 G84	V76-Y80 HydrophobicContact CG1-CD2 3.94Å; V76-Y80 HydrophobicContact CG1-CE2 3.67Å; V76-Y80 VanDerWaalsContact O-CD2 3.24Å; V76-Y80 WeakPolarHBondContact O-CD2 3.37Å; V76-Y80 PolarHBondContact O-N 3.33Å; V76-Y80 VanDerWaalsContact O-N 3.08Å; G77-Y80 PolarHBondContact O-N 2.97Å; Y80-I83 PolarHBondContact O-N 3.27Å; Y80-G84 PolarHBondContact O-N 2.86Å
81	A	94.1	Very high	90.8	Very high	54 Å²	54	92.5 Å²	92.5	45%	0.446	50%	0.501	S	S	.	.	H	α-helix	trans	-62.1	-44.6	177.2	0	0	0	0	0	111.7	G77 A78 G79 G84 I85	G77-A81 WeakPolarHBondContact O-CB 3.41Å; G77-A81 PolarHBondContact O-N 2.95Å; A78-A81 PolarHBondContact O-N 3.27Å; G79-A81 VanDerWaalsContact C-N 3.33Å; G79-A81 PolarHBondContact O-N 3.03Å; A81-G84 PolarHBondContact O-N 2.65Å; A81-I85 VanDerWaalsContact O-CG1 3.28Å; A81-I85 WeakPolarHBondContact O-CG1 2.97Å; A81-I85 PolarHBondContact O-N 3.45Å
82	L	95.7	Very high	90.8	Very high	114 Å²	114	93.8 Å²	93.8	60%	0.597	50%	0.503	S	S	*	.	H	α-helix	trans	-60.6	-47.3	176.1	-76.5	170.9	0	0	0	112	A78 G79 G84 I85 T86	A78-L82 WeakPolarHBondContact O-CG 3.35Å; A78-L82 PolarHBondContact O-N 3.37Å; G79-L82 PolarHBondContact O-N 2.64Å; L82-G84 VanDerWaalsContact C-N 3.3Å; L82-G84 PolarHBondContact O-N 3.37Å; L82-I85 PolarHBondContact O-N 3.37Å; L82-T86 PolarHBondContact O-N 3.1Å; L82-T86 PolarHBondContact O-OG1 3.07Å
83	I	95.3	Very high	91.3	Very high	102 Å²	102	93.3 Å²	93.3	52%	0.523	49%	0.493	S	S	.	.	H	α-helix	trans	-58.7	-44.9	177.1	-66.7	166.2	0	0	0	110.5	G79 Y80 T86 I87	G79-I83 WeakPolarHBondContact O-CG1 3.38Å; G79-I83 PolarHBondContact O-N 3.23Å; G79-I83 VanDerWaalsContact O-N 3.1Å; Y80-I83 PolarHBondContact O-N 3.27Å; I83-T86 PolarHBondContact O-N 3.29Å; I83-I87 HydrophobicContact CG2-CD1 3.78Å; I83-I87 HydrophobicContact CG2-CG1 4.48Å; I83-I87 VanDerWaalsContact O-CG1 3.31Å; I83-I87 WeakPolarHBondContact O-CG1 3.3Å; I83-I87 PolarHBondContact O-N 2.83Å
84	G	94.7	Very high	91.3	Very high	31 Å²	31	99.2 Å²	99.2	32%	0.32	51%	0.508	S	S	.	.	H	α-helix	trans	-60.7	-45	177.4	0	0	0	0	0	113	Y80 A81 L82 I87 T88	Y80-G84 PolarHBondContact O-N 2.86Å; A81-G84 PolarHBondContact O-N 2.65Å; L82-G84 VanDerWaalsContact C-N 3.3Å; L82-G84 PolarHBondContact O-N 3.37Å; G84-I87 PolarHBondContact O-N 3.24Å; G84-T88 VanDerWaalsContact O-CB 3.31Å; G84-T88 WeakPolarHBondContact O-CB 3.29Å; G84-T88 PolarHBondContact O-N 3.47Å; G84-T88 PolarHBondContact O-OG1 2.87Å
