A0A077ZG27_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZG27, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 114 aa.

						>A0A077ZG27_TRITR|A0A077ZG27
MLTGCDTFVVLPPYTEHGFVIFGKNSDRPSAEVQEIVYIPSAQHEKGSKLLCTYIEIEQVEKTNAVVLSKPAWMWGAEMGANEFGVVVGNEAVWTKLRAGEAATERLLGMDLLR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.4	Low	81.9	Confident	231 Å²	231	96.4 Å²	96.4	100%	1.138	53%	0.527	S	S	*	.				0	127	0	-163.1	176.4	-90.7	0	0	105.7	T3	M1-T3 PolarHBondContact O-N 3.12Å
2	L	55.2	Low	83.1	Confident	139 Å²	139	93.6 Å²	93.6	73%	0.728	52%	0.518	S	S	*	.			trans	-63.2	129.3	173.9	-69.8	166.1	0	0	0	107.2
3	T	68.7	Low	84.1	Confident	136 Å²	136	95.1 Å²	95.1	83%	0.834	53%	0.534	S	S	*	.			trans	-103.3	102	-178.8	53.3	0	0	0	0	108.4	M1	M1-T3 PolarHBondContact O-N 3.12Å
4	G	75.4	Confident	85	Confident	21 Å²	21	102.2 Å²	102.2	22%	0.216	55%	0.551	C	S	.	*	S	Bend	trans	102.9	159.4	177.9	0	0	0	0	0	113.6	D27	G4-D27 WeakPolarHBondContact CA-OD2 3.31Å; G4-D27 WeakPolarHBondContact O-CB 3.33Å
5	C	83.7	Confident	85.8	Confident	8 Å²	8	96.5 Å²	96.5	5%	0.054	52%	0.521	C	S	.	.			trans	-89.7	161.2	172.2	35.5	0	0	0	0	110.6	K24 N25 D27 E91 A92	C5-K24 VanDerWaalsContact CB-NZ 3.29Å; C5-K24 PolarHBondContact SG-NZ 2.62Å; C5-N25 WeakPolarHBondContact CB-O 3.33Å; C5-D27 HydrophobicContact CB-CB 4.34Å; C5-E91 VanDerWaalsContact O-OE1 3.08Å; C5-E91 PolarHBondContact SG-OE1 3.23Å; C5-E91 PolarHBondContact SG-OE2 3.31Å; C5-E91 VanDerWaalsContact SG-OE2 3.38Å; C5-A92 PolarHBondContact SG-N 3.18Å
6	D	88.7	Confident	86.4	Confident	115 Å²	115	101.8 Å²	101.8	62%	0.615	54%	0.541	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-131	140.5	175.5	-73.8	-65.3	0	0	0	108.4	K24 N25	D6-K24 CarbonylContact O-C 3.57Å; D6-K24 WeakPolarHBondContact O-CA 3.46Å; D6-N25 PolarHBondContact N-O 2.94Å; D6-N25 PolarHBondContact O-N 3.36Å
7	T	92.5	Very high	86.9	Confident	69 Å²	69	103.6 Å²	103.6	42%	0.423	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	133.8	174.9	-59.8	0	0	0	0	109.1	F22 G23 E91	T7-F22 HydrophobicContact CG2-CD2 4.32Å; T7-F22 HydrophobicContact CG2-CE2 3.57Å; T7-F22 HydrophobicContact CG2-CZ 4.24Å; T7-G23 WeakPolarHBondContact CA-O 3.44Å; T7-E91 PolarHBondContact OG1-OE2 3.11Å
8	F	94.7	Very high	87.3	Confident	117 Å²	117	100.3 Å²	100.3	51%	0.513	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	152.7	171.8	78.8	-90.8	0	0	0	111.4	V10 I21 G23	F8-V10 HydrophobicContact CD2-CG2 4.23Å; F8-V10 HydrophobicContact CE2-CG2 4.34Å; F8-I21 HydrophobicContact CE2-CG2 3.85Å; F8-I21 HydrophobicContact CZ-CG2 4.3Å; F8-G23 PolarHBondContact N-O 2.83Å; F8-G23 PolarHBondContact O-N 2.91Å
9	V	96.2	Very high	87.7	Confident	84 Å²	84	102.3 Å²	102.3	51%	0.509	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	136.6	174.3	64.6	0	0	0	0	109.8	L11 V20 I21	V9-L11 HydrophobicContact CG2-CD2 3.61Å; V9-L11 HydrophobicContact CG2-CG 4.1Å; V9-V20 HydrophobicContact CG2-CG1 3.87Å; V9-I21 CarbonylContact C-O 3.55Å; V9-I21 VanDerWaalsContact CA-O 3.28Å; V9-I21 WeakPolarHBondContact CA-O 3.28Å
10	V	97.4	Very high	88.1	Confident	46 Å²	46	101.2 Å²	101.2	28%	0.279	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	120.9	168	-168.2	0	0	0	0	107.5	F8 T15 I21	F8-V10 HydrophobicContact CD2-CG2 4.23Å; F8-V10 HydrophobicContact CE2-CG2 4.34Å; V10-T15 HydrophobicContact CB-CG2 4Å; V10-T15 HydrophobicContact CG1-CG2 3.59Å; V10-I21 HydrophobicContact CB-CB 4.15Å; V10-I21 HydrophobicContact CG2-CB 4.45Å; V10-I21 PolarHBondContact N-O 2.89Å; V10-I21 PolarHBondContact O-N 2.86Å
11	L	96.3	Very high	88.4	Confident	94 Å²	94	100.4 Å²	100.4	49%	0.492	54%	0.536	S	S	.	.			trans	-102.3	156.9	-178	-59.8	176.7	0	0	0	110.5	V9 Y14 V20	V9-L11 HydrophobicContact CG2-CD2 3.61Å; V9-L11 HydrophobicContact CG2-CG 4.1Å; L11-Y14 WeakPolarHBondContact O-CB 3.19Å; L11-Y14 WeakPolarHBondContact O-CD2 3.29Å; L11-Y14 PolarHBondContact O-N 2.95Å; L11-V20 HydrophobicContact CD2-CG1 4.04Å; L11-V20 HydrophobicContact CD2-CG2 3.97Å
12	P	96.5	Very high	90.5	Very high	63 Å²	63	92.1 Å²	92.1	41%	0.409	49%	0.494	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54	146.3	163.9	-25.6	36.5	0	0	0	111.6	Y14 G18	P12-Y14 VanDerWaalsContact C-N 3.33Å; P12-G18 VanDerWaalsContact CG-O 3.23Å; P12-G18 WeakPolarHBondContact CG-O 3.23Å
13	P	95.7	Very high	92.4	Very high	113 Å²	113	86.2 Å²	86.2	73%	0.734	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	cis	-87.3	12.7	2.8	37.5	-36.9	0	0	0	113.8	T15	P13-T15 PolarHBondContact O-N 2.95Å; P13-T15 VanDerWaalsContact O-N 3.11Å
14	Y	97.2	Very high	93.6	Very high	195 Å²	195	80.9 Å²	80.9	77%	0.765	43%	0.432	S	S	*	.	S	Bend	trans	-79	12.7	-174.2	-53.4	-73.7	0	0	0	114.2	L11 P12	L11-Y14 WeakPolarHBondContact O-CB 3.19Å; L11-Y14 WeakPolarHBondContact O-CD2 3.29Å; L11-Y14 PolarHBondContact O-N 2.95Å; P12-Y14 VanDerWaalsContact C-N 3.33Å
15	T	97	Very high	94.3	Very high	16 Å²	16	83.5 Å²	83.5	10%	0.098	44%	0.441	C	S	.	.	S	Bend	trans	-126.4	137	177.2	60.5	0	0	0	0	109.5	V10 P13 H17 G18 F19 I21	V10-T15 HydrophobicContact CB-CG2 4Å; V10-T15 HydrophobicContact CG1-CG2 3.59Å; P13-T15 PolarHBondContact O-N 2.95Å; P13-T15 VanDerWaalsContact O-N 3.11Å; T15-H17 PolarHBondContact O-N 2.86Å; T15-H17 VanDerWaalsContact O-N 3.12Å; T15-G18 PolarHBondContact O-N 2.85Å; T15-F19 VanDerWaalsContact CB-O 3.29Å; T15-F19 WeakPolarHBondContact CB-O 3.4Å; T15-F19 WeakPolarHBondContact CG2-O 3.35Å; T15-F19 PolarHBondContact OG1-N 3.05Å; T15-F19 PolarHBondContact OG1-O 2.87Å; T15-I21 HydrophobicContact CG2-CD1 3.91Å; T15-I21 HydrophobicContact CG2-CG1 4.04Å
16	E	94.8	Very high	94.5	Very high	182 Å²	182	84.6 Å²	84.6	85%	0.85	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-31.9	-169.7	-173.5	174.5	-178.8	0	0	114.1
17	H	95.2	Very high	94.3	Very high	132 Å²	132	82.1 Å²	82.1	61%	0.611	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.7	14.2	-176.4	-58.7	-42.5	0	0	0	113.5	T15 F19	T15-H17 PolarHBondContact O-N 2.86Å; T15-H17 VanDerWaalsContact O-N 3.12Å; H17-F19 HydrophobicContact CB-CD2 3.55Å; H17-F19 HydrophobicContact CB-CE2 3.38Å; H17-F19 HydrophobicContact CB-CG 4.49Å; H17-F19 HydrophobicContact CB-CZ 4.21Å; H17-F19 PolarHBondContact O-N 2.9Å
18	G	94.5	Very high	94.2	Very high	45 Å²	45	82.4 Å²	82.4	46%	0.464	43%	0.428	S	S	.	.	S	Bend	trans	68.5	19.8	-179.7	0	0	0	0	0	114.5	P12 T15	P12-G18 VanDerWaalsContact CG-O 3.23Å; P12-G18 WeakPolarHBondContact CG-O 3.23Å; T15-G18 PolarHBondContact O-N 2.85Å
