A0A077ZGH7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZGH7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 97 aa.

						>A0A077ZGH7_TRITR|A0A077ZGH7
MLKIEVPHPAAKSVIEISRYSLRSIRSRIEILTCFIEAAEKLNATEPFLTQDIRPVHIIAALQAALTDVVAHCNEKMGGNININNEETLLDVCSSVD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.7	Very low	73.1	Confident	190 Å²	190	111.3 Å²	111.3	94%	0.936	60%	0.601	S	S	*	*				0	121	0	-170.6	164.7	100.5	0	0	107.3	K3	M1-K3 PolarHBondContact O-N 3.1Å; M1-K3 VanDerWaalsContact O-N 3.07Å
2	L	47.1	Very low	74.3	Confident	155 Å²	155	111.8 Å²	111.8	81%	0.812	59%	0.593	S	S	*	*			trans	-60.3	113.6	177.1	-140.8	115.2	0	0	0	107.6	I4	L2-I4 HydrophobicContact CD2-CG1 4.12Å; L2-I4 PolarHBondContact O-N 3.08Å
3	K	57.5	Low	75.5	Confident	159 Å²	159	107.6 Å²	107.6	69%	0.691	58%	0.578	S	S	*	*			trans	-88.1	90.3	-178.8	-152.5	-176.1	-174.4	-167.4	0	106.6	M1 E5	M1-K3 PolarHBondContact O-N 3.1Å; M1-K3 VanDerWaalsContact O-N 3.07Å; K3-E5 PolarHBondContact O-N 3.3Å; K3-E5 VanDerWaalsContact O-N 3.17Å
4	I	69.2	Low	76.3	Confident	101 Å²	101	102.4 Å²	102.4	52%	0.518	55%	0.552	S	S	.	*			trans	-70.6	107.9	172.1	-56.3	171.6	0	0	0	106.2	L2 V6 I15	L2-I4 HydrophobicContact CD2-CG1 4.12Å; L2-I4 PolarHBondContact O-N 3.08Å; I4-V6 HydrophobicContact CG2-CG2 3.76Å; I4-I15 HydrophobicContact CG2-CD1 4.46Å
5	E	77.7	Confident	77	Confident	160 Å²	160	97.1 Å²	97.1	75%	0.748	52%	0.523	S	S	*	.			trans	-87	121	172.4	-68.5	-163.5	165	0	0	109.1	K3	K3-E5 PolarHBondContact O-N 3.3Å; K3-E5 VanDerWaalsContact O-N 3.17Å
6	V	78.2	Confident	77.6	Confident	40 Å²	40	97.2 Å²	97.2	24%	0.242	52%	0.519	C	S	.	.			trans	-122.4	133.3	178.2	-170.2	0	0	0	0	108.1	I4 A11 K12 I15	I4-V6 HydrophobicContact CG2-CG2 3.76Å; V6-A11 HydrophobicContact CB-CB 4.25Å; V6-A11 HydrophobicContact CG1-CB 3.52Å; V6-K12 WeakPolarHBondContact O-CE 3.49Å; V6-K12 WeakPolarHBondContact O-CG 2.81Å; V6-I15 HydrophobicContact CB-CD1 4.37Å; V6-I15 HydrophobicContact CG2-CD1 3.49Å; V6-I15 VanDerWaalsContact CG2-CD1 3.49Å
7	P	84.2	Confident	78.2	Confident	121 Å²	121	98.2 Å²	98.2	79%	0.786	52%	0.523	S	S	*	.	S	Bend	trans	-70.5	-37.7	-176	25.7	-33.8	0	0	0	112.5
8	H	85.3	Confident	78.7	Confident	115 Å²	115	93.3 Å²	93.3	53%	0.532	50%	0.498	S	S	.	.	S	Bend	trans	-71.2	125.3	-171.7	-166.2	-95.3	0	0	0	112.3	A10 A11 K12	H8-A10 VanDerWaalsContact C-N 3.33Å; H8-A10 WeakPolarHBondContact CE1-CB 3.39Å; H8-A10 VanDerWaalsContact ND1-CB 3.35Å; H8-A10 WeakPolarHBondContact ND1-CB 3.46Å; H8-A10 PolarHBondContact ND1-N 3.22Å; H8-A10 PolarHBondContact O-N 3.23Å; H8-A11 HydrophobicContact CB-CB 4.09Å; H8-A11 PolarHBondContact O-N 3.04Å; H8-A11 VanDerWaalsContact O-N 3.08Å; H8-K12 PolarHBondContact O-N 2.68Å; H8-K12 VanDerWaalsContact O-N 3.1Å
9	P	86.8	Confident	79	Confident	97 Å²	97	93.5 Å²	93.5	63%	0.63	49%	0.491	S	S	*	.	H	α-helix	trans	-57.1	-40.5	-179.1	-26.6	34.5	0	0	0	113.9	A11 K12 S13	P9-A11 VanDerWaalsContact C-N 3.31Å; P9-A11 PolarHBondContact O-N 3.25Å; P9-K12 WeakPolarHBondContact O-CB 3.44Å; P9-K12 PolarHBondContact O-N 3.15Å; P9-S13 PolarHBondContact O-N 3.48Å
10	A	85.3	Confident	79.4	Confident	53 Å²	53	98 Å²	98	44%	0.438	50%	0.502	S	S	.	.	H	α-helix	trans	-65.3	-37.3	178.4	0	0	0	0	0	111.5	H8 K12 S13 V14	H8-A10 VanDerWaalsContact C-N 3.33Å; H8-A10 WeakPolarHBondContact CE1-CB 3.39Å; H8-A10 VanDerWaalsContact ND1-CB 3.35Å; H8-A10 WeakPolarHBondContact ND1-CB 3.46Å; H8-A10 PolarHBondContact ND1-N 3.22Å; H8-A10 PolarHBondContact O-N 3.23Å; A10-K12 PolarHBondContact O-N 3.22Å; A10-S13 WeakPolarHBondContact O-CB 3.37Å; A10-S13 PolarHBondContact O-N 3.05Å; A10-S13 VanDerWaalsContact O-N 3.16Å; A10-V14 WeakPolarHBondContact O-CG2 3.41Å; A10-V14 PolarHBondContact O-N 3.17Å
11	A	84.9	Confident	79.7	Confident	33 Å²	33	95.1 Å²	95.1	27%	0.273	49%	0.491	S	S	.	.	H	α-helix	trans	-67.5	-37.8	177.9	0	0	0	0	0	111.4	V6 H8 P9 S13 V14 I15	V6-A11 HydrophobicContact CB-CB 4.25Å; V6-A11 HydrophobicContact CG1-CB 3.52Å; H8-A11 HydrophobicContact CB-CB 4.09Å; H8-A11 PolarHBondContact O-N 3.04Å; H8-A11 VanDerWaalsContact O-N 3.08Å; P9-A11 VanDerWaalsContact C-N 3.31Å; P9-A11 PolarHBondContact O-N 3.25Å; A11-S13 VanDerWaalsContact C-N 3.3Å; A11-S13 PolarHBondContact O-N 3.29Å; A11-V14 PolarHBondContact O-N 3.29Å; A11-I15 WeakPolarHBondContact O-CG1 3.42Å; A11-I15 PolarHBondContact O-N 3.12Å
12	K	88.3	Confident	81.7	Confident	117 Å²	117	94.8 Å²	94.8	51%	0.509	49%	0.492	S	S	.	.	H	α-helix	trans	-58.4	-43.5	170.9	-66.8	-179.5	-175.3	179	0	111.5	V6 H8 P9 A10 I15 E16	V6-K12 WeakPolarHBondContact O-CE 3.49Å; V6-K12 WeakPolarHBondContact O-CG 2.81Å; H8-K12 PolarHBondContact O-N 2.68Å; H8-K12 VanDerWaalsContact O-N 3.1Å; P9-K12 WeakPolarHBondContact O-CB 3.44Å; P9-K12 PolarHBondContact O-N 3.15Å; A10-K12 PolarHBondContact O-N 3.22Å; K12-I15 PolarHBondContact O-N 3.48Å; K12-E16 WeakPolarHBondContact O-CB 3.34Å; K12-E16 PolarHBondContact O-N 3.42Å
13	S	89	Confident	83.7	Confident	58 Å²	58	94.7 Å²	94.7	41%	0.406	48%	0.481	S	S	.	.	H	α-helix	trans	-62.4	-45.7	177.5	-176.2	0	0	0	0	112	P9 A10 A11 I15 E16 I17	P9-S13 PolarHBondContact O-N 3.48Å; A10-S13 WeakPolarHBondContact O-CB 3.37Å; A10-S13 PolarHBondContact O-N 3.05Å; A10-S13 VanDerWaalsContact O-N 3.16Å; A11-S13 VanDerWaalsContact C-N 3.3Å; A11-S13 PolarHBondContact O-N 3.29Å; S13-I15 VanDerWaalsContact C-N 3.34Å; S13-I15 PolarHBondContact O-N 2.99Å; S13-E16 PolarHBondContact O-N 3.16Å; S13-E16 VanDerWaalsContact O-N 3.16Å; S13-I17 VanDerWaalsContact O-CG1 3.31Å; S13-I17 WeakPolarHBondContact O-CG1 3.35Å; S13-I17 PolarHBondContact O-N 3.07Å