85	I	94.4	Very high	91	Very high	89 Å²	89	98.8 Å²	98.8	46%	0.456	51%	0.506	S	S	.	.	H	α-helix	trans	-61.2	-48.1	176.2	-68.2	163.7	0	0	0	110.1	A81 L82 I87 T88 E89	A81-I85 VanDerWaalsContact O-CG1 3.28Å; A81-I85 WeakPolarHBondContact O-CG1 2.97Å; A81-I85 PolarHBondContact O-N 3.45Å; L82-I85 PolarHBondContact O-N 3.37Å; I85-I87 PolarHBondContact O-N 2.83Å; I85-T88 WeakPolarHBondContact O-CB 3.4Å; I85-T88 PolarHBondContact O-N 3.37Å; I85-T88 VanDerWaalsContact O-N 3.15Å; I85-E89 HydrophobicContact CG2-CG 4.27Å; I85-E89 WeakPolarHBondContact O-CG 3.45Å; I85-E89 PolarHBondContact O-N 2.54Å
86	T	92.9	Very high	90.7	Very high	76 Å²	76	97.3 Å²	97.3	47%	0.466	50%	0.5	S	S	.	.	H	α-helix	trans	-60.9	-44.4	-179.4	-55.4	0	0	0	0	112.4	L82 I83 T88 E89 L90	L82-T86 PolarHBondContact O-N 3.1Å; L82-T86 PolarHBondContact O-OG1 3.07Å; I83-T86 PolarHBondContact O-N 3.29Å; T86-T88 VanDerWaalsContact C-N 3.3Å; T86-T88 PolarHBondContact O-N 3.47Å; T86-E89 PolarHBondContact O-N 3.48Å; T86-L90 HydrophobicContact CG2-CD1 4.1Å; T86-L90 WeakPolarHBondContact O-CB 3.38Å; T86-L90 VanDerWaalsContact O-CG 3.26Å; T86-L90 WeakPolarHBondContact O-CG 3.33Å; T86-L90 PolarHBondContact O-N 3.26Å
87	I	93.8	Very high	90.1	Very high	109 Å²	109	100.3 Å²	100.3	56%	0.559	51%	0.505	S	S	*	.	H	α-helix	trans	-61.9	-42.7	176.5	-68.2	167.9	0	0	0	110.5	I83 G84 I85 L90 Y91	I83-I87 HydrophobicContact CG2-CD1 3.78Å; I83-I87 HydrophobicContact CG2-CG1 4.48Å; I83-I87 VanDerWaalsContact O-CG1 3.31Å; I83-I87 WeakPolarHBondContact O-CG1 3.3Å; I83-I87 PolarHBondContact O-N 2.83Å; G84-I87 PolarHBondContact O-N 3.24Å; I85-I87 PolarHBondContact O-N 2.83Å; I87-L90 PolarHBondContact O-N 2.7Å; I87-Y91 WeakPolarHBondContact O-CB 3.26Å; I87-Y91 PolarHBondContact O-N 3.09Å
88	T	91.2	Very high	89.6	Confident	69 Å²	69	100.6 Å²	100.6	42%	0.423	50%	0.504	S	S	.	.	H	α-helix	trans	-65.1	-47.5	-178.8	-58.1	0	0	0	0	111.1	G84 I85 T86 L90 Y91 Y92	G84-T88 VanDerWaalsContact O-CB 3.31Å; G84-T88 WeakPolarHBondContact O-CB 3.29Å; G84-T88 PolarHBondContact O-N 3.47Å; G84-T88 PolarHBondContact O-OG1 2.87Å; I85-T88 WeakPolarHBondContact O-CB 3.4Å; I85-T88 PolarHBondContact O-N 3.37Å; I85-T88 VanDerWaalsContact O-N 3.15Å; T86-T88 VanDerWaalsContact C-N 3.3Å; T86-T88 PolarHBondContact O-N 3.47Å; T88-L90 PolarHBondContact O-N 3.02Å; T88-Y91 PolarHBondContact O-N 2.97Å; T88-Y92 HydrophobicContact CG2-CD2 3.6Å; T88-Y92 HydrophobicContact CG2-CE2 3.46Å; T88-Y92 VanDerWaalsContact CG2-CE2 3.46Å; T88-Y92 WeakPolarHBondContact O-CD2 3.36Å; T88-Y92 PolarHBondContact O-N 2.97Å
89	E	89.3	Confident	88.9	Confident	118 Å²	118	104.3 Å²	104.3	55%	0.551	52%	0.519	S	S	*	.	H	α-helix	trans	-62.1	-42	176.6	-74	-175.5	174.3	0	0	112.2	I85 T86 Y91 Y92 N93	I85-E89 HydrophobicContact CG2-CG 4.27Å; I85-E89 WeakPolarHBondContact O-CG 3.45Å; I85-E89 PolarHBondContact O-N 2.54Å; T86-E89 PolarHBondContact O-N 3.48Å; E89-Y91 PolarHBondContact O-N 3.06Å; E89-Y92 PolarHBondContact O-N 2.76Å; E89-N93 VanDerWaalsContact O-CB 3.24Å; E89-N93 WeakPolarHBondContact O-CB 3.5Å; E89-N93 PolarHBondContact O-N 2.89Å; E89-N93 PolarHBondContact O-ND2 3.28Å