19	F	94.2	Very high	94	Very high	137 Å²	137	80.7 Å²	80.7	60%	0.601	43%	0.429	S	S	*	.	P	Polyproline II helix	trans	-81.2	155.6	172	-61.3	-55	0	0	0	111.7	T15 H17	T15-F19 VanDerWaalsContact CB-O 3.29Å; T15-F19 WeakPolarHBondContact CB-O 3.4Å; T15-F19 WeakPolarHBondContact CG2-O 3.35Å; T15-F19 PolarHBondContact OG1-N 3.05Å; T15-F19 PolarHBondContact OG1-O 2.87Å; H17-F19 HydrophobicContact CB-CD2 3.55Å; H17-F19 HydrophobicContact CB-CE2 3.38Å; H17-F19 HydrophobicContact CB-CG 4.49Å; H17-F19 HydrophobicContact CB-CZ 4.21Å; H17-F19 PolarHBondContact O-N 2.9Å
20	V	94.9	Very high	93.6	Very high	81 Å²	81	83 Å²	83	49%	0.491	45%	0.449	S	S	.	.	P	Polyproline II helix	trans	-85	128.2	164.2	174.3	0	0	0	0	108.1	V9 L11	V9-V20 HydrophobicContact CG2-CG1 3.87Å; L11-V20 HydrophobicContact CD2-CG1 4.04Å; L11-V20 HydrophobicContact CD2-CG2 3.97Å
21	I	95.6	Very high	93.4	Very high	84 Å²	84	85.3 Å²	85.3	43%	0.431	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	121.2	168.8	-58.9	171.5	0	0	0	107	F8 V9 V10 T15	F8-I21 HydrophobicContact CE2-CG2 3.85Å; F8-I21 HydrophobicContact CZ-CG2 4.3Å; V9-I21 CarbonylContact C-O 3.55Å; V9-I21 VanDerWaalsContact CA-O 3.28Å; V9-I21 WeakPolarHBondContact CA-O 3.28Å; V10-I21 HydrophobicContact CB-CB 4.15Å; V10-I21 HydrophobicContact CG2-CB 4.45Å; V10-I21 PolarHBondContact N-O 2.89Å; V10-I21 PolarHBondContact O-N 2.86Å; T15-I21 HydrophobicContact CG2-CD1 3.91Å; T15-I21 HydrophobicContact CG2-CG1 4.04Å
22	F	96.4	Very high	93.2	Very high	58 Å²	58	83 Å²	83	25%	0.254	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	132.9	173.1	170.5	-97.6	0	0	0	108.9	T7 K24 M79 V87	T7-F22 HydrophobicContact CG2-CD2 4.32Å; T7-F22 HydrophobicContact CG2-CE2 3.57Å; T7-F22 HydrophobicContact CG2-CZ 4.24Å; F22-K24 HydrophobicContact CE1-CB 4.19Å; F22-K24 HydrophobicContact CZ-CB 3.94Å; F22-M79 HydrophobicContact CE1-CB 4.19Å; F22-V87 HydrophobicContact CB-CB 4.26Å; F22-V87 HydrophobicContact CB-CG1 4.38Å; F22-V87 HydrophobicContact CB-CG2 3.81Å; F22-V87 HydrophobicContact CD1-CB 4.09Å; F22-V87 HydrophobicContact CD1-CG2 4.36Å; F22-V87 HydrophobicContact CD2-CB 4.44Å; F22-V87 HydrophobicContact CD2-CG2 3.91Å; F22-V87 HydrophobicContact CG-CB 4.01Å; F22-V87 HydrophobicContact CG-CG2 3.77Å
23	G	94.9	Very high	93.2	Very high	15 Å²	15	84.3 Å²	84.3	16%	0.155	47%	0.467	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	138.3	173.2	0	0	0	0	0	110.4	T7 F8	T7-G23 WeakPolarHBondContact CA-O 3.44Å; F8-G23 PolarHBondContact N-O 2.83Å; F8-G23 PolarHBondContact O-N 2.91Å
24	K	93.1	Very high	93.2	Very high	23 Å²	23	82.1 Å²	82.1	10%	0.1	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	133.6	173.9	174.9	171.4	172.5	65.4	0	109.3	C5 D6 F22 E78 M79 N90 E91	C5-K24 VanDerWaalsContact CB-NZ 3.29Å; C5-K24 PolarHBondContact SG-NZ 2.62Å; D6-K24 CarbonylContact O-C 3.57Å; D6-K24 WeakPolarHBondContact O-CA 3.46Å; F22-K24 HydrophobicContact CE1-CB 4.19Å; F22-K24 HydrophobicContact CZ-CB 3.94Å; K24-E78 WeakPolarHBondContact CE-O 3.3Å; K24-M79 HydrophobicContact CB-CE 3.68Å; K24-M79 HydrophobicContact CB-SD 3.89Å; K24-M79 HydrophobicContact CD-CB 4.27Å; K24-M79 HydrophobicContact CD-CE 3.95Å; K24-M79 HydrophobicContact CG-CE 3.61Å; K24-M79 HydrophobicContact CG-SD 4.46Å; K24-M79 WeakPolarHBondContact O-CE 3.47Å; K24-N90 WeakPolarHBondContact CE-O 3.46Å; K24-N90 PolarHBondContact NZ-O 2.53Å; K24-E91 IonicContact NZ-OE2 2.92Å; K24-E91 PolarHBondContact NZ-OE2 3.34Å
25	N	90.6	Very high	93.1	Very high	77 Å²	77	76.4 Å²	76.4	41%	0.412	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	137.9	166.4	-173.5	44.5	0	0	0	109.3	C5 D6	C5-N25 WeakPolarHBondContact CB-O 3.33Å; D6-N25 PolarHBondContact N-O 2.94Å; D6-N25 PolarHBondContact O-N 3.36Å
26	S	87.3	Confident	93.2	Very high	30 Å²	30	81.5 Å²	81.5	21%	0.21	45%	0.452	C	S	.	.			trans	-95.9	137	179.6	-170.3	0	0	0	0	109.6	R28 E78	S26-R28 VanDerWaalsContact C-N 3.31Å; S26-R28 WeakPolarHBondContact OG-CG 3.26Å; S26-E78 WeakPolarHBondContact CB-OE2 3.36Å; S26-E78 PolarHBondContact OG-OE2 3.34Å
27	D	85.9	Confident	93.3	Very high	63 Å²	63	74.6 Å²	74.6	34%	0.337	42%	0.422	S	S	.	.			trans	-96.5	13.3	176.9	68.3	-23.2	0	0	0	112.8	G4 C5	G4-D27 WeakPolarHBondContact CA-OD2 3.31Å; G4-D27 WeakPolarHBondContact O-CB 3.33Å; C5-D27 HydrophobicContact CB-CB 4.34Å
28	R	89.5	Confident	93.5	Very high	75 Å²	75	75.5 Å²	75.5	28%	0.283	42%	0.421	S	S	.	.	S	Bend	trans	-62.5	152.7	178.6	-60.4	-64	-56.7	172.6	5	111.1	S26 S30 E32 E78	S26-R28 VanDerWaalsContact C-N 3.31Å; S26-R28 WeakPolarHBondContact OG-CG 3.26Å; R28-S30 PolarHBondContact O-N 2.79Å; R28-E32 IonicContact CZ-OE1 3.8Å; R28-E32 IonicContact CZ-OE2 3.25Å; R28-E32 VanDerWaalsContact CZ-OE2 3.25Å; R28-E32 IonicContact NE-OE1 3.98Å; R28-E32 IonicContact NE-OE2 2.7Å; R28-E32 PolarHBondContact NE-OE2 3.01Å; R28-E32 VanDerWaalsContact NH2-CD 3.28Å; R28-E32 IonicContact NH2-OE1 2.77Å; R28-E32 PolarHBondContact NH2-OE1 2.96Å; R28-E32 IonicContact NH2-OE2 2.97Å; R28-E32 PolarHBondContact NH2-OE2 3.3Å; R28-E78 HydrophobicContact CG-CG 4.08Å
29	P	90.3	Very high	93.7	Very high	81 Å²	81	75.3 Å²	75.3	53%	0.526	41%	0.409	S	S	.	.			trans	-55.3	136	-179.9	-25.3	34.8	0	0	0	112.1	A31 E32	P29-A31 PolarHBondContact O-N 2.85Å; P29-E32 HydrophobicContact CB-CB 4.35Å; P29-E32 VanDerWaalsContact O-CB 3.23Å; P29-E32 WeakPolarHBondContact O-CB 3.4Å; P29-E32 PolarHBondContact O-N 2.88Å
30	S	88.3	Confident	93.9	Very high	133 Å²	133	72.2 Å²	72.2	93%	0.93	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.2	-19.5	-174.9	63.1	0	0	0	0	115	R28	R28-S30 PolarHBondContact O-N 2.79Å
31	A	92.5	Very high	94	Very high	95 Å²	95	71.1 Å²	71.1	79%	0.785	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.1	-7.5	175.9	0	0	0	0	0	112.8	P29	P29-A31 PolarHBondContact O-N 2.85Å
32	E	93.5	Very high	94.2	Very high	46 Å²	46	68.8 Å²	68.8	22%	0.215	39%	0.392	C	S	.	.	S	Bend	trans	-77.3	128.5	176.2	-169.3	171.8	-105.8	0	0	109.6	R28 P29 Q34 P71 W73	R28-E32 IonicContact CZ-OE1 3.8Å; R28-E32 IonicContact CZ-OE2 3.25Å; R28-E32 VanDerWaalsContact CZ-OE2 3.25Å; R28-E32 IonicContact NE-OE1 3.98Å; R28-E32 IonicContact NE-OE2 2.7Å; R28-E32 PolarHBondContact NE-OE2 3.01Å; R28-E32 VanDerWaalsContact NH2-CD 3.28Å; R28-E32 IonicContact NH2-OE1 2.77Å; R28-E32 PolarHBondContact NH2-OE1 2.96Å; R28-E32 IonicContact NH2-OE2 2.97Å; R28-E32 PolarHBondContact NH2-OE2 3.3Å; P29-E32 HydrophobicContact CB-CB 4.35Å; P29-E32 VanDerWaalsContact O-CB 3.23Å; P29-E32 WeakPolarHBondContact O-CB 3.4Å; P29-E32 PolarHBondContact O-N 2.88Å; E32-Q34 PolarHBondContact O-N 2.95Å; E32-P71 HydrophobicContact CG-CB 4.22Å; E32-W73 PolarHBondContact OE1-NE1 3.1Å
33	V	96	Very high	94.3	Very high	90 Å²	90	74.2 Å²	74.2	55%	0.545	42%	0.418	S	S	.	.	P	Polyproline II helix	trans	-71.5	124.1	179	176.1	0	0	0	0	109.2	E35 P71 A72	V33-E35 HydrophobicContact CG1-CG 4.2Å; V33-P71 CarbonylContact O-C 3.55Å; V33-P71 WeakPolarHBondContact O-CA 3.26Å; V33-A72 HydrophobicContact CB-CB 3.91Å; V33-A72 HydrophobicContact CG1-CB 4Å; V33-A72 PolarHBondContact O-N 3.45Å