14	V	87.6	Confident	85.1	Confident	34 Å²	34	90.2 Å²	90.2	21%	0.206	47%	0.47	C	S	.	.	H	α-helix	trans	-61.5	-42.7	176.4	-176.9	0	0	0	0	111.1	A10 A11 E16 I17 S18 L32 F35	A10-V14 WeakPolarHBondContact O-CG2 3.41Å; A10-V14 PolarHBondContact O-N 3.17Å; A11-V14 PolarHBondContact O-N 3.29Å; V14-E16 VanDerWaalsContact C-N 3.33Å; V14-E16 PolarHBondContact O-N 2.88Å; V14-I17 PolarHBondContact O-N 3.22Å; V14-S18 WeakPolarHBondContact O-CB 3.34Å; V14-S18 PolarHBondContact O-N 3.28Å; V14-L32 HydrophobicContact CB-CD2 4.44Å; V14-L32 HydrophobicContact CG1-CD2 3.71Å; V14-F35 HydrophobicContact CG1-CB 4.24Å; V14-F35 HydrophobicContact CG1-CD1 4.49Å; V14-F35 HydrophobicContact CG1-CD2 3.48Å; V14-F35 VanDerWaalsContact CG1-CD2 3.48Å; V14-F35 HydrophobicContact CG1-CE2 3.89Å; V14-F35 HydrophobicContact CG1-CG 3.84Å; V14-F35 HydrophobicContact CG2-CD1 4.42Å; V14-F35 HydrophobicContact CG2-CG 4.48Å
15	I	86.5	Confident	86	Confident	24 Å²	24	91.2 Å²	91.2	12%	0.123	48%	0.475	C	S	.	.	H	α-helix	trans	-61.1	-43.3	175.1	-68.5	168.2	0	0	0	110.7	I4 V6 A11 K12 S13 S18 R19 L32	I4-I15 HydrophobicContact CG2-CD1 4.46Å; V6-I15 HydrophobicContact CB-CD1 4.37Å; V6-I15 HydrophobicContact CG2-CD1 3.49Å; V6-I15 VanDerWaalsContact CG2-CD1 3.49Å; A11-I15 WeakPolarHBondContact O-CG1 3.42Å; A11-I15 PolarHBondContact O-N 3.12Å; K12-I15 PolarHBondContact O-N 3.48Å; S13-I15 VanDerWaalsContact C-N 3.34Å; S13-I15 PolarHBondContact O-N 2.99Å; I15-S18 PolarHBondContact O-N 3.34Å; I15-S18 PolarHBondContact O-OG 3.45Å; I15-R19 WeakPolarHBondContact O-CG 3.31Å; I15-R19 PolarHBondContact O-N 3.44Å; I15-R19 VanDerWaalsContact O-N 3.11Å; I15-L32 HydrophobicContact CB-CD2 4.46Å; I15-L32 HydrophobicContact CG1-CD2 3.83Å
16	E	86.9	Confident	86.5	Confident	98 Å²	98	92 Å²	92	46%	0.458	47%	0.471	S	S	.	.	H	α-helix	trans	-65	-45.7	178.6	-173.2	170.2	-169.1	0	0	112.5	K12 S13 V14 S18 R19 Y20	K12-E16 WeakPolarHBondContact O-CB 3.34Å; K12-E16 PolarHBondContact O-N 3.42Å; S13-E16 PolarHBondContact O-N 3.16Å; S13-E16 VanDerWaalsContact O-N 3.16Å; V14-E16 VanDerWaalsContact C-N 3.33Å; V14-E16 PolarHBondContact O-N 2.88Å; E16-S18 PolarHBondContact O-N 3.45Å; E16-R19 WeakPolarHBondContact O-CB 3.39Å; E16-R19 PolarHBondContact O-N 3.42Å; E16-Y20 HydrophobicContact CG-CD2 4.34Å; E16-Y20 HydrophobicContact CG-CE2 3.89Å; E16-Y20 WeakPolarHBondContact O-CD2 3.41Å; E16-Y20 PolarHBondContact O-N 3.35Å
17	I	87.5	Confident	87	Confident	114 Å²	114	91.6 Å²	91.6	59%	0.585	47%	0.47	S	S	*	.	H	α-helix	trans	-57.3	-42.8	173.6	-67.4	164.7	0	0	0	110.2	S13 V14 R19 Y20 S21	S13-I17 VanDerWaalsContact O-CG1 3.31Å; S13-I17 WeakPolarHBondContact O-CG1 3.35Å; S13-I17 PolarHBondContact O-N 3.07Å; V14-I17 PolarHBondContact O-N 3.22Å; I17-R19 PolarHBondContact O-N 2.97Å; I17-Y20 PolarHBondContact O-N 3.33Å; I17-S21 PolarHBondContact O-N 2.97Å
18	S	86.3	Confident	87.1	Confident	10 Å²	10	88.8 Å²	88.8	7%	0.07	44%	0.444	C	S	.	.	H	α-helix	trans	-62	-29.2	177.7	85.2	0	0	0	0	112.3	V14 I15 E16 S21 R28 L32	V14-S18 WeakPolarHBondContact O-CB 3.34Å; V14-S18 PolarHBondContact O-N 3.28Å; I15-S18 PolarHBondContact O-N 3.34Å; I15-S18 PolarHBondContact O-OG 3.45Å; E16-S18 PolarHBondContact O-N 3.45Å; S18-S21 WeakPolarHBondContact O-CB 3.33Å; S18-S21 PolarHBondContact O-N 2.86Å; S18-R28 WeakPolarHBondContact O-CD 3.33Å; S18-R28 PolarHBondContact O-NE 3.16Å; S18-L32 WeakPolarHBondContact OG-CD1 3.46Å
19	R	84.9	Confident	87.2	Confident	98 Å²	98	88 Å²	88	37%	0.37	44%	0.442	S	S	.	.	H	α-helix	trans	-69.2	-35.3	178.9	-71.6	174.9	-173.2	132.9	2	112.6	I15 E16 I17	I15-R19 WeakPolarHBondContact O-CG 3.31Å; I15-R19 PolarHBondContact O-N 3.44Å; I15-R19 VanDerWaalsContact O-N 3.11Å; E16-R19 WeakPolarHBondContact O-CB 3.39Å; E16-R19 PolarHBondContact O-N 3.42Å; I17-R19 PolarHBondContact O-N 2.97Å
20	Y	88	Confident	87.3	Confident	182 Å²	182	88.4 Å²	88.4	71%	0.714	44%	0.436	S	S	*	.	H	α-helix	trans	-89.6	-2.7	178.8	-62.6	-70.6	0	0	0	113.4	E16 I17 L22	E16-Y20 HydrophobicContact CG-CD2 4.34Å; E16-Y20 HydrophobicContact CG-CE2 3.89Å; E16-Y20 WeakPolarHBondContact O-CD2 3.41Å; E16-Y20 PolarHBondContact O-N 3.35Å; I17-Y20 PolarHBondContact O-N 3.33Å; Y20-L22 PolarHBondContact O-N 3.02Å
21	S	84.7	Confident	87.4	Confident	38 Å²	38	88.8 Å²	88.8	27%	0.266	43%	0.43	S	S	.	.			trans	-65.3	131.4	177.5	-169.5	0	0	0	0	111.3	I17 S18 R23	I17-S21 PolarHBondContact O-N 2.97Å; S18-S21 WeakPolarHBondContact O-CB 3.33Å; S18-S21 PolarHBondContact O-N 2.86Å; S21-R23 PolarHBondContact O-N 3.18Å; S21-R23 WeakPolarHBondContact OG-CB 3.43Å; S21-R23 WeakPolarHBondContact OG-CG 3.33Å; S21-R23 PolarHBondContact OG-N 3.22Å
22	L	91	Very high	87.6	Confident	183 Å²	183	88.7 Å²	88.7	96%	0.958	42%	0.424	S	S	*	.			trans	-71.2	-3.2	172.8	-62.2	174.9	0	0	0	113.3	Y20	Y20-L22 PolarHBondContact O-N 3.02Å
23	R	87.5	Confident	87.7	Confident	154 Å²	154	85.9 Å²	85.9	58%	0.581	42%	0.417	S	S	*	.	S	Bend	trans	-69.9	156.5	177.9	-68.5	179.6	178.3	-92.5	0.5	111.2	S21 R28 I31	S21-R23 PolarHBondContact O-N 3.18Å; S21-R23 WeakPolarHBondContact OG-CB 3.43Å; S21-R23 WeakPolarHBondContact OG-CG 3.33Å; S21-R23 PolarHBondContact OG-N 3.22Å; R23-R28 HydrophobicContact CB-CG 4.2Å; R23-R28 VanDerWaalsContact O-CD 3.31Å; R23-R28 WeakPolarHBondContact O-CD 3.38Å; R23-I31 VanDerWaalsContact CD-CD1 3.44Å
24	S	88.2	Confident	87.8	Confident	65 Å²	65	86.9 Å²	86.9	46%	0.455	42%	0.423	S	S	.	.			trans	-55.6	157.3	173.8	80	0	0	0	0	111.7	R26 S27 R28	S24-R26 PolarHBondContact O-N 3.5Å; S24-S27 PolarHBondContact O-N 3.32Å; S24-S27 VanDerWaalsContact O-N 3.14Å; S24-S27 PolarHBondContact OG-N 3.04Å; S24-S27 VanDerWaalsContact OG-N 3.1Å; S24-S27 PolarHBondContact OG-OG 3.44Å; S24-R28 WeakPolarHBondContact O-CG 3.44Å; S24-R28 PolarHBondContact O-N 3.31Å
25	I	88.2	Confident	88	Confident	122 Å²	122	90.9 Å²	90.9	63%	0.626	44%	0.438	S	S	*	.	H	α-helix	trans	-58.6	-36.5	179	-150.6	157.4	0	0	0	111.9	R28 I29	I25-R28 PolarHBondContact O-N 2.94Å; I25-I29 WeakPolarHBondContact O-CG1 3.28Å; I25-I29 PolarHBondContact O-N 3.34Å; I25-I29 VanDerWaalsContact O-N 3.1Å