90	L	90.4	Very high	88	Confident	115 Å²	115	106.9 Å²	106.9	60%	0.602	53%	0.528	S	S	*	.	H	α-helix	trans	-62.7	-41.9	175.8	-74	173.2	0	0	0	112.1	T86 I87 T88 K94	T86-L90 HydrophobicContact CG2-CD1 4.1Å; T86-L90 WeakPolarHBondContact O-CB 3.38Å; T86-L90 VanDerWaalsContact O-CG 3.26Å; T86-L90 WeakPolarHBondContact O-CG 3.33Å; T86-L90 PolarHBondContact O-N 3.26Å; I87-L90 PolarHBondContact O-N 2.7Å; T88-L90 PolarHBondContact O-N 3.02Å; L90-K94 WeakPolarHBondContact O-CB 3.44Å; L90-K94 PolarHBondContact O-N 3.23Å
91	Y	90.6	Very high	87.1	Confident	131 Å²	131	101.4 Å²	101.4	51%	0.514	52%	0.515	S	S	.	.	H	α-helix	trans	-64.2	-47.1	177	-179.7	-98.5	0	0	0	112	I87 T88 E89 K94 K95	I87-Y91 WeakPolarHBondContact O-CB 3.26Å; I87-Y91 PolarHBondContact O-N 3.09Å; T88-Y91 PolarHBondContact O-N 2.97Å; E89-Y91 PolarHBondContact O-N 3.06Å; Y91-K94 PolarHBondContact O-N 3.26Å; Y91-K95 HydrophobicContact CD1-CD 4.47Å; Y91-K95 HydrophobicContact CE1-CD 3.76Å; Y91-K95 HydrophobicContact CE1-CG 4.38Å; Y91-K95 VanDerWaalsContact CZ-CE 3.49Å; Y91-K95 PolarHBondContact O-N 2.93Å; Y91-K95 WeakPolarHBondContact OH-CE 3.48Å; Y91-K95 PolarHBondContact OH-NZ 3.04Å
92	Y	86.9	Confident	86.1	Confident	139 Å²	139	105 Å²	105	55%	0.545	52%	0.523	S	S	.	.	H	α-helix	trans	-65.7	-38.7	177.4	-81.3	-67	0	0	0	112.4	T88 E89 K95 R96	T88-Y92 HydrophobicContact CG2-CD2 3.6Å; T88-Y92 HydrophobicContact CG2-CE2 3.46Å; T88-Y92 VanDerWaalsContact CG2-CE2 3.46Å; T88-Y92 WeakPolarHBondContact O-CD2 3.36Å; T88-Y92 PolarHBondContact O-N 2.97Å; E89-Y92 PolarHBondContact O-N 2.76Å; Y92-K95 PolarHBondContact O-N 2.93Å; Y92-R96 WeakPolarHBondContact O-CG 3.33Å; Y92-R96 PolarHBondContact O-N 3.01Å
93	N	87.3	Confident	85.1	Confident	86 Å²	86	103 Å²	103	46%	0.46	52%	0.522	S	S	.	.	H	α-helix	trans	-63.9	-39.9	175.3	-77.7	-20.5	0	0	0	112	E89 R96 K97	E89-N93 VanDerWaalsContact O-CB 3.24Å; E89-N93 WeakPolarHBondContact O-CB 3.5Å; E89-N93 PolarHBondContact O-N 2.89Å; E89-N93 PolarHBondContact O-ND2 3.28Å; N93-R96 PolarHBondContact O-N 3.34Å; N93-K97 WeakPolarHBondContact O-CG 3.15Å; N93-K97 PolarHBondContact O-N 3.49Å; N93-K97 VanDerWaalsContact O-N 3.1Å
94	K	85.4	Confident	83.9	Confident	165 Å²	165	106 Å²	106	72%	0.717	54%	0.535	S	S	*	.	H	α-helix	trans	-65.4	-41.8	175.4	-169.1	176.2	-178.4	-178.3	0	111.8	L90 Y91 K97 A98	L90-K94 WeakPolarHBondContact O-CB 3.44Å; L90-K94 PolarHBondContact O-N 3.23Å; Y91-K94 PolarHBondContact O-N 3.26Å; K94-K97 PolarHBondContact O-N 3.49Å; K94-A98 PolarHBondContact O-N 3.14Å; K94-A98 VanDerWaalsContact O-N 3.12Å