34	Q	94.6	Very high	94.4	Very high	66 Å²	66	76.4 Å²	76.4	31%	0.308	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	118.5	171.8	-166.7	76.6	4.1	0	0	109.5	E32 S69 K70	E32-Q34 PolarHBondContact O-N 2.95Å; Q34-S69 WeakPolarHBondContact CG-OG 2.84Å; Q34-S69 PolarHBondContact NE2-O 3.1Å; Q34-S69 PolarHBondContact NE2-OG 3.25Å; Q34-K70 CarbonylContact C-O 3.56Å; Q34-K70 WeakPolarHBondContact CA-O 3.14Å
35	E	96.6	Very high	94.6	Very high	75 Å²	75	83 Å²	83	35%	0.35	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	144.2	179.9	-58.3	177.7	135.7	0	0	110.7	V33 V37 S69 K70 A72	V33-E35 HydrophobicContact CG1-CG 4.2Å; E35-V37 HydrophobicContact CB-CG1 3.97Å; E35-S69 CarbonylContact O-C 3.59Å; E35-S69 VanDerWaalsContact O-CA 3.3Å; E35-S69 WeakPolarHBondContact O-CA 3.48Å; E35-K70 HydrophobicContact CB-CG 4.36Å; E35-K70 PolarHBondContact N-O 3.07Å; E35-K70 PolarHBondContact O-N 2.93Å; E35-K70 IonicContact OE2-NZ 2.9Å; E35-K70 PolarHBondContact OE2-NZ 3.47Å; E35-A72 HydrophobicContact CG-CB 4.02Å; E35-A72 WeakPolarHBondContact OE2-CA 3.34Å
36	I	97.6	Very high	94.9	Very high	123 Å²	123	87.9 Å²	87.9	63%	0.631	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.8	115.3	163.7	-54.4	-57.3	0	0	0	107.8	V67 L68	I36-V67 HydrophobicContact CG2-CG1 4.02Å; I36-L68 CarbonylContact C-O 3.59Å; I36-L68 WeakPolarHBondContact CA-O 3.3Å
37	V	98.2	Very high	95.4	Very high	37 Å²	37	89.1 Å²	89.1	22%	0.224	49%	0.491	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	140.4	-176.3	-58.5	0	0	0	0	110.8	E35 I39 V67 L68 K70	E35-V37 HydrophobicContact CB-CG1 3.97Å; V37-I39 HydrophobicContact CG2-CD1 4.26Å; V37-I39 HydrophobicContact CG2-CG1 4.23Å; V37-V67 CarbonylContact O-C 3.6Å; V37-V67 WeakPolarHBondContact O-CA 3.23Å; V37-L68 HydrophobicContact CG2-CB 3.91Å; V37-L68 PolarHBondContact N-O 2.89Å; V37-L68 PolarHBondContact O-N 2.97Å; V37-K70 HydrophobicContact CG2-CD 3.87Å; V37-K70 HydrophobicContact CG2-CG 4.19Å
38	Y	98.5	Very high	95.9	Very high	151 Å²	151	87.7 Å²	87.7	59%	0.592	49%	0.486	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.1	132.7	164.6	170.9	-108	0	0	0	108.9	P40 A65 V66 V67	Y38-P40 HydrophobicContact CE1-CB 4Å; Y38-A65 HydrophobicContact CE2-CB 4Å; Y38-V66 WeakPolarHBondContact CA-O 3.11Å; Y38-V66 WeakPolarHBondContact CD2-O 3.44Å; Y38-V67 HydrophobicContact CD2-CG2 3.92Å
39	I	98.2	Very high	96.3	Very high	41 Å²	41	88.9 Å²	88.9	21%	0.21	49%	0.493	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	117.9	176.2	-54.9	179.2	0	0	0	106.6	V37 A65 V66 L68 R114	V37-I39 HydrophobicContact CG2-CD1 4.26Å; V37-I39 HydrophobicContact CG2-CG1 4.23Å; I39-A65 CarbonylContact O-C 3.54Å; I39-A65 VanDerWaalsContact O-CA 3.26Å; I39-A65 WeakPolarHBondContact O-CA 3.35Å; I39-V66 HydrophobicContact CB-CG2 3.82Å; I39-V66 HydrophobicContact CD1-CG2 4.35Å; I39-V66 HydrophobicContact CG1-CG2 4.37Å; I39-V66 PolarHBondContact N-O 3.5Å; I39-V66 PolarHBondContact O-N 3.19Å; I39-L68 HydrophobicContact CD1-CD1 3.77Å; I39-R114 VanDerWaalsContact CD1-NH1 3.26Å; I39-R114 VanDerWaalsContact CD1-NH2 3.31Å
40	P	98.6	Very high	96.7	Very high	73 Å²	73	86.6 Å²	86.6	47%	0.474	48%	0.476	S	S	.	.			trans	-68.4	158.8	179.1	30.1	-35	0	0	0	110.7	Y38	Y38-P40 HydrophobicContact CE1-CB 4Å
41	S	98.5	Very high	97.1	Very high	58 Å²	58	85.6 Å²	85.6	41%	0.406	46%	0.46	S	S	.	.			trans	-60.1	144	167.5	48.7	0	0	0	0	109.7	T63	S41-T63 VanDerWaalsContact CA-O 3.29Å; S41-T63 WeakPolarHBondContact CA-O 3.41Å; S41-T63 WeakPolarHBondContact CB-O 3.49Å
42	A	98.2	Very high	97.4	Very high	35 Å²	35	81.4 Å²	81.4	29%	0.289	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.9	155.6	-179	0	0	0	0	0	111.2	K62 T63	A42-K62 WeakPolarHBondContact O-CA 3.39Å; A42-T63 PolarHBondContact N-O 3.02Å; A42-T63 PolarHBondContact N-OG1 2.87Å; A42-T63 PolarHBondContact O-N 3.49Å; A42-T63 PolarHBondContact O-OG1 3.18Å
43	Q	98.5	Very high	97.5	Very high	172 Å²	172	80.3 Å²	80.3	80%	0.804	42%	0.421	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.3	140.4	164.1	-66	-176.7	11.6	0	0	108.2	E61	Q43-E61 CarbonylContact C-O 3.59Å; Q43-E61 WeakPolarHBondContact CA-O 3.28Å
44	H	98	Very high	97.5	Very high	61 Å²	61	83.5 Å²	83.5	28%	0.282	43%	0.425	S	S	.	.			trans	-121.5	149.7	-178.4	-59.4	-73.4	0	0	0	110.3	Q59 V60 E61 T63	H44-Q59 HydrophobicContact CB-CG 3.47Å; H44-Q59 VanDerWaalsContact CB-CG 3.47Å; H44-Q59 VanDerWaalsContact CG-CG 3.48Å; H44-V60 WeakPolarHBondContact CB-O 3.41Å; H44-V60 PolarHBondContact CD2-O 3.29Å; H44-E61 PolarHBondContact N-O 2.83Å; H44-T63 PolarHBondContact NE2-OG1 3.21Å
45	E	97.9	Very high	97.6	Very high	161 Å²	161	81.5 Å²	81.5	75%	0.752	42%	0.416	S	S	*	.			trans	-62.9	139.7	177.9	-65.3	-179.4	175.9	0	0	110.6	G47 S48	E45-G47 PolarHBondContact O-N 2.9Å; E45-S48 WeakPolarHBondContact O-CB 3.47Å; E45-S48 PolarHBondContact O-N 2.86Å; E45-S48 PolarHBondContact O-OG 3.05Å
46	K	96.6	Very high	97.7	Very high	179 Å²	179	83.4 Å²	83.4	78%	0.778	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.3	127.6	178.8	-175.4	174.5	-175.2	171.3	0	110.7	S48	K46-S48 PolarHBondContact O-N 3.18Å
47	G	96.4	Very high	97.6	Very high	57 Å²	57	80 Å²	80	59%	0.588	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	7.9	-177.1	0	0	0	0	0	114	E45	E45-G47 PolarHBondContact O-N 2.9Å
48	S	97.8	Very high	97.6	Very high	32 Å²	32	83.9 Å²	83.9	22%	0.224	42%	0.423	C	S	.	.			trans	-66	158.7	167.7	62.9	0	0	0	0	110.9	E45 K46 Q59	E45-S48 WeakPolarHBondContact O-CB 3.47Å; E45-S48 PolarHBondContact O-N 2.86Å; E45-S48 PolarHBondContact O-OG 3.05Å; K46-S48 PolarHBondContact O-N 3.18Å; S48-Q59 VanDerWaalsContact O-CB 3.29Å; S48-Q59 WeakPolarHBondContact O-CB 3.21Å; S48-Q59 PolarHBondContact O-N 2.88Å; S48-Q59 WeakPolarHBondContact OG-CB 3.35Å
49	K	98.1	Very high	97.6	Very high	100 Å²	100	78 Å²	78	44%	0.435	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	155	-178.7	-66.2	-71	-167.5	160.8	0	110.6	E56 I57 E58	K49-E56 HydrophobicContact CB-CG 3.68Å; K49-E56 VanDerWaalsContact CB-OE1 3.23Å; K49-E56 WeakPolarHBondContact CB-OE1 3.37Å; K49-E56 HydrophobicContact CD-CG 4.31Å; K49-E56 HydrophobicContact CG-CG 4.36Å; K49-E56 VanDerWaalsContact CG-OE1 3.27Å; K49-E56 WeakPolarHBondContact CG-OE1 3.32Å; K49-I57 WeakPolarHBondContact CA-O 3.46Å; K49-E58 WeakPolarHBondContact CE-OE1 2.78Å; K49-E58 VanDerWaalsContact NZ-CD 3.29Å; K49-E58 IonicContact NZ-OE1 2.59Å; K49-E58 PolarHBondContact NZ-OE1 2.68Å; K49-E58 IonicContact NZ-OE2 3.64Å