26	R	86.8	Confident	88.1	Confident	176 Å²	176	94.2 Å²	94.2	66%	0.664	46%	0.455	S	S	*	.	H	α-helix	trans	-61.1	-52.4	174.5	175.7	-179.7	-61.5	-78.8	-0	111	S24 R28 I29 E30	S24-R26 PolarHBondContact O-N 3.5Å; R26-R28 VanDerWaalsContact C-N 3.26Å; R26-R28 PolarHBondContact O-N 3.32Å; R26-I29 WeakPolarHBondContact O-CB 3.47Å; R26-I29 PolarHBondContact O-N 2.75Å; R26-I29 VanDerWaalsContact O-N 3.09Å; R26-E30 VanDerWaalsContact CG-OE1 3.24Å; R26-E30 WeakPolarHBondContact CG-OE1 3.42Å; R26-E30 WeakPolarHBondContact O-CG 3.49Å; R26-E30 PolarHBondContact O-N 3.41Å
27	S	88.7	Confident	88.4	Confident	31 Å²	31	93.9 Å²	93.9	22%	0.217	45%	0.454	C	S	.	.	H	α-helix	trans	-64.6	-30.2	-179.7	-57.8	0	0	0	0	113.3	S24 E30 I31	S24-S27 PolarHBondContact O-N 3.32Å; S24-S27 VanDerWaalsContact O-N 3.14Å; S24-S27 PolarHBondContact OG-N 3.04Å; S24-S27 VanDerWaalsContact OG-N 3.1Å; S24-S27 PolarHBondContact OG-OG 3.44Å; S27-E30 WeakPolarHBondContact CA-OE2 3.44Å; S27-I31 VanDerWaalsContact O-CG1 3.32Å; S27-I31 WeakPolarHBondContact O-CG1 3.43Å; S27-I31 PolarHBondContact O-N 3.12Å; S27-I31 VanDerWaalsContact O-N 3.14Å
28	R	85.9	Confident	88.6	Confident	63 Å²	63	90.6 Å²	90.6	24%	0.238	44%	0.444	C	S	.	.	H	α-helix	trans	-67	-42	173	-70.4	163.9	54.1	-155.3	-4.7	111.6	S18 R23 S24 I25 R26 I31 L32	S18-R28 WeakPolarHBondContact O-CD 3.33Å; S18-R28 PolarHBondContact O-NE 3.16Å; R23-R28 HydrophobicContact CB-CG 4.2Å; R23-R28 VanDerWaalsContact O-CD 3.31Å; R23-R28 WeakPolarHBondContact O-CD 3.38Å; S24-R28 WeakPolarHBondContact O-CG 3.44Å; S24-R28 PolarHBondContact O-N 3.31Å; I25-R28 PolarHBondContact O-N 2.94Å; R26-R28 VanDerWaalsContact C-N 3.26Å; R26-R28 PolarHBondContact O-N 3.32Å; R28-I31 PolarHBondContact O-N 2.85Å; R28-L32 WeakPolarHBondContact O-CG 3.41Å; R28-L32 PolarHBondContact O-N 3.05Å; R28-L32 VanDerWaalsContact O-N 3.1Å
29	I	88.4	Confident	88.8	Confident	97 Å²	97	92.8 Å²	92.8	50%	0.497	46%	0.462	S	S	.	.	H	α-helix	trans	-64.7	-46.3	175.3	-68.3	165.7	0	0	0	110	I25 R26 I31 L32 T33	I25-I29 WeakPolarHBondContact O-CG1 3.28Å; I25-I29 PolarHBondContact O-N 3.34Å; I25-I29 VanDerWaalsContact O-N 3.1Å; R26-I29 WeakPolarHBondContact O-CB 3.47Å; R26-I29 PolarHBondContact O-N 2.75Å; R26-I29 VanDerWaalsContact O-N 3.09Å; I29-I31 VanDerWaalsContact C-N 3.29Å; I29-I31 PolarHBondContact O-N 2.9Å; I29-L32 PolarHBondContact O-N 3.32Å; I29-L32 VanDerWaalsContact O-N 3.1Å; I29-T33 WeakPolarHBondContact O-CB 3.38Å; I29-T33 PolarHBondContact O-N 3.41Å; I29-T33 PolarHBondContact O-OG1 3.3Å; I29-T33 VanDerWaalsContact O-OG1 3.13Å
30	E	88.5	Confident	89.1	Confident	107 Å²	107	93.9 Å²	93.9	50%	0.5	47%	0.472	S	S	.	.	H	α-helix	trans	-55.3	-43.1	177.4	-72.1	164	-177.9	0	0	112.3	R26 S27 C34	R26-E30 VanDerWaalsContact CG-OE1 3.24Å; R26-E30 WeakPolarHBondContact CG-OE1 3.42Å; R26-E30 WeakPolarHBondContact O-CG 3.49Å; R26-E30 PolarHBondContact O-N 3.41Å; S27-E30 WeakPolarHBondContact CA-OE2 3.44Å; E30-C34 WeakPolarHBondContact O-CB 3.48Å; E30-C34 PolarHBondContact O-N 2.63Å
31	I	88	Confident	89.3	Confident	60 Å²	60	91.1 Å²	91.1	31%	0.308	46%	0.463	S	S	.	.	H	α-helix	trans	-64.4	-48	176.1	-69.6	167.2	0	0	0	110.9	R23 S27 R28 I29 T33 C34 F35	R23-I31 VanDerWaalsContact CD-CD1 3.44Å; S27-I31 VanDerWaalsContact O-CG1 3.32Å; S27-I31 WeakPolarHBondContact O-CG1 3.43Å; S27-I31 PolarHBondContact O-N 3.12Å; S27-I31 VanDerWaalsContact O-N 3.14Å; R28-I31 PolarHBondContact O-N 2.85Å; I29-I31 VanDerWaalsContact C-N 3.29Å; I29-I31 PolarHBondContact O-N 2.9Å; I31-T33 VanDerWaalsContact C-N 3.35Å; I31-T33 PolarHBondContact O-N 3.48Å; I31-C34 PolarHBondContact O-N 3.11Å; I31-F35 HydrophobicContact CG2-CD2 3.75Å; I31-F35 HydrophobicContact CG2-CE2 3.59Å; I31-F35 WeakPolarHBondContact O-CD2 3.42Å; I31-F35 PolarHBondContact O-N 3.38Å
32	L	89.6	Confident	89.7	Confident	31 Å²	31	94.9 Å²	94.9	16%	0.162	48%	0.48	C	S	.	.	H	α-helix	trans	-60.1	-44.9	178.8	-76	169.2	0	0	0	112.1	V14 I15 S18 R28 I29 F35 I36	V14-L32 HydrophobicContact CB-CD2 4.44Å; V14-L32 HydrophobicContact CG1-CD2 3.71Å; I15-L32 HydrophobicContact CB-CD2 4.46Å; I15-L32 HydrophobicContact CG1-CD2 3.83Å; S18-L32 WeakPolarHBondContact OG-CD1 3.46Å; R28-L32 WeakPolarHBondContact O-CG 3.41Å; R28-L32 PolarHBondContact O-N 3.05Å; R28-L32 VanDerWaalsContact O-N 3.1Å; I29-L32 PolarHBondContact O-N 3.32Å; I29-L32 VanDerWaalsContact O-N 3.1Å; L32-F35 PolarHBondContact O-N 2.86Å; L32-I36 WeakPolarHBondContact O-CG1 3.4Å; L32-I36 PolarHBondContact O-N 3.3Å
33	T	90.1	Very high	89.7	Confident	59 Å²	59	91.5 Å²	91.5	36%	0.362	46%	0.463	S	S	.	.	H	α-helix	trans	-60	-46	177.1	-63.1	0	0	0	0	110.6	I29 I31 F35 I36 E37	I29-T33 WeakPolarHBondContact O-CB 3.38Å; I29-T33 PolarHBondContact O-N 3.41Å; I29-T33 PolarHBondContact O-OG1 3.3Å; I29-T33 VanDerWaalsContact O-OG1 3.13Å; I31-T33 VanDerWaalsContact C-N 3.35Å; I31-T33 PolarHBondContact O-N 3.48Å; T33-F35 VanDerWaalsContact C-N 3.32Å; T33-F35 PolarHBondContact O-N 3.08Å; T33-I36 PolarHBondContact O-N 2.94Å; T33-I36 VanDerWaalsContact O-N 3.14Å; T33-E37 HydrophobicContact CG2-CG 4.24Å; T33-E37 WeakPolarHBondContact CG2-OE1 3.25Å; T33-E37 WeakPolarHBondContact O-CB 3.44Å; T33-E37 WeakPolarHBondContact O-CG 3.49Å; T33-E37 PolarHBondContact O-N 3.43Å
34	C	91.1	Very high	90	Very high	79 Å²	79	87.2 Å²	87.2	53%	0.534	46%	0.46	S	S	.	.	H	α-helix	trans	-58.2	-41.4	175.8	-178.9	0	0	0	0	112.6	E30 I31 A38	E30-C34 WeakPolarHBondContact O-CB 3.48Å; E30-C34 PolarHBondContact O-N 2.63Å; I31-C34 PolarHBondContact O-N 3.11Å; C34-A38 VanDerWaalsContact O-CB 3.3Å; C34-A38 WeakPolarHBondContact O-CB 3.33Å; C34-A38 PolarHBondContact O-N 3.24Å