95	K	82.3	Confident	82.6	Confident	105 Å²	105	111.9 Å²	111.9	46%	0.457	56%	0.559	S	S	.	*	H	α-helix	trans	-62.9	-43.3	174.6	-87.2	-166.5	166.3	179.7	0	112.7	Y91 Y92 K97 A98 I99	Y91-K95 HydrophobicContact CD1-CD 4.47Å; Y91-K95 HydrophobicContact CE1-CD 3.76Å; Y91-K95 HydrophobicContact CE1-CG 4.38Å; Y91-K95 VanDerWaalsContact CZ-CE 3.49Å; Y91-K95 PolarHBondContact O-N 2.93Å; Y91-K95 WeakPolarHBondContact OH-CE 3.48Å; Y91-K95 PolarHBondContact OH-NZ 3.04Å; Y92-K95 PolarHBondContact O-N 2.93Å; K95-K97 VanDerWaalsContact C-N 3.3Å; K95-K97 PolarHBondContact O-N 3.36Å; K95-A98 PolarHBondContact O-N 3.5Å; K95-I99 WeakPolarHBondContact O-CG1 3.31Å; K95-I99 PolarHBondContact O-N 3.28Å; K95-I99 VanDerWaalsContact O-N 3.08Å
96	R	79.3	Confident	81	Confident	177 Å²	177	117.5 Å²	117.5	67%	0.668	59%	0.589	S	S	*	*	H	α-helix	trans	-58.9	-43.3	176.3	-75.1	-179.9	-175	-137.3	3.7	111.5	Y92 N93 A98 I99 T100	Y92-R96 WeakPolarHBondContact O-CG 3.33Å; Y92-R96 PolarHBondContact O-N 3.01Å; N93-R96 PolarHBondContact O-N 3.34Å; R96-A98 PolarHBondContact O-N 3.48Å; R96-I99 PolarHBondContact O-N 3.16Å; R96-T100 WeakPolarHBondContact O-CG2 3.49Å; R96-T100 PolarHBondContact O-N 3.12Å; R96-T100 PolarHBondContact O-OG1 2.98Å; R96-T100 VanDerWaalsContact O-OG1 3.08Å
97	K	78.7	Confident	80.4	Confident	154 Å²	154	119.6 Å²	119.6	67%	0.67	60%	0.595	S	S	*	*	H	α-helix	trans	-63.4	-37.6	177.4	-72	-178	-179.5	-169.5	0	113.3	N93 K94 K95 T100 S101	N93-K97 WeakPolarHBondContact O-CG 3.15Å; N93-K97 PolarHBondContact O-N 3.49Å; N93-K97 VanDerWaalsContact O-N 3.1Å; K94-K97 PolarHBondContact O-N 3.49Å; K95-K97 VanDerWaalsContact C-N 3.3Å; K95-K97 PolarHBondContact O-N 3.36Å; K97-T100 WeakPolarHBondContact CA-OG1 3.38Å; K97-T100 PolarHBondContact O-OG1 2.87Å; K97-S101 PolarHBondContact O-N 3.45Å; K97-S101 VanDerWaalsContact O-N 3.1Å; K97-S101 PolarHBondContact O-OG 3.48Å
98	A	78	Confident	79.7	Confident	44 Å²	44	120.1 Å²	120.1	36%	0.364	60%	0.597	S	S	.	*	H	α-helix	trans	-68.1	-41.6	177.3	0	0	0	0	0	112.2	K94 K95 R96 S101 E102	K94-A98 PolarHBondContact O-N 3.14Å; K94-A98 VanDerWaalsContact O-N 3.12Å; K95-A98 PolarHBondContact O-N 3.5Å; R96-A98 PolarHBondContact O-N 3.48Å; A98-S101 WeakPolarHBondContact CA-OG 3.45Å; A98-S101 PolarHBondContact O-N 2.91Å; A98-S101 PolarHBondContact O-OG 3.33Å; A98-E102 WeakPolarHBondContact O-CG 3.24Å; A98-E102 PolarHBondContact O-N 3.49Å
99	I	77.3	Confident	79	Confident	110 Å²	110	122.9 Å²	122.9	56%	0.564	61%	0.607	S	S	*	*	H	α-helix	trans	-65.9	-40.5	177.1	-64.1	165.4	0	0	0	110.6	K95 R96 S101 E102 A103	K95-I99 WeakPolarHBondContact O-CG1 3.31Å; K95-I99 PolarHBondContact O-N 3.28Å; K95-I99 VanDerWaalsContact O-N 3.08Å; R96-I99 PolarHBondContact O-N 3.16Å; I99-S101 VanDerWaalsContact C-N 3.35Å; I99-E102 PolarHBondContact O-N 2.94Å; I99-A103 PolarHBondContact O-N 3.35Å; I99-A103 VanDerWaalsContact O-N 3.09Å