50	L	97.4	Very high	97.5	Very high	34 Å²	34	80.2 Å²	80.2	18%	0.178	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	118.9	-179.7	175.5	62.1	0	0	0	109.9	C52 E56 I57 Q59 W75	L50-C52 PolarHBondContact O-N 3.32Å; L50-E56 WeakPolarHBondContact O-CA 3.37Å; L50-I57 HydrophobicContact CB-CG1 4.37Å; L50-I57 PolarHBondContact N-O 2.64Å; L50-I57 PolarHBondContact O-N 3.4Å; L50-Q59 HydrophobicContact CB-CB 4.1Å; L50-W75 HydrophobicContact CD1-CZ2 4.32Å; L50-W75 HydrophobicContact CD2-CH2 3.92Å; L50-W75 HydrophobicContact CD2-CZ2 3.26Å; L50-W75 HydrophobicContact CG-CZ2 3.96Å
51	L	97.9	Very high	97.5	Very high	111 Å²	111	82.4 Å²	82.4	58%	0.581	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76	117.5	168.5	-177.2	61.9	0	0	0	109.3
52	C	97.4	Very high	97.5	Very high	7 Å²	7	85.7 Å²	85.7	5%	0.047	43%	0.427	C	S	.	.			trans	-84.1	-143.1	170.6	-62.4	0	0	0	0	109.7	L50 I55 W75 L107	L50-C52 PolarHBondContact O-N 3.32Å; C52-I55 WeakPolarHBondContact CB-O 3.18Å; C52-I55 PolarHBondContact N-O 3.35Å; C52-W75 HydrophobicContact CB-CD2 3.94Å; C52-W75 HydrophobicContact CB-CE3 3.61Å; C52-W75 HydrophobicContact CB-CG 4.36Å; C52-W75 HydrophobicContact CB-CZ3 4.01Å; C52-W75 WeakPolarHBondContact SG-CZ3 3.36Å; C52-L107 HydrophobicContact CB-CD2 3.9Å
53	T	97.2	Very high	97.5	Very high	24 Å²	24	85.9 Å²	85.9	15%	0.147	43%	0.425	C	S	.	.	S	Bend	trans	-70.1	-44.5	-178.6	-61.7	0	0	0	0	112.6	W73 M74 W75 L108 D111	T53-W73 HydrophobicContact CG2-CE3 4.14Å; T53-W73 HydrophobicContact CG2-CH2 4.39Å; T53-W73 HydrophobicContact CG2-CZ3 3.49Å; T53-W73 VanDerWaalsContact CG2-CZ3 3.49Å; T53-M74 HydrophobicContact CG2-CE 4.42Å; T53-M74 HydrophobicContact CG2-CG 4.03Å; T53-M74 WeakPolarHBondContact OG1-CG 3.4Å; T53-W75 PolarHBondContact OG1-N 3.1Å; T53-W75 VanDerWaalsContact OG1-N 3.17Å; T53-L108 HydrophobicContact CG2-CD1 3.89Å; T53-D111 VanDerWaalsContact CB-OD1 3.3Å; T53-D111 WeakPolarHBondContact CB-OD1 3.19Å; T53-D111 PolarHBondContact N-OD1 3.06Å; T53-D111 PolarHBondContact OG1-OD1 2.88Å
54	Y	96.3	Very high	97.5	Very high	157 Å²	157	80.7 Å²	80.7	62%	0.616	40%	0.402	S	S	*	.	S	Bend	trans	-131.8	-14.2	-178.6	-61.6	-56.8	0	0	0	114.3	W73 L108	Y54-W73 HydrophobicContact CE2-CZ3 4.36Å; Y54-W73 AromaticContact CZ-CZ3 3.84Å; Y54-W73 WeakPolarHBondContact OH-CZ3 3.29Å; Y54-L108 HydrophobicContact CD2-CD1 4.04Å; Y54-L108 HydrophobicContact CD2-CG 4.48Å; Y54-L108 HydrophobicContact CE2-CD1 3.85Å
55	I	96.3	Very high	97.5	Very high	23 Å²	23	78.1 Å²	78.1	12%	0.118	39%	0.391	C	S	.	.			trans	-135.1	154.9	-168.1	76.9	169.6	0	0	0	110.2	C52 I57 E105 L107	C52-I55 WeakPolarHBondContact CB-O 3.18Å; C52-I55 PolarHBondContact N-O 3.35Å; I55-I57 HydrophobicContact CD1-CG2 4.47Å; I55-I57 HydrophobicContact CG1-CG2 4.47Å; I55-E105 HydrophobicContact CB-CG 4.33Å; I55-E105 HydrophobicContact CD1-CG 4.45Å; I55-E105 HydrophobicContact CG2-CG 3.34Å; I55-E105 VanDerWaalsContact CG2-OE1 3.29Å; I55-E105 WeakPolarHBondContact CG2-OE1 3.46Å; I55-L107 HydrophobicContact CD1-CD2 3.77Å; I55-L107 HydrophobicContact CD1-CG 4.03Å; I55-L107 HydrophobicContact CG1-CD2 3.75Å
56	E	97.4	Very high	97.5	Very high	115 Å²	115	71 Å²	71	54%	0.537	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	133.9	179	-169.6	176.7	92.9	0	0	111.1	K49 L50	K49-E56 HydrophobicContact CB-CG 3.68Å; K49-E56 VanDerWaalsContact CB-OE1 3.23Å; K49-E56 WeakPolarHBondContact CB-OE1 3.37Å; K49-E56 HydrophobicContact CD-CG 4.31Å; K49-E56 HydrophobicContact CG-CG 4.36Å; K49-E56 VanDerWaalsContact CG-OE1 3.27Å; K49-E56 WeakPolarHBondContact CG-OE1 3.32Å; L50-E56 WeakPolarHBondContact O-CA 3.37Å
57	I	96.9	Very high	97.6	Very high	53 Å²	53	65.9 Å²	65.9	27%	0.272	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	166.6	177	67.4	171.6	0	0	0	111.4	K49 L50 I55 Q59 L107	K49-I57 WeakPolarHBondContact CA-O 3.46Å; L50-I57 HydrophobicContact CB-CG1 4.37Å; L50-I57 PolarHBondContact N-O 2.64Å; L50-I57 PolarHBondContact O-N 3.4Å; I55-I57 HydrophobicContact CD1-CG2 4.47Å; I55-I57 HydrophobicContact CG1-CG2 4.47Å; I57-Q59 PolarHBondContact O-N 3.14Å; I57-L107 HydrophobicContact CD1-CD1 4.42Å; I57-L107 HydrophobicContact CG2-CD1 4.37Å; I57-L107 HydrophobicContact CG2-CD2 3.92Å; I57-L107 HydrophobicContact CG2-CG 4.36Å
58	E	97.7	Very high	97.7	Very high	117 Å²	117	63.4 Å²	63.4	55%	0.547	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.2	127.1	167.4	-59.2	-59.9	157.2	0	0	109.8	K49	K49-E58 WeakPolarHBondContact CE-OE1 2.78Å; K49-E58 VanDerWaalsContact NZ-CD 3.29Å; K49-E58 IonicContact NZ-OE1 2.59Å; K49-E58 PolarHBondContact NZ-OE1 2.68Å; K49-E58 IonicContact NZ-OE2 3.64Å
59	Q	97.7	Very high	97.7	Very high	29 Å²	29	62.7 Å²	62.7	14%	0.136	31%	0.311	C	S	.	.	P	Polyproline II helix	trans	-77.2	138.5	176.8	178.3	59.2	-72.6	0	0	110.3	H44 S48 L50 I57	H44-Q59 HydrophobicContact CB-CG 3.47Å; H44-Q59 VanDerWaalsContact CB-CG 3.47Å; H44-Q59 VanDerWaalsContact CG-CG 3.48Å; S48-Q59 VanDerWaalsContact O-CB 3.29Å; S48-Q59 WeakPolarHBondContact O-CB 3.21Å; S48-Q59 PolarHBondContact O-N 2.88Å; S48-Q59 WeakPolarHBondContact OG-CB 3.35Å; L50-Q59 HydrophobicContact CB-CB 4.1Å; I57-Q59 PolarHBondContact O-N 3.14Å
60	V	97.2	Very high	97.6	Very high	86 Å²	86	58.7 Å²	58.7	52%	0.521	29%	0.294	S	S	.	.	P	Polyproline II helix	trans	-73.9	143.9	171.9	-66.2	0	0	0	0	110.3	H44 K62 T63	H44-V60 WeakPolarHBondContact CB-O 3.41Å; H44-V60 PolarHBondContact CD2-O 3.29Å; V60-K62 WeakPolarHBondContact CG2-O 3.23Å; V60-K62 PolarHBondContact O-N 3.48Å; V60-K62 VanDerWaalsContact O-N 3.1Å; V60-T63 HydrophobicContact CG2-CG2 3.76Å
61	E	97.9	Very high	97.5	Very high	119 Å²	119	57.1 Å²	57.1	56%	0.556	29%	0.285	S	S	*	.	S	Bend	trans	-61.5	-23.7	-177.9	-64	-176.8	-166.6	0	0	113.2	Q43 H44	Q43-E61 CarbonylContact C-O 3.59Å; Q43-E61 WeakPolarHBondContact CA-O 3.28Å; H44-E61 PolarHBondContact N-O 2.83Å
62	K	98.2	Very high	97.4	Very high	127 Å²	127	53.8 Å²	53.8	55%	0.552	27%	0.274	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142.9	134.7	179.4	-175.3	-179.2	176	-173.9	0	111.6	A42 V60	A42-K62 WeakPolarHBondContact O-CA 3.39Å; V60-K62 WeakPolarHBondContact CG2-O 3.23Å; V60-K62 PolarHBondContact O-N 3.48Å; V60-K62 VanDerWaalsContact O-N 3.1Å
63	T	98.2	Very high	97.3	Very high	40 Å²	40	59.1 Å²	59.1	25%	0.245	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	149.9	169.9	52.4	0	0	0	0	110.5	S41 A42 H44 V60	S41-T63 VanDerWaalsContact CA-O 3.29Å; S41-T63 WeakPolarHBondContact CA-O 3.41Å; S41-T63 WeakPolarHBondContact CB-O 3.49Å; A42-T63 PolarHBondContact N-O 3.02Å; A42-T63 PolarHBondContact N-OG1 2.87Å; A42-T63 PolarHBondContact O-N 3.49Å; A42-T63 PolarHBondContact O-OG1 3.18Å; H44-T63 PolarHBondContact NE2-OG1 3.21Å; V60-T63 HydrophobicContact CG2-CG2 3.76Å