35	F	90.9	Very high	90.3	Very high	117 Å²	117	84.9 Å²	84.9	51%	0.513	44%	0.443	S	S	.	.	H	α-helix	trans	-63.2	-43	175.1	-86.1	-72.7	0	0	0	112.9	V14 I31 L32 T33 A38 A39	V14-F35 HydrophobicContact CG1-CB 4.24Å; V14-F35 HydrophobicContact CG1-CD1 4.49Å; V14-F35 HydrophobicContact CG1-CD2 3.48Å; V14-F35 VanDerWaalsContact CG1-CD2 3.48Å; V14-F35 HydrophobicContact CG1-CE2 3.89Å; V14-F35 HydrophobicContact CG1-CG 3.84Å; V14-F35 HydrophobicContact CG2-CD1 4.42Å; V14-F35 HydrophobicContact CG2-CG 4.48Å; I31-F35 HydrophobicContact CG2-CD2 3.75Å; I31-F35 HydrophobicContact CG2-CE2 3.59Å; I31-F35 WeakPolarHBondContact O-CD2 3.42Å; I31-F35 PolarHBondContact O-N 3.38Å; L32-F35 PolarHBondContact O-N 2.86Å; T33-F35 VanDerWaalsContact C-N 3.32Å; T33-F35 PolarHBondContact O-N 3.08Å; F35-A38 PolarHBondContact O-N 3.25Å; F35-A39 WeakPolarHBondContact O-CB 3.41Å; F35-A39 PolarHBondContact O-N 2.69Å
36	I	89.8	Confident	90.6	Very high	94 Å²	94	84.2 Å²	84.2	48%	0.482	44%	0.438	S	S	.	.	H	α-helix	trans	-64.5	-49.3	178.3	-67.6	165.2	0	0	0	109.7	L32 T33 A38 A39 E40	L32-I36 WeakPolarHBondContact O-CG1 3.4Å; L32-I36 PolarHBondContact O-N 3.3Å; T33-I36 PolarHBondContact O-N 2.94Å; T33-I36 VanDerWaalsContact O-N 3.14Å; I36-A38 VanDerWaalsContact C-N 3.27Å; I36-A38 PolarHBondContact O-N 2.91Å; I36-A39 WeakPolarHBondContact O-CB 3.37Å; I36-A39 PolarHBondContact O-N 3.43Å; I36-A39 VanDerWaalsContact O-N 3.08Å; I36-E40 HydrophobicContact CG2-CG 4.43Å; I36-E40 WeakPolarHBondContact O-CG 3.38Å; I36-E40 PolarHBondContact O-N 3.21Å
37	E	91.8	Very high	91	Very high	92 Å²	92	79 Å²	79	43%	0.43	43%	0.427	S	S	.	.	H	α-helix	trans	-60.5	-35.5	178.6	-76.8	-177.2	-169.7	0	0	112.9	T33 K41	T33-E37 HydrophobicContact CG2-CG 4.24Å; T33-E37 WeakPolarHBondContact CG2-OE1 3.25Å; T33-E37 WeakPolarHBondContact O-CB 3.44Å; T33-E37 WeakPolarHBondContact O-CG 3.49Å; T33-E37 PolarHBondContact O-N 3.43Å; E37-K41 WeakPolarHBondContact O-CD 3.47Å; E37-K41 VanDerWaalsContact O-CG 3.25Å; E37-K41 WeakPolarHBondContact O-CG 3.3Å; E37-K41 PolarHBondContact O-N 3.21Å; E37-K41 PolarHBondContact O-NZ 3.28Å
38	A	91.6	Very high	91.3	Very high	45 Å²	45	81.6 Å²	81.6	37%	0.372	43%	0.434	S	S	.	.	H	α-helix	trans	-69.7	-43.4	173.6	0	0	0	0	0	111.2	C34 F35 I36 E40 K41 L42	C34-A38 VanDerWaalsContact O-CB 3.3Å; C34-A38 WeakPolarHBondContact O-CB 3.33Å; C34-A38 PolarHBondContact O-N 3.24Å; F35-A38 PolarHBondContact O-N 3.25Å; I36-A38 VanDerWaalsContact C-N 3.27Å; I36-A38 PolarHBondContact O-N 2.91Å; A38-E40 VanDerWaalsContact C-N 3.34Å; A38-E40 PolarHBondContact O-N 3.43Å; A38-K41 PolarHBondContact O-N 3.34Å; A38-L42 WeakPolarHBondContact O-CB 3.21Å; A38-L42 VanDerWaalsContact O-CG 3.28Å; A38-L42 WeakPolarHBondContact O-CG 3.33Å; A38-L42 PolarHBondContact O-N 2.8Å
39	A	91	Very high	91.6	Very high	56 Å²	56	82.8 Å²	82.8	46%	0.463	45%	0.445	S	S	.	.	H	α-helix	trans	-62.4	-40.4	177.3	0	0	0	0	0	112.1	F35 I36 L42 N43	F35-A39 WeakPolarHBondContact O-CB 3.41Å; F35-A39 PolarHBondContact O-N 2.69Å; I36-A39 WeakPolarHBondContact O-CB 3.37Å; I36-A39 PolarHBondContact O-N 3.43Å; I36-A39 VanDerWaalsContact O-N 3.08Å; A39-L42 PolarHBondContact O-N 3.04Å; A39-N43 WeakPolarHBondContact O-CB 3.32Å; A39-N43 PolarHBondContact O-N 3.22Å
40	E	91.8	Very high	91.9	Very high	121 Å²	121	83.6 Å²	83.6	57%	0.565	45%	0.454	S	S	*	.	H	α-helix	trans	-61.6	-45.7	175.1	-74.6	175.9	175.2	0	0	111.9	I36 A38 L42 N43 A44	I36-E40 HydrophobicContact CG2-CG 4.43Å; I36-E40 WeakPolarHBondContact O-CG 3.38Å; I36-E40 PolarHBondContact O-N 3.21Å; A38-E40 VanDerWaalsContact C-N 3.34Å; A38-E40 PolarHBondContact O-N 3.43Å; E40-L42 VanDerWaalsContact C-N 3.35Å; E40-L42 PolarHBondContact O-N 3.24Å; E40-N43 PolarHBondContact O-N 3.31Å; E40-A44 PolarHBondContact O-N 2.97Å
41	K	92	Very high	92.3	Very high	124 Å²	124	84.5 Å²	84.5	54%	0.539	46%	0.459	S	S	.	.	H	α-helix	trans	-62.9	-42.1	175.9	-69.7	168.8	-175.1	78.5	0	111.2	E37 A38 A44 T45	E37-K41 WeakPolarHBondContact O-CD 3.47Å; E37-K41 VanDerWaalsContact O-CG 3.25Å; E37-K41 WeakPolarHBondContact O-CG 3.3Å; E37-K41 PolarHBondContact O-N 3.21Å; E37-K41 PolarHBondContact O-NZ 3.28Å; A38-K41 PolarHBondContact O-N 3.34Å; K41-A44 PolarHBondContact O-N 3.14Å; K41-T45 WeakPolarHBondContact O-CG2 3.41Å; K41-T45 PolarHBondContact O-N 2.93Å; K41-T45 VanDerWaalsContact O-N 3.12Å; K41-T45 PolarHBondContact O-OG1 3.1Å
42	L	92	Very high	92.5	Very high	117 Å²	117	88.9 Å²	88.9	61%	0.613	48%	0.482	S	S	*	.	H	α-helix	trans	-62.4	-44.4	176.1	-72.5	172.6	0	0	0	111.9	A38 A39 E40 A44 T45 E46	A38-L42 WeakPolarHBondContact O-CB 3.21Å; A38-L42 VanDerWaalsContact O-CG 3.28Å; A38-L42 WeakPolarHBondContact O-CG 3.33Å; A38-L42 PolarHBondContact O-N 2.8Å; A39-L42 PolarHBondContact O-N 3.04Å; E40-L42 VanDerWaalsContact C-N 3.35Å; E40-L42 PolarHBondContact O-N 3.24Å; L42-A44 VanDerWaalsContact C-N 3.32Å; L42-A44 PolarHBondContact O-N 3.34Å; L42-T45 WeakPolarHBondContact CA-OG1 3.47Å; L42-T45 CarbonylContact O-C 3.59Å; L42-T45 PolarHBondContact O-N 3.46Å; L42-T45 PolarHBondContact O-OG1 3.03Å; L42-E46 PolarHBondContact O-N 2.86Å
43	N	92.3	Very high	92.8	Very high	111 Å²	111	90.2 Å²	90.2	59%	0.594	49%	0.489	S	S	*	.	H	α-helix	trans	-61.3	-40.3	176.2	-172.9	76.6	0	0	0	111.6	A39 E40 T45 E46	A39-N43 WeakPolarHBondContact O-CB 3.32Å; A39-N43 PolarHBondContact O-N 3.22Å; E40-N43 PolarHBondContact O-N 3.31Å; N43-T45 PolarHBondContact O-N 3.13Å; N43-E46 WeakPolarHBondContact O-CB 3.31Å; N43-E46 PolarHBondContact O-N 2.85Å
44	A	92.5	Very high	93.1	Very high	65 Å²	65	95.3 Å²	95.3	54%	0.537	50%	0.502	S	S	.	.	H	α-helix	trans	-64.3	-27.4	174.3	0	0	0	0	0	113	E40 K41 L42	E40-A44 PolarHBondContact O-N 2.97Å; K41-A44 PolarHBondContact O-N 3.14Å; L42-A44 VanDerWaalsContact C-N 3.32Å; L42-A44 PolarHBondContact O-N 3.34Å