100	T	76.7	Confident	78.4	Confident	83 Å²	83	123.2 Å²	123.2	51%	0.509	61%	0.61	S	S	.	*	H	α-helix	trans	-67.7	-33.3	177.8	48.3	0	0	0	0	112.9	R96 K97 E104	R96-T100 WeakPolarHBondContact O-CG2 3.49Å; R96-T100 PolarHBondContact O-N 3.12Å; R96-T100 PolarHBondContact O-OG1 2.98Å; R96-T100 VanDerWaalsContact O-OG1 3.08Å; K97-T100 WeakPolarHBondContact CA-OG1 3.38Å; K97-T100 PolarHBondContact O-OG1 2.87Å; T100-E104 PolarHBondContact O-N 3.3Å
101	S	74.5	Confident	77.7	Confident	58 Å²	58	123.8 Å²	123.8	41%	0.406	61%	0.611	S	S	.	*	H	α-helix	trans	-72.5	-36.4	175.3	54.2	0	0	0	0	112.6	K97 A98 I99 A103 E104 D105	K97-S101 PolarHBondContact O-N 3.45Å; K97-S101 VanDerWaalsContact O-N 3.1Å; K97-S101 PolarHBondContact O-OG 3.48Å; A98-S101 WeakPolarHBondContact CA-OG 3.45Å; A98-S101 PolarHBondContact O-N 2.91Å; A98-S101 PolarHBondContact O-OG 3.33Å; I99-S101 VanDerWaalsContact C-N 3.35Å; S101-A103 VanDerWaalsContact C-N 3.29Å; S101-A103 PolarHBondContact O-N 3Å; S101-E104 PolarHBondContact O-N 3.2Å; S101-D105 PolarHBondContact O-N 3.04Å
102	E	73.3	Confident	76.8	Confident	130 Å²	130	123.3 Å²	123.3	61%	0.607	62%	0.617	S	S	*	*	H	α-helix	trans	-65.1	-35.3	174.2	-74.1	172.5	174.9	0	0	111.4	A98 I99 E104 D105	A98-E102 WeakPolarHBondContact O-CG 3.24Å; A98-E102 PolarHBondContact O-N 3.49Å; I99-E102 PolarHBondContact O-N 2.94Å; E102-E104 VanDerWaalsContact C-N 3.31Å; E102-E104 PolarHBondContact O-N 2.91Å; E102-D105 PolarHBondContact O-N 3.38Å
103	A	74.4	Confident	76.1	Confident	71 Å²	71	122.1 Å²	122.1	59%	0.587	62%	0.622	S	S	*	*	H	α-helix	trans	-75.3	-14.3	176.8	0	0	0	0	0	114.7	I99 S101	I99-A103 PolarHBondContact O-N 3.35Å; I99-A103 VanDerWaalsContact O-N 3.09Å; S101-A103 VanDerWaalsContact C-N 3.29Å; S101-A103 PolarHBondContact O-N 3Å
104	E	69.5	Low	75.2	Confident	167 Å²	167	124.9 Å²	124.9	78%	0.78	64%	0.635	S	S	*	*	H	α-helix	trans	-90.6	-17.9	174.4	-79.6	-179.1	165	0	0	112.7	T100 S101 E102	T100-E104 PolarHBondContact O-N 3.3Å; S101-E104 PolarHBondContact O-N 3.2Å; E102-E104 VanDerWaalsContact C-N 3.31Å; E102-E104 PolarHBondContact O-N 2.91Å
105	D	68.2	Low	74.4	Confident	154 Å²	154	121.6 Å²	121.6	82%	0.824	63%	0.628	S	S	*	*	H	α-helix	trans	-93.2	-8.5	-179.7	-93.2	-24.2	0	0	0	114	S101 E102	S101-D105 PolarHBondContact O-N 3.04Å; E102-D105 PolarHBondContact O-N 3.38Å
106	D	60.5	Low	73.7	Confident	206 Å²	206	123.1 Å²	123.1	100%	1.102	64%	0.644	S	S	*	*			trans	-94.4	0	174.8	-78.6	-21.3	0	0	0	112.8

Retrieved 106 of 106 residues in 28.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).