64	N	98.4	Very high	97.2	Very high	63 Å²	63	58.4 Å²	58.4	34%	0.337	29%	0.288	S	S	.	.			trans	-91.5	155.6	177.3	-61.3	-34.7	0	0	0	110	E83 F84	N64-E83 WeakPolarHBondContact CA-OE1 3.21Å; N64-E83 HydrophobicContact CB-CG 4.31Å; N64-E83 VanDerWaalsContact CB-OE1 3.26Å; N64-E83 WeakPolarHBondContact CB-OE1 3.42Å; N64-F84 HydrophobicContact CB-CD2 4.33Å; N64-F84 HydrophobicContact CB-CE2 4.01Å; N64-F84 VanDerWaalsContact CG-CE2 3.44Å; N64-F84 WeakPolarHBondContact OD1-CE2 3.44Å
65	A	98.7	Very high	97.3	Very high	6 Å²	6	53 Å²	53	5%	0.05	27%	0.266	C	S	.	.			trans	-69.9	136.7	175.2	0	0	0	0	0	110.2	Y38 I39 N82 E83	Y38-A65 HydrophobicContact CE2-CB 4Å; I39-A65 CarbonylContact O-C 3.54Å; I39-A65 VanDerWaalsContact O-CA 3.26Å; I39-A65 WeakPolarHBondContact O-CA 3.35Å; A65-N82 CarbonylContact O-C 3.57Å; A65-N82 VanDerWaalsContact O-CA 3.31Å; A65-N82 WeakPolarHBondContact O-CA 3.4Å; A65-E83 HydrophobicContact CB-CB 4.19Å; A65-E83 HydrophobicContact CB-CG 4.43Å; A65-E83 PolarHBondContact N-OE1 3.29Å; A65-E83 PolarHBondContact O-N 3.38Å
66	V	98.7	Very high	97.3	Very high	12 Å²	12	51.9 Å²	51.9	7%	0.073	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	149.2	-176.4	-65.3	0	0	0	0	111.8	Y38 I39 L68 A81 N82	Y38-V66 WeakPolarHBondContact CA-O 3.11Å; Y38-V66 WeakPolarHBondContact CD2-O 3.44Å; I39-V66 HydrophobicContact CB-CG2 3.82Å; I39-V66 HydrophobicContact CD1-CG2 4.35Å; I39-V66 HydrophobicContact CG1-CG2 4.37Å; I39-V66 PolarHBondContact N-O 3.5Å; I39-V66 PolarHBondContact O-N 3.19Å; V66-L68 HydrophobicContact CB-CD2 3.95Å; V66-L68 HydrophobicContact CB-CG 4.18Å; V66-L68 HydrophobicContact CG2-CD1 3.94Å; V66-L68 HydrophobicContact CG2-CD2 3.94Å; V66-L68 HydrophobicContact CG2-CG 3.74Å; V66-A81 CarbonylContact C-O 3.55Å; V66-A81 WeakPolarHBondContact CA-O 3.43Å; V66-N82 HydrophobicContact CG1-CB 3.78Å
67	V	98.5	Very high	97.3	Very high	72 Å²	72	46.4 Å²	46.4	44%	0.436	24%	0.235	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	124.5	160.4	178.2	0	0	0	0	107.3	I36 V37 Y38 G80 A81	I36-V67 HydrophobicContact CG2-CG1 4.02Å; V37-V67 CarbonylContact O-C 3.6Å; V37-V67 WeakPolarHBondContact O-CA 3.23Å; Y38-V67 HydrophobicContact CD2-CG2 3.92Å; V67-G80 CarbonylContact O-C 3.54Å; V67-G80 WeakPolarHBondContact O-CA 3.01Å; V67-A81 PolarHBondContact N-O 2.97Å; V67-A81 PolarHBondContact O-N 2.92Å
68	L	98.1	Very high	97.3	Very high	5 Å²	5	44 Å²	44	3%	0.026	22%	0.223	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	144	-174.4	-56.8	180	0	0	0	110.7	I36 V37 I39 V66 A77 L113	I36-L68 CarbonylContact C-O 3.59Å; I36-L68 WeakPolarHBondContact CA-O 3.3Å; V37-L68 HydrophobicContact CG2-CB 3.91Å; V37-L68 PolarHBondContact N-O 2.89Å; V37-L68 PolarHBondContact O-N 2.97Å; I39-L68 HydrophobicContact CD1-CD1 3.77Å; V66-L68 HydrophobicContact CB-CD2 3.95Å; V66-L68 HydrophobicContact CB-CG 4.18Å; V66-L68 HydrophobicContact CG2-CD1 3.94Å; V66-L68 HydrophobicContact CG2-CD2 3.94Å; V66-L68 HydrophobicContact CG2-CG 3.74Å; L68-A77 HydrophobicContact CB-CB 3.85Å; L68-A77 HydrophobicContact CD1-CB 4.05Å; L68-A77 HydrophobicContact CD2-CB 4.14Å; L68-A77 HydrophobicContact CG-CB 4.23Å; L68-L113 HydrophobicContact CD2-CD2 4.38Å
69	S	96.9	Very high	97.2	Very high	17 Å²	17	39.9 Å²	39.9	12%	0.119	20%	0.204	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	114.7	161.8	177.7	0	0	0	0	108	Q34 E35 E78 M79	Q34-S69 WeakPolarHBondContact CG-OG 2.84Å; Q34-S69 PolarHBondContact NE2-O 3.1Å; Q34-S69 PolarHBondContact NE2-OG 3.25Å; E35-S69 CarbonylContact O-C 3.59Å; E35-S69 VanDerWaalsContact O-CA 3.3Å; E35-S69 WeakPolarHBondContact O-CA 3.48Å; S69-E78 PolarHBondContact O-N 3.17Å; S69-M79 PolarHBondContact N-O 3.41Å; S69-M79 PolarHBondContact O-N 2.72Å
70	K	96.4	Very high	97.2	Very high	16 Å²	16	39 Å²	39	7%	0.07	20%	0.203	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	149.6	-172	57	171.3	-72.1	-61.4	0	113.2	Q34 E35 V37 A72 M74 G76 A77	Q34-K70 CarbonylContact C-O 3.56Å; Q34-K70 WeakPolarHBondContact CA-O 3.14Å; E35-K70 HydrophobicContact CB-CG 4.36Å; E35-K70 PolarHBondContact N-O 3.07Å; E35-K70 PolarHBondContact O-N 2.93Å; E35-K70 IonicContact OE2-NZ 2.9Å; E35-K70 PolarHBondContact OE2-NZ 3.47Å; V37-K70 HydrophobicContact CG2-CD 3.87Å; V37-K70 HydrophobicContact CG2-CG 4.19Å; K70-A72 PolarHBondContact NZ-O 2.91Å; K70-A72 VanDerWaalsContact NZ-O 3.1Å; K70-M74 WeakPolarHBondContact CE-O 3.47Å; K70-M74 PolarHBondContact NZ-O 3.32Å; K70-G76 VanDerWaalsContact CB-O 3.28Å; K70-G76 WeakPolarHBondContact CB-O 3.42Å; K70-A77 HydrophobicContact CB-CB 3.85Å
71	P	96.1	Very high	97.2	Very high	0 Å²	0	37 Å²	37	0%	0	20%	0.195	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-59.1	139.4	163.5	-23.2	34.7	0	0	0	110.7	E32 V33 W73 M74 E78 M110	E32-P71 HydrophobicContact CG-CB 4.22Å; V33-P71 CarbonylContact O-C 3.55Å; V33-P71 WeakPolarHBondContact O-CA 3.26Å; P71-W73 VanDerWaalsContact C-N 3.26Å; P71-W73 PolarHBondContact O-N 2.86Å; P71-M74 HydrophobicContact CB-CB 4.24Å; P71-M74 PolarHBondContact O-N 2.83Å; P71-E78 HydrophobicContact CG-CG 4.39Å; P71-M110 HydrophobicContact CG-SD 4.1Å
72	A	95.9	Very high	97.2	Very high	41 Å²	41	33.2 Å²	33.2	34%	0.339	18%	0.178	S	C	.	.	T	Hydrogen-bonded Turn	trans	-57.4	-36.9	-172.7	0	0	0	0	0	113.9	V33 E35 K70	V33-A72 HydrophobicContact CB-CB 3.91Å; V33-A72 HydrophobicContact CG1-CB 4Å; V33-A72 PolarHBondContact O-N 3.45Å; E35-A72 HydrophobicContact CG-CB 4.02Å; E35-A72 WeakPolarHBondContact OE2-CA 3.34Å; K70-A72 PolarHBondContact NZ-O 2.91Å; K70-A72 VanDerWaalsContact NZ-O 3.1Å
73	W	95	Very high	97.2	Very high	119 Å²	119	31.6 Å²	31.6	45%	0.451	17%	0.173	S	C	.	.	T	Hydrogen-bonded Turn	trans	-82.1	-14.1	-175.6	64.4	-93.1	0	0	0	114.6	E32 T53 Y54 P71	E32-W73 PolarHBondContact OE1-NE1 3.1Å; T53-W73 HydrophobicContact CG2-CE3 4.14Å; T53-W73 HydrophobicContact CG2-CH2 4.39Å; T53-W73 HydrophobicContact CG2-CZ3 3.49Å; T53-W73 VanDerWaalsContact CG2-CZ3 3.49Å; Y54-W73 HydrophobicContact CE2-CZ3 4.36Å; Y54-W73 AromaticContact CZ-CZ3 3.84Å; Y54-W73 WeakPolarHBondContact OH-CZ3 3.29Å; P71-W73 VanDerWaalsContact C-N 3.26Å; P71-W73 PolarHBondContact O-N 2.86Å
74	M	95.7	Very high	97.2	Very high	9 Å²	9	36 Å²	36	4%	0.044	19%	0.189	C	C	.	.			trans	-93	153	-171.4	-168.1	168.7	-74.5	0	0	111.9	T53 K70 P71 L108 M110	T53-M74 HydrophobicContact CG2-CE 4.42Å; T53-M74 HydrophobicContact CG2-CG 4.03Å; T53-M74 WeakPolarHBondContact OG1-CG 3.4Å; K70-M74 WeakPolarHBondContact CE-O 3.47Å; K70-M74 PolarHBondContact NZ-O 3.32Å; P71-M74 HydrophobicContact CB-CB 4.24Å; P71-M74 PolarHBondContact O-N 2.83Å; M74-L108 HydrophobicContact CE-CD1 3.8Å; M74-M110 HydrophobicContact CE-CE 3.35Å; M74-M110 HydrophobicContact CE-SD 3.97Å; M74-M110 HydrophobicContact SD-CB 3.31Å; M74-M110 WeakPolarHBondContact SD-CB 3.32Å; M74-M110 HydrophobicContact SD-CE 3.57Å; M74-M110 VanDerWaalsContact SD-CE 3.57Å; M74-M110 HydrophobicContact SD-CG 3.96Å; M74-M110 HydrophobicContact SD-SD 3.38Å