45	T	94.6	Very high	93.3	Very high	15 Å²	15	95.2 Å²	95.2	9%	0.092	50%	0.5	C	S	.	.	H	α-helix	trans	-89.6	-12	178.2	59	0	0	0	0	115.2	K41 L42 N43 P47 F48 L49 I58 L62	K41-T45 WeakPolarHBondContact O-CG2 3.41Å; K41-T45 PolarHBondContact O-N 2.93Å; K41-T45 VanDerWaalsContact O-N 3.12Å; K41-T45 PolarHBondContact O-OG1 3.1Å; L42-T45 WeakPolarHBondContact CA-OG1 3.47Å; L42-T45 CarbonylContact O-C 3.59Å; L42-T45 PolarHBondContact O-N 3.46Å; L42-T45 PolarHBondContact O-OG1 3.03Å; N43-T45 PolarHBondContact O-N 3.13Å; T45-P47 VanDerWaalsContact C-N 3.32Å; T45-F48 HydrophobicContact CG2-CD2 4.41Å; T45-F48 WeakPolarHBondContact O-CB 3.49Å; T45-F48 PolarHBondContact O-N 3.47Å; T45-L49 PolarHBondContact O-N 3.29Å; T45-I58 HydrophobicContact CG2-CG2 3.74Å; T45-L62 HydrophobicContact CG2-CD1 3.64Å
46	E	94.3	Very high	93.6	Very high	109 Å²	109	94.9 Å²	94.9	51%	0.509	51%	0.507	S	S	.	.	H	α-helix	trans	-51.6	-42.6	-178.2	-175.6	176.3	-153.4	0	0	113.3	L42 N43 F48 L49 T50	L42-E46 PolarHBondContact O-N 2.86Å; N43-E46 WeakPolarHBondContact O-CB 3.31Å; N43-E46 PolarHBondContact O-N 2.85Å; E46-F48 VanDerWaalsContact C-N 3.26Å; E46-F48 PolarHBondContact O-N 3.23Å; E46-L49 WeakPolarHBondContact O-CB 3.34Å; E46-L49 PolarHBondContact O-N 2.82Å; E46-T50 PolarHBondContact O-N 3.42Å; E46-T50 VanDerWaalsContact O-N 3.12Å
47	P	95.6	Very high	94	Very high	67 Å²	67	94.7 Å²	94.7	44%	0.435	51%	0.505	S	S	.	.	H	α-helix	trans	-57.7	-36.6	177.4	-25.8	36	0	0	0	113.5	T45 L49 T50 Q51	T45-P47 VanDerWaalsContact C-N 3.32Å; P47-L49 VanDerWaalsContact C-N 3.32Å; P47-L49 PolarHBondContact O-N 3.02Å; P47-T50 PolarHBondContact O-N 3.3Å; P47-T50 PolarHBondContact O-OG1 3.1Å; P47-Q51 WeakPolarHBondContact O-CG 3.48Å; P47-Q51 PolarHBondContact O-N 2.99Å
48	F	95.2	Very high	94.1	Very high	84 Å²	84	91 Å²	91	37%	0.368	49%	0.487	S	S	.	.	H	α-helix	trans	-69.6	-32.7	179	-54.2	-54	0	0	0	112	T45 E46 Q51 I53 I58	T45-F48 HydrophobicContact CG2-CD2 4.41Å; T45-F48 WeakPolarHBondContact O-CB 3.49Å; T45-F48 PolarHBondContact O-N 3.47Å; E46-F48 VanDerWaalsContact C-N 3.26Å; E46-F48 PolarHBondContact O-N 3.23Å; F48-Q51 PolarHBondContact O-N 3.09Å; F48-I53 HydrophobicContact CB-CB 4.46Å; F48-I53 HydrophobicContact CB-CD1 4.08Å; F48-I53 HydrophobicContact CD1-CD1 4.16Å; F48-I53 WeakPolarHBondContact O-CB 3.33Å; F48-I53 PolarHBondContact O-N 3.05Å; F48-I58 HydrophobicContact CB-CD1 3.54Å; F48-I58 HydrophobicContact CB-CG1 3.87Å; F48-I58 HydrophobicContact CD2-CG2 4.2Å
49	L	93.4	Very high	94.3	Very high	89 Å²	89	93.3 Å²	93.3	47%	0.466	49%	0.493	S	S	.	.	H	α-helix	trans	-67.2	-38.8	173.6	-61.2	173.6	0	0	0	111	T45 E46 P47 Q51 D52 P55 I58	T45-L49 PolarHBondContact O-N 3.29Å; E46-L49 WeakPolarHBondContact O-CB 3.34Å; E46-L49 PolarHBondContact O-N 2.82Å; P47-L49 VanDerWaalsContact C-N 3.32Å; P47-L49 PolarHBondContact O-N 3.02Å; L49-Q51 PolarHBondContact O-N 3.5Å; L49-D52 PolarHBondContact O-N 3.4Å; L49-D52 VanDerWaalsContact O-N 3.15Å; L49-P55 HydrophobicContact CD2-CG 3.99Å; L49-I58 HydrophobicContact CD2-CD1 3.56Å; L49-I58 HydrophobicContact CG-CD1 4.06Å
50	T	94.6	Very high	94.6	Very high	113 Å²	113	93 Å²	93	69%	0.693	49%	0.49	S	S	*	.	H	α-helix	trans	-67.9	-19.2	176.1	67.3	0	0	0	0	113.6	E46 P47 D52	E46-T50 PolarHBondContact O-N 3.42Å; E46-T50 VanDerWaalsContact O-N 3.12Å; P47-T50 PolarHBondContact O-N 3.3Å; P47-T50 PolarHBondContact O-OG1 3.1Å; T50-D52 VanDerWaalsContact C-N 3.3Å
51	Q	95.2	Very high	94.9	Very high	127 Å²	127	90.2 Å²	90.2	59%	0.593	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.5	11.3	175	-68.2	175.7	2.5	0	0	113.3	P47 F48 L49 I53	P47-Q51 WeakPolarHBondContact O-CG 3.48Å; P47-Q51 PolarHBondContact O-N 2.99Å; F48-Q51 PolarHBondContact O-N 3.09Å; L49-Q51 PolarHBondContact O-N 3.5Å; Q51-I53 HydrophobicContact CB-CD1 4.38Å; Q51-I53 HydrophobicContact CB-CG1 4.16Å; Q51-I53 PolarHBondContact O-N 3.1Å
52	D	92.9	Very high	95	Very high	151 Å²	151	88.5 Å²	88.5	81%	0.807	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.7	24.9	-178.5	-156.2	28.3	0	0	0	113.6	L49 T50 R54	L49-D52 PolarHBondContact O-N 3.4Å; L49-D52 VanDerWaalsContact O-N 3.15Å; T50-D52 VanDerWaalsContact C-N 3.3Å; D52-R54 PolarHBondContact O-N 3.21Å
53	I	95.7	Very high	95.3	Very high	60 Å²	60	88.7 Å²	88.7	31%	0.308	48%	0.482	S	S	.	.			trans	-76	121.3	172.3	-55.3	178.9	0	0	0	108.2	F48 Q51 H57 I58	F48-I53 HydrophobicContact CB-CB 4.46Å; F48-I53 HydrophobicContact CB-CD1 4.08Å; F48-I53 HydrophobicContact CD1-CD1 4.16Å; F48-I53 WeakPolarHBondContact O-CB 3.33Å; F48-I53 PolarHBondContact O-N 3.05Å; Q51-I53 HydrophobicContact CB-CD1 4.38Å; Q51-I53 HydrophobicContact CB-CG1 4.16Å; Q51-I53 PolarHBondContact O-N 3.1Å; I53-H57 HydrophobicContact CG2-CB 4Å; I53-I58 HydrophobicContact CB-CD1 4.32Å; I53-I58 HydrophobicContact CB-CG1 4.13Å; I53-I58 HydrophobicContact CG2-CD1 4.36Å; I53-I58 HydrophobicContact CG2-CG1 3.65Å
54	R	96.9	Very high	95.5	Very high	165 Å²	165	85.8 Å²	85.8	62%	0.623	47%	0.473	S	S	*	.			trans	-56.1	133.1	178.7	-63.6	-170.6	-66.5	175.9	-8.1	110.5	D52 V56 H57 I58	D52-R54 PolarHBondContact O-N 3.21Å; R54-V56 PolarHBondContact O-N 3.28Å; R54-H57 PolarHBondContact NE-CE1 3.37Å; R54-H57 PolarHBondContact NH2-CE1 3.17Å; R54-H57 PolarHBondContact NH2-NE2 2.91Å; R54-H57 WeakPolarHBondContact O-CA 3.3Å; R54-H57 WeakPolarHBondContact O-CB 3.3Å; R54-H57 PolarHBondContact O-N 2.89Å; R54-I58 PolarHBondContact O-N 3.4Å
55	P	95.6	Very high	95.7	Very high	78 Å²	78	85 Å²	85	51%	0.506	47%	0.467	S	S	.	.	H	α-helix	trans	-51.4	-36.9	-178.4	-30.7	35.1	0	0	0	114.7	L49 H57 I58 I59	L49-P55 HydrophobicContact CD2-CG 3.99Å; P55-H57 PolarHBondContact O-N 2.86Å; P55-I58 PolarHBondContact O-N 3.4Å; P55-I59 WeakPolarHBondContact O-CG1 3.36Å; P55-I59 PolarHBondContact O-N 2.91Å
56	V	97.2	Very high	95.8	Very high	109 Å²	109	89.8 Å²	89.8	66%	0.661	49%	0.491	S	S	*	.	H	α-helix	trans	-58.6	-35.3	176.2	179.1	0	0	0	0	112.2	R54 A60	R54-V56 PolarHBondContact O-N 3.28Å; V56-A60 WeakPolarHBondContact O-CB 3.49Å; V56-A60 PolarHBondContact O-N 3.07Å; V56-A60 VanDerWaalsContact O-N 3.07Å
57	H	96.7	Very high	95.9	Very high	91 Å²	91	89 Å²	89	42%	0.421	49%	0.494	S	S	.	.	H	α-helix	trans	-76.3	-38	179.7	-64.4	50	0	0	0	110.9	I53 R54 P55 A60 A61	I53-H57 HydrophobicContact CG2-CB 4Å; R54-H57 PolarHBondContact NE-CE1 3.37Å; R54-H57 PolarHBondContact NH2-CE1 3.17Å; R54-H57 PolarHBondContact NH2-NE2 2.91Å; R54-H57 WeakPolarHBondContact O-CA 3.3Å; R54-H57 WeakPolarHBondContact O-CB 3.3Å; R54-H57 PolarHBondContact O-N 2.89Å; P55-H57 PolarHBondContact O-N 2.86Å; H57-A60 PolarHBondContact O-N 3.24Å; H57-A61 VanDerWaalsContact O-CB 3.3Å; H57-A61 WeakPolarHBondContact O-CB 3.4Å; H57-A61 PolarHBondContact O-N 2.91Å
58	I	95.9	Very high	96	Very high	13 Å²	13	91.2 Å²	91.2	7%	0.067	50%	0.502	C	S	.	.	H	α-helix	trans	-60.8	-47.9	174.5	-57.6	171	0	0	0	109.7	T45 F48 L49 I53 R54 P55 A61 L62	T45-I58 HydrophobicContact CG2-CG2 3.74Å; F48-I58 HydrophobicContact CB-CD1 3.54Å; F48-I58 HydrophobicContact CB-CG1 3.87Å; F48-I58 HydrophobicContact CD2-CG2 4.2Å; L49-I58 HydrophobicContact CD2-CD1 3.56Å; L49-I58 HydrophobicContact CG-CD1 4.06Å; I53-I58 HydrophobicContact CB-CD1 4.32Å; I53-I58 HydrophobicContact CB-CG1 4.13Å; I53-I58 HydrophobicContact CG2-CD1 4.36Å; I53-I58 HydrophobicContact CG2-CG1 3.65Å; R54-I58 PolarHBondContact O-N 3.4Å; P55-I58 PolarHBondContact O-N 3.4Å; I58-A61 PolarHBondContact O-N 3.31Å; I58-L62 HydrophobicContact CG2-CD1 4.1Å; I58-L62 HydrophobicContact CG2-CG 4.44Å; I58-L62 WeakPolarHBondContact O-CB 3.42Å; I58-L62 WeakPolarHBondContact O-CG 3.43Å; I58-L62 PolarHBondContact O-N 3.14Å
59	I	95.7	Very high	96	Very high	95 Å²	95	91.2 Å²	91.2	49%	0.487	51%	0.509	S	S	.	.	H	α-helix	trans	-61.1	-48.3	179	-66	165.4	0	0	0	110.6	P55 A61 L62 Q63	P55-I59 WeakPolarHBondContact O-CG1 3.36Å; P55-I59 PolarHBondContact O-N 2.91Å; I59-A61 VanDerWaalsContact C-N 3.32Å; I59-A61 PolarHBondContact O-N 3.43Å; I59-L62 PolarHBondContact O-N 3.1Å; I59-Q63 HydrophobicContact CG2-CG 4.41Å; I59-Q63 WeakPolarHBondContact O-CB 3.49Å; I59-Q63 VanDerWaalsContact O-CG 3.3Å; I59-Q63 WeakPolarHBondContact O-CG 3.3Å; I59-Q63 PolarHBondContact O-N 3.14Å
60	A	97.4	Very high	96.1	Very high	50 Å²	50	90.4 Å²	90.4	41%	0.413	51%	0.507	S	S	.	.	H	α-helix	trans	-60.4	-41.3	178.6	0	0	0	0	0	112.2	V56 H57 Q63 A64	V56-A60 WeakPolarHBondContact O-CB 3.49Å; V56-A60 PolarHBondContact O-N 3.07Å; V56-A60 VanDerWaalsContact O-N 3.07Å; H57-A60 PolarHBondContact O-N 3.24Å; A60-Q63 PolarHBondContact O-N 3.02Å; A60-A64 WeakPolarHBondContact O-CB 3.24Å; A60-A64 PolarHBondContact O-N 2.94Å
61	A	96.2	Very high	96.1	Very high	61 Å²	61	87 Å²	87	50%	0.504	49%	0.49	S	S	.	.	H	α-helix	trans	-66.2	-42.3	177	0	0	0	0	0	112.3	H57 I58 I59 Q63 A64 A65	H57-A61 VanDerWaalsContact O-CB 3.3Å; H57-A61 WeakPolarHBondContact O-CB 3.4Å; H57-A61 PolarHBondContact O-N 2.91Å; I58-A61 PolarHBondContact O-N 3.31Å; I59-A61 VanDerWaalsContact C-N 3.32Å; I59-A61 PolarHBondContact O-N 3.43Å; A61-Q63 VanDerWaalsContact C-N 3.34Å; A61-A64 PolarHBondContact O-N 3.3Å; A61-A65 WeakPolarHBondContact O-CB 3.35Å; A61-A65 PolarHBondContact O-N 2.94Å
62	L	95.8	Very high	96.1	Very high	88 Å²	88	86 Å²	86	46%	0.461	49%	0.486	S	S	.	.	H	α-helix	trans	-64.3	-38.5	175.1	-73.4	175	0	0	0	112.2	T45 I58 I59 A65 L66	T45-L62 HydrophobicContact CG2-CD1 3.64Å; I58-L62 HydrophobicContact CG2-CD1 4.1Å; I58-L62 HydrophobicContact CG2-CG 4.44Å; I58-L62 WeakPolarHBondContact O-CB 3.42Å; I58-L62 WeakPolarHBondContact O-CG 3.43Å; I58-L62 PolarHBondContact O-N 3.14Å; I59-L62 PolarHBondContact O-N 3.1Å; L62-A65 PolarHBondContact O-N 3.49Å; L62-L66 VanDerWaalsContact O-CB 3.3Å; L62-L66 WeakPolarHBondContact O-CB 3.38Å; L62-L66 PolarHBondContact O-N 2.88Å
63	Q	96.9	Very high	96.1	Very high	122 Å²	122	81.2 Å²	81.2	57%	0.57	46%	0.464	S	S	*	.	H	α-helix	trans	-65	-43.4	175.4	-74.2	175.3	-38.9	0	0	111.7	I59 A60 A61 L66 T67	I59-Q63 HydrophobicContact CG2-CG 4.41Å; I59-Q63 WeakPolarHBondContact O-CB 3.49Å; I59-Q63 VanDerWaalsContact O-CG 3.3Å; I59-Q63 WeakPolarHBondContact O-CG 3.3Å; I59-Q63 PolarHBondContact O-N 3.14Å; A60-Q63 PolarHBondContact O-N 3.02Å; A61-Q63 VanDerWaalsContact C-N 3.34Å; Q63-L66 PolarHBondContact O-N 3.35Å; Q63-T67 WeakPolarHBondContact O-CB 3.49Å; Q63-T67 PolarHBondContact O-N 3.5Å; Q63-T67 PolarHBondContact O-OG1 3.36Å
64	A	97.5	Very high	95.8	Very high	50 Å²	50	83.8 Å²	83.8	41%	0.413	48%	0.478	S	S	.	.	H	α-helix	trans	-61.9	-49.9	174.5	0	0	0	0	0	111	A60 A61 L66 T67 D68	A60-A64 WeakPolarHBondContact O-CB 3.24Å; A60-A64 PolarHBondContact O-N 2.94Å; A61-A64 PolarHBondContact O-N 3.3Å; A64-L66 VanDerWaalsContact C-N 3.33Å; A64-L66 PolarHBondContact O-N 3.37Å; A64-T67 WeakPolarHBondContact O-CA 3.27Å; A64-T67 WeakPolarHBondContact O-CB 3.3Å; A64-T67 PolarHBondContact O-N 2.93Å; A64-D68 PolarHBondContact O-N 2.95Å
65	A	96.2	Very high	95.5	Very high	49 Å²	49	83 Å²	83	41%	0.405	48%	0.481	S	S	.	.	H	α-helix	trans	-59.7	-41.2	178.5	0	0	0	0	0	112.6	A61 L62 T67 D68 V69	A61-A65 WeakPolarHBondContact O-CB 3.35Å; A61-A65 PolarHBondContact O-N 2.94Å; L62-A65 PolarHBondContact O-N 3.49Å; A65-T67 VanDerWaalsContact C-N 3.34Å; A65-D68 PolarHBondContact O-N 3.5Å; A65-V69 VanDerWaalsContact O-CG2 3.27Å; A65-V69 WeakPolarHBondContact O-CG2 3.45Å; A65-V69 PolarHBondContact O-N 2.78Å