75	W	97.4	Very high	97.1	Very high	44 Å²	44	36.2 Å²	36.2	17%	0.167	21%	0.206	C	C	.	.	S	Bend	trans	-78.8	-47.4	171	174.9	86.9	0	0	0	112.4	L50 C52 T53 D111 R114	L50-W75 HydrophobicContact CD1-CZ2 4.32Å; L50-W75 HydrophobicContact CD2-CH2 3.92Å; L50-W75 HydrophobicContact CD2-CZ2 3.26Å; L50-W75 HydrophobicContact CG-CZ2 3.96Å; C52-W75 HydrophobicContact CB-CD2 3.94Å; C52-W75 HydrophobicContact CB-CE3 3.61Å; C52-W75 HydrophobicContact CB-CG 4.36Å; C52-W75 HydrophobicContact CB-CZ3 4.01Å; C52-W75 WeakPolarHBondContact SG-CZ3 3.36Å; T53-W75 PolarHBondContact OG1-N 3.1Å; T53-W75 VanDerWaalsContact OG1-N 3.17Å; W75-D111 HydrophobicContact CE3-CB 4.16Å; W75-D111 HydrophobicContact CZ3-CB 4.17Å; W75-D111 VanDerWaalsContact CZ3-O 3.24Å; W75-D111 WeakPolarHBondContact CZ3-O 3.33Å; W75-R114 HydrophobicContact CH2-CB 3.47Å; W75-R114 VanDerWaalsContact CH2-CB 3.47Å; W75-R114 HydrophobicContact CH2-CG 3.36Å; W75-R114 HydrophobicContact CZ2-CB 4.13Å; W75-R114 HydrophobicContact CZ2-CG 3.47Å; W75-R114 VanDerWaalsContact CZ2-CG 3.47Å; W75-R114 HydrophobicContact CZ3-CB 3.71Å; W75-R114 HydrophobicContact CZ3-CG 3.97Å; W75-R114 PolarHBondContact O-NH1 3.11Å
76	G	97.2	Very high	97	Very high	0 Å²	0	40 Å²	40	0%	0	23%	0.228	C	C	.	.	S	Bend	trans	-70.2	-168.1	174.8	0	0	0	0	0	114.3	K70 M110	K70-G76 VanDerWaalsContact CB-O 3.28Å; K70-G76 WeakPolarHBondContact CB-O 3.42Å; G76-M110 CarbonylContact C-O 3.55Å; G76-M110 WeakPolarHBondContact CA-O 3.34Å
77	A	97.1	Very high	96.9	Very high	0 Å²	0	42.2 Å²	42.2	0%	0	24%	0.242	C	C	.	.			trans	-142.2	161	-175.2	0	0	0	0	0	113.8	L68 K70 M110 L113	L68-A77 HydrophobicContact CB-CB 3.85Å; L68-A77 HydrophobicContact CD1-CB 4.05Å; L68-A77 HydrophobicContact CD2-CB 4.14Å; L68-A77 HydrophobicContact CG-CB 4.23Å; K70-A77 HydrophobicContact CB-CB 3.85Å; A77-M110 PolarHBondContact N-O 3.49Å; A77-M110 VanDerWaalsContact N-O 3.07Å; A77-M110 WeakPolarHBondContact O-CB 3.09Å; A77-M110 WeakPolarHBondContact O-CG 3.19Å; A77-L113 HydrophobicContact CB-CD2 3.73Å; A77-L113 PolarHBondContact N-O 3.17Å; A77-L113 WeakPolarHBondContact O-CB 3.31Å
78	E	95.7	Very high	96.8	Very high	2 Å²	2	42 Å²	42	1%	0.009	24%	0.241	C	C	.	.	S	Bend	trans	-82.3	-33.7	175.8	-84.6	-76.9	113.3	0	0	111.8	K24 S26 R28 S69 P71 G89 N90 M110 L113	K24-E78 WeakPolarHBondContact CE-O 3.3Å; S26-E78 WeakPolarHBondContact CB-OE2 3.36Å; S26-E78 PolarHBondContact OG-OE2 3.34Å; R28-E78 HydrophobicContact CG-CG 4.08Å; S69-E78 PolarHBondContact O-N 3.17Å; P71-E78 HydrophobicContact CG-CG 4.39Å; E78-G89 WeakPolarHBondContact O-CA 3.48Å; E78-N90 PolarHBondContact O-N 3.43Å; E78-N90 PolarHBondContact OE1-ND2 3.18Å; E78-N90 VanDerWaalsContact OE1-ND2 3.14Å; E78-M110 HydrophobicContact CG-SD 3.85Å; E78-M110 WeakPolarHBondContact OE1-CG 3.29Å; E78-L113 WeakPolarHBondContact O-CD1 3.47Å
79	M	97	Very high	96.6	Very high	31 Å²	31	43 Å²	43	15%	0.153	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.3	161.7	176	61.2	-165.3	82.7	0	0	110.7	F22 K24 S69 V88	F22-M79 HydrophobicContact CE1-CB 4.19Å; K24-M79 HydrophobicContact CB-CE 3.68Å; K24-M79 HydrophobicContact CB-SD 3.89Å; K24-M79 HydrophobicContact CD-CB 4.27Å; K24-M79 HydrophobicContact CD-CE 3.95Å; K24-M79 HydrophobicContact CG-CE 3.61Å; K24-M79 HydrophobicContact CG-SD 4.46Å; K24-M79 WeakPolarHBondContact O-CE 3.47Å; S69-M79 PolarHBondContact N-O 3.41Å; S69-M79 PolarHBondContact O-N 2.72Å; M79-V88 CarbonylContact C-O 3.54Å; M79-V88 WeakPolarHBondContact CA-O 3.23Å; M79-V88 WeakPolarHBondContact CB-O 3.38Å
80	G	97.1	Very high	96.5	Very high	11 Å²	11	43.6 Å²	43.6	11%	0.113	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.3	173.2	175.2	0	0	0	0	0	113.8	V67 V87 V88	V67-G80 CarbonylContact O-C 3.54Å; V67-G80 WeakPolarHBondContact O-CA 3.01Å; G80-V87 WeakPolarHBondContact O-CA 3.47Å; G80-V88 PolarHBondContact N-O 2.87Å; G80-V88 PolarHBondContact O-N 3.49Å
81	A	97.6	Very high	96.2	Very high	42 Å²	42	46.5 Å²	46.5	35%	0.347	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	145.3	172.9	0	0	0	0	0	109.9	V66 V67 V86 V87	V66-A81 CarbonylContact C-O 3.55Å; V66-A81 WeakPolarHBondContact CA-O 3.43Å; V67-A81 PolarHBondContact N-O 2.97Å; V67-A81 PolarHBondContact O-N 2.92Å; A81-V86 CarbonylContact C-O 3.58Å; A81-V86 VanDerWaalsContact CA-O 3.23Å; A81-V86 WeakPolarHBondContact CA-O 3.3Å; A81-V87 HydrophobicContact CB-CG1 3.92Å
82	N	98.1	Very high	95.8	Very high	40 Å²	40	49 Å²	49	21%	0.214	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.8	170.4	176.3	77.9	9.1	0	0	0	113	A65 V66 F84 G85 V86	A65-N82 CarbonylContact O-C 3.57Å; A65-N82 VanDerWaalsContact O-CA 3.31Å; A65-N82 WeakPolarHBondContact O-CA 3.4Å; V66-N82 HydrophobicContact CG1-CB 3.78Å; N82-F84 PolarHBondContact O-N 2.77Å; N82-F84 WeakPolarHBondContact OD1-CA 3.46Å; N82-F84 WeakPolarHBondContact OD1-CB 3.4Å; N82-F84 PolarHBondContact OD1-N 3.49Å; N82-G85 PolarHBondContact O-N 3.07Å; N82-G85 VanDerWaalsContact O-N 3.1Å; N82-G85 PolarHBondContact OD1-N 3.07Å; N82-V86 PolarHBondContact N-O 2.7Å; N82-V86 WeakPolarHBondContact OD1-CB 3.24Å; N82-V86 PolarHBondContact OD1-N 3.24Å
83	E	98.1	Very high	95.4	Very high	93 Å²	93	52.4 Å²	52.4	44%	0.435	30%	0.304	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.6	-12.3	178.5	68.5	-169.4	141.5	0	0	115.1	N64 A65	N64-E83 WeakPolarHBondContact CA-OE1 3.21Å; N64-E83 HydrophobicContact CB-CG 4.31Å; N64-E83 VanDerWaalsContact CB-OE1 3.26Å; N64-E83 WeakPolarHBondContact CB-OE1 3.42Å; A65-E83 HydrophobicContact CB-CB 4.19Å; A65-E83 HydrophobicContact CB-CG 4.43Å; A65-E83 PolarHBondContact N-OE1 3.29Å; A65-E83 PolarHBondContact O-N 3.38Å
84	F	97.7	Very high	94.9	Very high	132 Å²	132	58 Å²	58	58%	0.579	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.4	11.1	178.1	-60.9	-72	0	0	0	113.2	N64 N82 V86	N64-F84 HydrophobicContact CB-CD2 4.33Å; N64-F84 HydrophobicContact CB-CE2 4.01Å; N64-F84 VanDerWaalsContact CG-CE2 3.44Å; N64-F84 WeakPolarHBondContact OD1-CE2 3.44Å; N82-F84 PolarHBondContact O-N 2.77Å; N82-F84 WeakPolarHBondContact OD1-CA 3.46Å; N82-F84 WeakPolarHBondContact OD1-CB 3.4Å; N82-F84 PolarHBondContact OD1-N 3.49Å; F84-V86 VanDerWaalsContact C-N 3.31Å; F84-V86 PolarHBondContact O-N 3.21Å
85	G	95.3	Very high	94.3	Very high	69 Å²	69	62.2 Å²	62.2	71%	0.711	35%	0.352	S	S	*	.	S	Bend	trans	74.1	20.8	178.2	0	0	0	0	0	113.9	N82	N82-G85 PolarHBondContact O-N 3.07Å; N82-G85 VanDerWaalsContact O-N 3.1Å; N82-G85 PolarHBondContact OD1-N 3.07Å