66	L	96.2	Very high	95.1	Very high	114 Å²	114	86.5 Å²	86.5	60%	0.597	49%	0.489	S	S	*	.	H	α-helix	trans	-63.6	-41.3	175.1	179.8	61.8	0	0	0	111.5	L62 Q63 A64 D68 V69 V70	L62-L66 VanDerWaalsContact O-CB 3.3Å; L62-L66 WeakPolarHBondContact O-CB 3.38Å; L62-L66 PolarHBondContact O-N 2.88Å; Q63-L66 PolarHBondContact O-N 3.35Å; A64-L66 VanDerWaalsContact C-N 3.33Å; A64-L66 PolarHBondContact O-N 3.37Å; L66-D68 VanDerWaalsContact C-N 3.33Å; L66-D68 PolarHBondContact O-N 3.06Å; L66-V69 PolarHBondContact O-N 3.3Å; L66-V70 HydrophobicContact CD1-CG2 4.3Å; L66-V70 VanDerWaalsContact O-CG2 3.3Å; L66-V70 WeakPolarHBondContact O-CG2 3.5Å; L66-V70 PolarHBondContact O-N 3.02Å
67	T	97.4	Very high	94.5	Very high	94 Å²	94	88.6 Å²	88.6	58%	0.577	49%	0.493	S	S	*	.	H	α-helix	trans	-61	-44.5	176.7	-55.9	0	0	0	0	110.9	Q63 A64 A65 V70 A71	Q63-T67 WeakPolarHBondContact O-CB 3.49Å; Q63-T67 PolarHBondContact O-N 3.5Å; Q63-T67 PolarHBondContact O-OG1 3.36Å; A64-T67 WeakPolarHBondContact O-CA 3.27Å; A64-T67 WeakPolarHBondContact O-CB 3.3Å; A64-T67 PolarHBondContact O-N 2.93Å; A65-T67 VanDerWaalsContact C-N 3.34Å; T67-V70 PolarHBondContact O-N 3.4Å; T67-A71 WeakPolarHBondContact O-CB 3.33Å; T67-A71 PolarHBondContact O-N 2.91Å
68	D	97.3	Very high	93.5	Very high	112 Å²	112	86.8 Å²	86.8	60%	0.599	50%	0.499	S	S	*	.	H	α-helix	trans	-64.3	-42.6	177.9	-66.4	-19	0	0	0	111.8	A64 A65 L66 A71 H72	A64-D68 PolarHBondContact O-N 2.95Å; A65-D68 PolarHBondContact O-N 3.5Å; L66-D68 VanDerWaalsContact C-N 3.33Å; L66-D68 PolarHBondContact O-N 3.06Å; D68-A71 PolarHBondContact O-N 2.97Å; D68-H72 WeakPolarHBondContact O-CB 3.27Å; D68-H72 PolarHBondContact O-N 3.34Å
69	V	96	Very high	92.6	Very high	84 Å²	84	89 Å²	89	51%	0.509	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-44.1	176.7	169.4	0	0	0	0	111.1	A65 L66 H72 C73	A65-V69 VanDerWaalsContact O-CG2 3.27Å; A65-V69 WeakPolarHBondContact O-CG2 3.45Å; A65-V69 PolarHBondContact O-N 2.78Å; L66-V69 PolarHBondContact O-N 3.3Å; V69-H72 PolarHBondContact O-N 2.87Å; V69-C73 WeakPolarHBondContact O-CB 3.49Å; V69-C73 PolarHBondContact O-N 3.37Å; V69-C73 PolarHBondContact O-SG 3.37Å
70	V	95.3	Very high	91.7	Very high	72 Å²	72	92.3 Å²	92.3	44%	0.436	54%	0.544	S	S	.	.	H	α-helix	trans	-63.2	-43.9	177.6	170.2	0	0	0	0	110.8	L66 T67 H72 C73 N74	L66-V70 HydrophobicContact CD1-CG2 4.3Å; L66-V70 VanDerWaalsContact O-CG2 3.3Å; L66-V70 WeakPolarHBondContact O-CG2 3.5Å; L66-V70 PolarHBondContact O-N 3.02Å; T67-V70 PolarHBondContact O-N 3.4Å; V70-H72 VanDerWaalsContact C-N 3.35Å; V70-H72 PolarHBondContact O-N 3.29Å; V70-C73 PolarHBondContact O-N 3.28Å; V70-N74 VanDerWaalsContact O-CG 3.29Å; V70-N74 PolarHBondContact O-N 2.81Å; V70-N74 PolarHBondContact O-ND2 3.45Å
71	A	94.7	Very high	90.9	Very high	41 Å²	41	93.5 Å²	93.5	34%	0.339	54%	0.543	S	S	.	.	H	α-helix	trans	-59.7	-46.5	174.9	0	0	0	0	0	111.2	T67 D68 C73 N74 E75	T67-A71 WeakPolarHBondContact O-CB 3.33Å; T67-A71 PolarHBondContact O-N 2.91Å; D68-A71 PolarHBondContact O-N 2.97Å; A71-C73 PolarHBondContact O-N 2.96Å; A71-N74 PolarHBondContact O-N 3.31Å; A71-E75 WeakPolarHBondContact O-CG 3.32Å; A71-E75 PolarHBondContact O-N 2.95Å
72	H	94.6	Very high	90.1	Very high	108 Å²	108	94.4 Å²	94.4	50%	0.5	54%	0.539	S	S	.	.	H	α-helix	trans	-60.3	-44.8	177.9	-172.4	77.5	0	0	0	112.8	D68 V69 V70 E75 K76	D68-H72 WeakPolarHBondContact O-CB 3.27Å; D68-H72 PolarHBondContact O-N 3.34Å; V69-H72 PolarHBondContact O-N 2.87Å; V70-H72 VanDerWaalsContact C-N 3.35Å; V70-H72 PolarHBondContact O-N 3.29Å; H72-E75 PolarHBondContact O-N 2.86Å; H72-K76 WeakPolarHBondContact O-CB 3.48Å; H72-K76 WeakPolarHBondContact O-CG 3.5Å; H72-K76 PolarHBondContact O-N 3.5Å
73	C	93.2	Very high	89.5	Confident	50 Å²	50	96.3 Å²	96.3	34%	0.338	55%	0.548	S	S	.	.	H	α-helix	trans	-61.4	-43.8	175.7	-71.3	0	0	0	0	111.4	V69 V70 A71 E75 M77 G78	V69-C73 WeakPolarHBondContact O-CB 3.49Å; V69-C73 PolarHBondContact O-N 3.37Å; V69-C73 PolarHBondContact O-SG 3.37Å; V70-C73 PolarHBondContact O-N 3.28Å; A71-C73 PolarHBondContact O-N 2.96Å; C73-E75 VanDerWaalsContact C-N 3.34Å; C73-E75 PolarHBondContact O-N 3.24Å; C73-M77 CarbonylContact O-C 3.55Å; C73-M77 WeakPolarHBondContact O-CA 3.49Å; C73-M77 VanDerWaalsContact O-CB 3.27Å; C73-M77 WeakPolarHBondContact O-CB 3.4Å; C73-M77 PolarHBondContact O-N 3.44Å; C73-G78 PolarHBondContact O-N 3.12Å; C73-G78 VanDerWaalsContact O-N 3.12Å
74	N	89.8	Confident	89	Confident	114 Å²	114	97.3 Å²	97.3	61%	0.61	56%	0.558	S	S	*	*	H	α-helix	trans	-64.4	-38.4	177.9	-71.4	-25.5	0	0	0	112.4	V70 A71 G78	V70-N74 VanDerWaalsContact O-CG 3.29Å; V70-N74 PolarHBondContact O-N 2.81Å; V70-N74 PolarHBondContact O-ND2 3.45Å; A71-N74 PolarHBondContact O-N 3.31Å; N74-G78 WeakPolarHBondContact O-CA 3.33Å; N74-G78 PolarHBondContact O-N 2.94Å
75	E	89.5	Confident	88.4	Confident	149 Å²	149	97.8 Å²	97.8	70%	0.696	55%	0.553	S	S	*	*	H	α-helix	trans	-75.1	-37.3	179.7	-72.8	176.4	-171.4	0	0	113.7	A71 H72 C73	A71-E75 WeakPolarHBondContact O-CG 3.32Å; A71-E75 PolarHBondContact O-N 2.95Å; H72-E75 PolarHBondContact O-N 2.86Å; C73-E75 VanDerWaalsContact C-N 3.34Å; C73-E75 PolarHBondContact O-N 3.24Å
76	K	88.5	Confident	87.9	Confident	151 Å²	151	102.5 Å²	102.5	66%	0.657	57%	0.567	S	S	*	*	H	α-helix	trans	-100.8	-33.6	-171.5	-63.2	-59.9	-176.7	-174.5	0	114.1	H72	H72-K76 WeakPolarHBondContact O-CB 3.48Å; H72-K76 WeakPolarHBondContact O-CG 3.5Å; H72-K76 PolarHBondContact O-N 3.5Å
77	M	82.9	Confident	87.4	Confident	152 Å²	152	104.2 Å²	104.2	75%	0.749	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.2	-15.8	-176.3	-54.3	179.5	66.5	0	0	112.3	C73 G79	C73-M77 CarbonylContact O-C 3.55Å; C73-M77 WeakPolarHBondContact O-CA 3.49Å; C73-M77 VanDerWaalsContact O-CB 3.27Å; C73-M77 WeakPolarHBondContact O-CB 3.4Å; C73-M77 PolarHBondContact O-N 3.44Å; M77-G79 PolarHBondContact O-N 3.38Å
78	G	76.9	Confident	86.7	Confident	53 Å²	53	101.9 Å²	101.9	55%	0.546	56%	0.557	S	S	.	*			trans	-67.4	92.8	174.1	0	0	0	0	0	111.4	C73 N74	C73-G78 PolarHBondContact O-N 3.12Å; C73-G78 VanDerWaalsContact O-N 3.12Å; N74-G78 WeakPolarHBondContact O-CA 3.33Å; N74-G78 PolarHBondContact O-N 2.94Å