86	V	96.7	Very high	93.8	Very high	84 Å²	84	70.2 Å²	70.2	51%	0.509	39%	0.388	S	S	.	.			trans	-91.2	132.8	173.1	-176.3	0	0	0	0	109.1	A81 N82 F84	A81-V86 CarbonylContact C-O 3.58Å; A81-V86 VanDerWaalsContact CA-O 3.23Å; A81-V86 WeakPolarHBondContact CA-O 3.3Å; N82-V86 PolarHBondContact N-O 2.7Å; N82-V86 WeakPolarHBondContact OD1-CB 3.24Å; N82-V86 PolarHBondContact OD1-N 3.24Å; F84-V86 VanDerWaalsContact C-N 3.31Å; F84-V86 PolarHBondContact O-N 3.21Å
87	V	96.8	Very high	93	Very high	59 Å²	59	75.1 Å²	75.1	36%	0.358	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	147.3	173.7	-63	0	0	0	0	110.4	F22 G80 A81	F22-V87 HydrophobicContact CB-CB 4.26Å; F22-V87 HydrophobicContact CB-CG1 4.38Å; F22-V87 HydrophobicContact CB-CG2 3.81Å; F22-V87 HydrophobicContact CD1-CB 4.09Å; F22-V87 HydrophobicContact CD1-CG2 4.36Å; F22-V87 HydrophobicContact CD2-CB 4.44Å; F22-V87 HydrophobicContact CD2-CG2 3.91Å; F22-V87 HydrophobicContact CG-CB 4.01Å; F22-V87 HydrophobicContact CG-CG2 3.77Å; G80-V87 WeakPolarHBondContact O-CA 3.47Å; A81-V87 HydrophobicContact CB-CG1 3.92Å
88	V	96.3	Very high	92.2	Very high	69 Å²	69	84.5 Å²	84.5	42%	0.418	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.5	146.6	178.7	57.4	0	0	0	0	109.8	M79 G80 L113	M79-V88 CarbonylContact C-O 3.54Å; M79-V88 WeakPolarHBondContact CA-O 3.23Å; M79-V88 WeakPolarHBondContact CB-O 3.38Å; G80-V88 PolarHBondContact N-O 2.87Å; G80-V88 PolarHBondContact O-N 3.49Å; V88-L113 HydrophobicContact CB-CD1 4.5Å; V88-L113 HydrophobicContact CB-CG 4.39Å; V88-L113 HydrophobicContact CG1-CD1 4.15Å; V88-L113 HydrophobicContact CG1-CD2 3.76Å; V88-L113 HydrophobicContact CG1-CG 3.65Å; V88-L113 HydrophobicContact CG2-CD1 3.94Å; V88-L113 HydrophobicContact CG2-CG 3.96Å
89	G	95.2	Very high	91.3	Very high	24 Å²	24	88.5 Å²	88.5	25%	0.247	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	136.5	175.3	0	0	0	0	0	110.8	E78	E78-G89 WeakPolarHBondContact O-CA 3.48Å
90	N	94.1	Very high	90.5	Very high	30 Å²	30	90 Å²	90	16%	0.16	51%	0.505	C	S	.	.			trans	-80.2	116.6	179.8	167.9	64.8	0	0	0	110.4	K24 E78 G109 M110 L113	K24-N90 WeakPolarHBondContact CE-O 3.46Å; K24-N90 PolarHBondContact NZ-O 2.53Å; E78-N90 PolarHBondContact O-N 3.43Å; E78-N90 PolarHBondContact OE1-ND2 3.18Å; E78-N90 VanDerWaalsContact OE1-ND2 3.14Å; N90-G109 VanDerWaalsContact OD1-C 3.26Å; N90-M110 HydrophobicContact CB-CG 4.03Å; N90-M110 VanDerWaalsContact ND2-CG 3.3Å; N90-M110 WeakPolarHBondContact ND2-CG 3.27Å; N90-L113 HydrophobicContact CB-CD1 3.76Å
91	E	91.3	Very high	89.7	Confident	78 Å²	78	94.5 Å²	94.5	36%	0.364	52%	0.524	S	S	.	.			trans	-110.8	127.9	-178.3	-167	61.9	-152.7	0	0	111.3	C5 T7 K24 V93	C5-E91 VanDerWaalsContact O-OE1 3.08Å; C5-E91 PolarHBondContact SG-OE1 3.23Å; C5-E91 PolarHBondContact SG-OE2 3.31Å; C5-E91 VanDerWaalsContact SG-OE2 3.38Å; T7-E91 PolarHBondContact OG1-OE2 3.11Å; K24-E91 IonicContact NZ-OE2 2.92Å; K24-E91 PolarHBondContact NZ-OE2 3.34Å; E91-V93 PolarHBondContact O-N 3.17Å
92	A	87.5	Confident	88.9	Confident	52 Å²	52	96 Å²	96	43%	0.43	54%	0.535	S	S	.	.			trans	-74.4	127	178.5	0	0	0	0	0	110.7	C5	C5-A92 PolarHBondContact SG-N 3.18Å
93	V	86	Confident	88.2	Confident	112 Å²	112	98.2 Å²	98.2	68%	0.679	56%	0.559	S	S	*	*			trans	-123.8	140	174.9	-61.7	0	0	0	0	110.8	E91 T95	E91-V93 PolarHBondContact O-N 3.17Å; V93-T95 HydrophobicContact CG2-CG2 4.26Å; V93-T95 PolarHBondContact O-N 2.95Å
94	W	84.3	Confident	87.8	Confident	238 Å²	238	96.9 Å²	96.9	90%	0.902	56%	0.558	S	S	*	*			trans	-80.9	107.2	174	-72.9	-86.3	0	0	0	110.7
95	T	83.8	Confident	87.5	Confident	96 Å²	96	97.2 Å²	97.2	59%	0.589	56%	0.561	S	S	*	*			trans	-85.3	158.8	177.6	72.9	0	0	0	0	111.9	V93	V93-T95 HydrophobicContact CG2-CG2 4.26Å; V93-T95 PolarHBondContact O-N 2.95Å
96	K	86.2	Confident	87.4	Confident	213 Å²	213	102.1 Å²	102.1	93%	0.926	56%	0.558	S	S	*	*			trans	-105.5	22.1	174.2	-62.7	-176.9	-178.8	178.3	0	112.4
97	L	81.9	Confident	87.3	Confident	103 Å²	103	100.5 Å²	100.5	54%	0.539	55%	0.547	S	S	.	.			trans	-61.9	145	-177.4	-69.1	173.3	0	0	0	110.9
98	R	79	Confident	87.2	Confident	196 Å²	196	100.6 Å²	100.6	74%	0.74	55%	0.545	S	S	*	.			trans	-71.6	147.9	176.2	-68.5	178.4	170.4	163.3	-1.7	109.8	G100 E101 A102	R98-G100 PolarHBondContact O-N 3.34Å; R98-G100 VanDerWaalsContact O-N 3.11Å; R98-E101 WeakPolarHBondContact O-CB 3.47Å; R98-E101 PolarHBondContact O-N 3.32Å; R98-A102 PolarHBondContact O-N 2.66Å
99	A	77	Confident	87	Confident	87 Å²	87	99.3 Å²	99.3	72%	0.719	55%	0.545	S	S	*	.	H	α-helix	trans	-52.8	-37.9	-176.6	0	0	0	0	0	113.7	E101 A102 A103	A99-E101 VanDerWaalsContact C-N 3.34Å; A99-E101 PolarHBondContact O-N 3.17Å; A99-A102 PolarHBondContact O-N 2.98Å; A99-A103 PolarHBondContact O-N 3.03Å; A99-A103 VanDerWaalsContact O-N 3.1Å
100	G	81.5	Confident	87	Confident	61 Å²	61	98.8 Å²	98.8	63%	0.629	54%	0.537	S	S	*	.	H	α-helix	trans	-65.6	-33.9	177.2	0	0	0	0	0	113.7	R98	R98-G100 PolarHBondContact O-N 3.34Å; R98-G100 VanDerWaalsContact O-N 3.11Å
101	E	80.6	Confident	87.2	Confident	107 Å²	107	97.6 Å²	97.6	50%	0.5	53%	0.53	S	S	.	.	H	α-helix	trans	-74.4	-39.9	175.7	-66.3	171.5	-125.8	0	0	110.7	R98 A99 A103 T104	R98-E101 WeakPolarHBondContact O-CB 3.47Å; R98-E101 PolarHBondContact O-N 3.32Å; A99-E101 VanDerWaalsContact C-N 3.34Å; A99-E101 PolarHBondContact O-N 3.17Å; E101-A103 PolarHBondContact O-N 3.49Å; E101-T104 WeakPolarHBondContact O-CB 3.29Å; E101-T104 PolarHBondContact O-N 3.32Å; E101-T104 VanDerWaalsContact O-N 3.09Å; E101-T104 PolarHBondContact O-OG1 2.94Å
102	A	79.7	Confident	87.4	Confident	72 Å²	72	100 Å²	100	60%	0.595	55%	0.545	S	S	*	.	H	α-helix	trans	-64.1	-22.2	176.8	0	0	0	0	0	113.7	R98 A99 T104	R98-A102 PolarHBondContact O-N 2.66Å; A99-A102 PolarHBondContact O-N 2.98Å; A102-T104 VanDerWaalsContact C-N 3.3Å
103	A	82.9	Confident	87.7	Confident	87 Å²	87	97.8 Å²	97.8	72%	0.719	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.4	-8.9	175.9	0	0	0	0	0	113.5	A99 E101 E105	A99-A103 PolarHBondContact O-N 3.03Å; A99-A103 VanDerWaalsContact O-N 3.1Å; E101-A103 PolarHBondContact O-N 3.49Å; A103-E105 PolarHBondContact O-N 3.41Å
104	T	89.6	Confident	88.2	Confident	65 Å²	65	98.1 Å²	98.1	40%	0.399	52%	0.515	S	S	.	.	S	Bend	trans	-76.6	129.5	179.6	-33.4	0	0	0	0	109.9	E101 A102 R106	E101-T104 WeakPolarHBondContact O-CB 3.29Å; E101-T104 PolarHBondContact O-N 3.32Å; E101-T104 VanDerWaalsContact O-N 3.09Å; E101-T104 PolarHBondContact O-OG1 2.94Å; A102-T104 VanDerWaalsContact C-N 3.3Å; T104-R106 PolarHBondContact O-N 2.93Å
105	E	91.5	Very high	88.4	Confident	140 Å²	140	91.2 Å²	91.2	65%	0.654	50%	0.496	S	S	*	.			trans	-59.5	126	178.1	-175.1	177	106.1	0	0	111.6	I55 A103	I55-E105 HydrophobicContact CB-CG 4.33Å; I55-E105 HydrophobicContact CD1-CG 4.45Å; I55-E105 HydrophobicContact CG2-CG 3.34Å; I55-E105 VanDerWaalsContact CG2-OE1 3.29Å; I55-E105 WeakPolarHBondContact CG2-OE1 3.46Å; A103-E105 PolarHBondContact O-N 3.41Å
106	R	93.2	Very high	88.6	Confident	171 Å²	171	90.9 Å²	90.9	65%	0.645	49%	0.491	S	S	*	.			trans	-148.9	161.7	-178.7	-65	-64.6	-178.1	-92.1	-2.7	109.8	T104	T104-R106 PolarHBondContact O-N 2.93Å
107	L	95.4	Very high	88.7	Confident	51 Å²	51	84.1 Å²	84.1	27%	0.267	47%	0.467	S	S	.	.			trans	-59	142.3	167.8	-67.9	174.9	0	0	0	110.3	C52 I55 I57 D111 L112	C52-L107 HydrophobicContact CB-CD2 3.9Å; I55-L107 HydrophobicContact CD1-CD2 3.77Å; I55-L107 HydrophobicContact CD1-CG 4.03Å; I55-L107 HydrophobicContact CG1-CD2 3.75Å; I57-L107 HydrophobicContact CD1-CD1 4.42Å; I57-L107 HydrophobicContact CG2-CD1 4.37Å; I57-L107 HydrophobicContact CG2-CD2 3.92Å; I57-L107 HydrophobicContact CG2-CG 4.36Å; L107-D111 HydrophobicContact CB-CB 3.98Å; L107-D111 HydrophobicContact CD2-CB 3.91Å; L107-D111 HydrophobicContact CG-CB 4.45Å; L107-L112 HydrophobicContact CB-CD2 4.01Å; L107-L112 HydrophobicContact CB-CG 4.43Å; L107-L112 HydrophobicContact CD1-CD2 3.78Å
108	L	93.7	Very high	89.1	Confident	60 Å²	60	83 Å²	83	31%	0.314	46%	0.462	S	S	.	.			trans	-69.1	159.1	170.3	-57.3	179	0	0	0	110.3	T53 Y54 M74 M110 D111 L112	T53-L108 HydrophobicContact CG2-CD1 3.89Å; Y54-L108 HydrophobicContact CD2-CD1 4.04Å; Y54-L108 HydrophobicContact CD2-CG 4.48Å; Y54-L108 HydrophobicContact CE2-CD1 3.85Å; M74-L108 HydrophobicContact CE-CD1 3.8Å; L108-M110 PolarHBondContact O-N 3.32Å; L108-D111 HydrophobicContact CB-CB 4.37Å; L108-D111 PolarHBondContact N-OD2 3.35Å; L108-D111 WeakPolarHBondContact O-CB 3.33Å; L108-D111 PolarHBondContact O-N 3.1Å; L108-L112 PolarHBondContact O-N 2.59Å
109	G	93.4	Very high	89.8	Confident	42 Å²	42	75.9 Å²	75.9	43%	0.433	45%	0.445	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.2	-40.7	174.4	0	0	0	0	0	112.8	N90 L112	N90-G109 VanDerWaalsContact OD1-C 3.26Å; G109-L112 WeakPolarHBondContact O-CB 3.49Å; G109-L112 PolarHBondContact O-N 2.96Å
110	M	95.6	Very high	90.6	Very high	14 Å²	14	75.2 Å²	75.2	7%	0.069	43%	0.427	C	S	.	.	T	Hydrogen-bonded Turn	trans	-71.6	-28.1	174.8	-73.5	-177.2	-91.8	0	0	113.9	P71 M74 G76 A77 E78 N90 L108 L112 L113	P71-M110 HydrophobicContact CG-SD 4.1Å; M74-M110 HydrophobicContact CE-CE 3.35Å; M74-M110 HydrophobicContact CE-SD 3.97Å; M74-M110 HydrophobicContact SD-CB 3.31Å; M74-M110 WeakPolarHBondContact SD-CB 3.32Å; M74-M110 HydrophobicContact SD-CE 3.57Å; M74-M110 VanDerWaalsContact SD-CE 3.57Å; M74-M110 HydrophobicContact SD-CG 3.96Å; M74-M110 HydrophobicContact SD-SD 3.38Å; G76-M110 CarbonylContact C-O 3.55Å; G76-M110 WeakPolarHBondContact CA-O 3.34Å; A77-M110 PolarHBondContact N-O 3.49Å; A77-M110 VanDerWaalsContact N-O 3.07Å; A77-M110 WeakPolarHBondContact O-CB 3.09Å; A77-M110 WeakPolarHBondContact O-CG 3.19Å; E78-M110 HydrophobicContact CG-SD 3.85Å; E78-M110 WeakPolarHBondContact OE1-CG 3.29Å; N90-M110 HydrophobicContact CB-CG 4.03Å; N90-M110 VanDerWaalsContact ND2-CG 3.3Å; N90-M110 WeakPolarHBondContact ND2-CG 3.27Å; L108-M110 PolarHBondContact O-N 3.32Å; M110-L112 VanDerWaalsContact C-N 3.27Å; M110-L112 PolarHBondContact O-N 3.09Å; M110-L113 CarbonylContact O-C 3.59Å; M110-L113 WeakPolarHBondContact O-CA 3.21Å; M110-L113 WeakPolarHBondContact O-CB 3.33Å; M110-L113 PolarHBondContact O-N 3.26Å
111	D	97.1	Very high	91.3	Very high	5 Å²	5	76.2 Å²	76.2	3%	0.027	41%	0.412	C	S	.	.	T	Hydrogen-bonded Turn	trans	-67.3	-32.7	173.6	-72	-35.2	0	0	0	110.8	T53 W75 L107 L108 L113	T53-D111 VanDerWaalsContact CB-OD1 3.3Å; T53-D111 WeakPolarHBondContact CB-OD1 3.19Å; T53-D111 PolarHBondContact N-OD1 3.06Å; T53-D111 PolarHBondContact OG1-OD1 2.88Å; W75-D111 HydrophobicContact CE3-CB 4.16Å; W75-D111 HydrophobicContact CZ3-CB 4.17Å; W75-D111 VanDerWaalsContact CZ3-O 3.24Å; W75-D111 WeakPolarHBondContact CZ3-O 3.33Å; L107-D111 HydrophobicContact CB-CB 3.98Å; L107-D111 HydrophobicContact CD2-CB 3.91Å; L107-D111 HydrophobicContact CG-CB 4.45Å; L108-D111 HydrophobicContact CB-CB 4.37Å; L108-D111 PolarHBondContact N-OD2 3.35Å; L108-D111 WeakPolarHBondContact O-CB 3.33Å; L108-D111 PolarHBondContact O-N 3.1Å; D111-L113 PolarHBondContact O-N 3.47Å
112	L	95.5	Very high	92.1	Very high	127 Å²	127	73.8 Å²	73.8	67%	0.665	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-19.2	172.7	-58.7	175.5	0	0	0	112.3	L107 L108 G109 M110 R114	L107-L112 HydrophobicContact CB-CD2 4.01Å; L107-L112 HydrophobicContact CB-CG 4.43Å; L107-L112 HydrophobicContact CD1-CD2 3.78Å; L108-L112 PolarHBondContact O-N 2.59Å; G109-L112 WeakPolarHBondContact O-CB 3.49Å; G109-L112 PolarHBondContact O-N 2.96Å; M110-L112 VanDerWaalsContact C-N 3.27Å; M110-L112 PolarHBondContact O-N 3.09Å; L112-R114 PolarHBondContact O-N 2.91Å
113	L	95	Very high	93.1	Very high	6 Å²	6	74 Å²	74	3%	0.031	39%	0.39	C	S	.	.			trans	-93.2	77.2	176.6	-157.7	161.1	0	0	0	109.7	L68 A77 E78 V88 N90 M110 D111	L68-L113 HydrophobicContact CD2-CD2 4.38Å; A77-L113 HydrophobicContact CB-CD2 3.73Å; A77-L113 PolarHBondContact N-O 3.17Å; A77-L113 WeakPolarHBondContact O-CB 3.31Å; E78-L113 WeakPolarHBondContact O-CD1 3.47Å; V88-L113 HydrophobicContact CB-CD1 4.5Å; V88-L113 HydrophobicContact CB-CG 4.39Å; V88-L113 HydrophobicContact CG1-CD1 4.15Å; V88-L113 HydrophobicContact CG1-CD2 3.76Å; V88-L113 HydrophobicContact CG1-CG 3.65Å; V88-L113 HydrophobicContact CG2-CD1 3.94Å; V88-L113 HydrophobicContact CG2-CG 3.96Å; N90-L113 HydrophobicContact CB-CD1 3.76Å; M110-L113 CarbonylContact O-C 3.59Å; M110-L113 WeakPolarHBondContact O-CA 3.21Å; M110-L113 WeakPolarHBondContact O-CB 3.33Å; M110-L113 PolarHBondContact O-N 3.26Å; D111-L113 PolarHBondContact O-N 3.47Å
114	R	94.9	Very high	94.1	Very high	120 Å²	120	72.8 Å²	72.8	45%	0.453	36%	0.36	S	S	.	.			trans	-145.1	0	175.2	-171.6	76.9	169.7	-163.2	-9	111.7	I39 W75 L112	I39-R114 VanDerWaalsContact CD1-NH1 3.26Å; I39-R114 VanDerWaalsContact CD1-NH2 3.31Å; W75-R114 HydrophobicContact CH2-CB 3.47Å; W75-R114 VanDerWaalsContact CH2-CB 3.47Å; W75-R114 HydrophobicContact CH2-CG 3.36Å; W75-R114 HydrophobicContact CZ2-CB 4.13Å; W75-R114 HydrophobicContact CZ2-CG 3.47Å; W75-R114 VanDerWaalsContact CZ2-CG 3.47Å; W75-R114 HydrophobicContact CZ3-CB 3.71Å; W75-R114 HydrophobicContact CZ3-CG 3.97Å; W75-R114 PolarHBondContact O-NH1 3.11Å; L112-R114 PolarHBondContact O-N 2.91Å

Retrieved 114 of 114 residues in 215.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).