79	G	77.1	Confident	86.1	Confident	61 Å²	61	99.7 Å²	99.7	63%	0.629	55%	0.545	S	S	*	.			trans	-71.5	135.1	165	0	0	0	0	0	110.4	M77 I81	M77-G79 PolarHBondContact O-N 3.38Å; G79-I81 PolarHBondContact O-N 2.82Å
80	N	77.2	Confident	85.7	Confident	163 Å²	163	100.8 Å²	100.8	87%	0.872	55%	0.548	S	S	*	.			trans	-75.9	107.4	170.4	-170.4	-0.8	0	0	0	109	N82	N80-N82 PolarHBondContact O-N 3.46Å
81	I	79.1	Confident	85.2	Confident	76 Å²	76	102.6 Å²	102.6	39%	0.39	56%	0.555	S	S	.	*			trans	-85.8	112	177	-60.9	168.4	0	0	0	108.2	G79 I83 T88 L89 V92	G79-I81 PolarHBondContact O-N 2.82Å; I81-I83 PolarHBondContact O-N 3.22Å; I81-T88 HydrophobicContact CG2-CG2 4.34Å; I81-L89 HydrophobicContact CG2-CD2 3.82Å; I81-V92 HydrophobicContact CD1-CG1 4.18Å; I81-V92 HydrophobicContact CD1-CG2 3.77Å; I81-V92 HydrophobicContact CG1-CG2 4.08Å; I81-V92 HydrophobicContact CG2-CG2 4.5Å
82	N	79.6	Confident	84.6	Confident	80 Å²	80	102.9 Å²	102.9	43%	0.428	55%	0.553	S	S	.	*			trans	-76	105.5	170	-179.3	8	0	0	0	109.7	N80 N84 N85	N80-N82 PolarHBondContact O-N 3.46Å; N82-N84 PolarHBondContact O-N 2.94Å; N82-N84 VanDerWaalsContact O-N 3.1Å; N82-N84 WeakPolarHBondContact OD1-CB 3.37Å; N82-N84 PolarHBondContact OD1-N 3.45Å; N82-N84 PolarHBondContact OD1-ND2 3.18Å; N82-N85 HydrophobicContact CB-CB 4.3Å; N82-N85 PolarHBondContact O-N 2.99Å
83	I	83.4	Confident	84.1	Confident	128 Å²	128	101.9 Å²	101.9	66%	0.656	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.5	-12.5	178.1	61.6	170.9	0	0	0	114.5	I81 L89	I81-I83 PolarHBondContact O-N 3.22Å; I83-L89 WeakPolarHBondContact O-CD1 3.49Å
84	N	86.7	Confident	83.7	Confident	143 Å²	143	103 Å²	103	77%	0.765	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-7.3	174.2	-55.9	-63.5	0	0	0	112.7	N82	N82-N84 PolarHBondContact O-N 2.94Å; N82-N84 VanDerWaalsContact O-N 3.1Å; N82-N84 WeakPolarHBondContact OD1-CB 3.37Å; N82-N84 PolarHBondContact OD1-N 3.45Å; N82-N84 PolarHBondContact OD1-ND2 3.18Å
85	N	84.3	Confident	83.2	Confident	60 Å²	60	101.5 Å²	101.5	32%	0.321	56%	0.564	S	S	.	*			trans	-98.9	100.2	175.9	-170.5	-0.9	0	0	0	110	N82 E87 T88 L89	N82-N85 HydrophobicContact CB-CB 4.3Å; N82-N85 PolarHBondContact O-N 2.99Å; N85-E87 PolarHBondContact O-N 3.4Å; N85-E87 WeakPolarHBondContact OD1-CB 3.46Å; N85-E87 PolarHBondContact OD1-N 3.37Å; N85-T88 PolarHBondContact ND2-OG1 3.23Å; N85-T88 PolarHBondContact O-N 2.96Å; N85-L89 PolarHBondContact O-N 3.25Å
86	E	85.6	Confident	82.5	Confident	148 Å²	148	100 Å²	100	69%	0.692	56%	0.564	S	S	*	*	H	α-helix	trans	-56.5	-37.1	178.6	-171.9	175.3	178.4	0	0	112.3	L89 L90	E86-L89 PolarHBondContact O-N 2.85Å; E86-L90 HydrophobicContact CG-CD1 4.21Å; E86-L90 HydrophobicContact CG-CG 4.5Å; E86-L90 VanDerWaalsContact O-CG 3.31Å; E86-L90 WeakPolarHBondContact O-CG 3.25Å; E86-L90 PolarHBondContact O-N 3.45Å
87	E	85.5	Confident	80.7	Confident	150 Å²	150	102.6 Å²	102.6	70%	0.701	59%	0.585	S	S	*	*	H	α-helix	trans	-64.4	-43.6	178.1	-172.8	178.9	-165.2	0	0	111.7	N85 L89 L90 D91	N85-E87 PolarHBondContact O-N 3.4Å; N85-E87 WeakPolarHBondContact OD1-CB 3.46Å; N85-E87 PolarHBondContact OD1-N 3.37Å; E87-L89 VanDerWaalsContact C-N 3.33Å; E87-L89 PolarHBondContact O-N 3.41Å; E87-L90 PolarHBondContact O-N 2.7Å; E87-D91 WeakPolarHBondContact O-CB 3.43Å; E87-D91 PolarHBondContact O-N 3.35Å
88	T	83	Confident	80.6	Confident	45 Å²	45	100.2 Å²	100.2	28%	0.276	58%	0.577	S	S	.	*	H	α-helix	trans	-65.8	-36.7	175.7	-53.4	0	0	0	0	111.6	I81 N85 V92	I81-T88 HydrophobicContact CG2-CG2 4.34Å; N85-T88 PolarHBondContact ND2-OG1 3.23Å; N85-T88 PolarHBondContact O-N 2.96Å; T88-V92 VanDerWaalsContact O-CG2 3.25Å; T88-V92 WeakPolarHBondContact O-CG2 3.36Å; T88-V92 PolarHBondContact O-N 3.06Å
89	L	85.7	Confident	80.8	Confident	66 Å²	66	102.6 Å²	102.6	35%	0.346	58%	0.579	S	S	.	*	H	α-helix	trans	-67.3	-40.6	176.1	-71.4	178.6	0	0	0	112	I81 I83 N85 E86 E87 V92 C93	I81-L89 HydrophobicContact CG2-CD2 3.82Å; I83-L89 WeakPolarHBondContact O-CD1 3.49Å; N85-L89 PolarHBondContact O-N 3.25Å; E86-L89 PolarHBondContact O-N 2.85Å; E87-L89 VanDerWaalsContact C-N 3.33Å; E87-L89 PolarHBondContact O-N 3.41Å; L89-V92 PolarHBondContact O-N 2.88Å; L89-C93 WeakPolarHBondContact O-CB 3.31Å; L89-C93 PolarHBondContact O-N 3.18Å; L89-C93 PolarHBondContact O-SG 2.87Å
90	L	86.2	Confident	81	Confident	107 Å²	107	104.9 Å²	104.9	56%	0.56	58%	0.576	S	S	*	*	H	α-helix	trans	-65.1	-42.9	175.9	-72.4	170.8	0	0	0	111.8	E86 E87 C93 S94	E86-L90 HydrophobicContact CG-CD1 4.21Å; E86-L90 HydrophobicContact CG-CG 4.5Å; E86-L90 VanDerWaalsContact O-CG 3.31Å; E86-L90 WeakPolarHBondContact O-CG 3.25Å; E86-L90 PolarHBondContact O-N 3.45Å; E87-L90 PolarHBondContact O-N 2.7Å; L90-C93 PolarHBondContact O-N 3.48Å; L90-S94 WeakPolarHBondContact O-CB 3.4Å; L90-S94 PolarHBondContact O-N 2.89Å; L90-S94 PolarHBondContact O-OG 3.05Å
91	D	84.9	Confident	81.2	Confident	110 Å²	110	101.5 Å²	101.5	59%	0.588	56%	0.559	S	S	*	*	H	α-helix	trans	-57.6	-49.5	174.9	-171.4	44.6	0	0	0	110.9	E87 C93 S94 S95	E87-D91 WeakPolarHBondContact O-CB 3.43Å; E87-D91 PolarHBondContact O-N 3.35Å; D91-C93 PolarHBondContact O-N 3.48Å; D91-S94 PolarHBondContact O-N 3.2Å; D91-S94 PolarHBondContact O-OG 3.22Å; D91-S95 WeakPolarHBondContact O-CB 3.5Å; D91-S95 PolarHBondContact O-N 3.29Å
92	V	83.8	Confident	81.3	Confident	47 Å²	47	103.1 Å²	103.1	29%	0.285	57%	0.569	S	S	.	*	H	α-helix	trans	-58.6	-47.6	174.4	172.9	0	0	0	0	111.6	I81 T88 L89 S94 S95 V96	I81-V92 HydrophobicContact CD1-CG1 4.18Å; I81-V92 HydrophobicContact CD1-CG2 3.77Å; I81-V92 HydrophobicContact CG1-CG2 4.08Å; I81-V92 HydrophobicContact CG2-CG2 4.5Å; T88-V92 VanDerWaalsContact O-CG2 3.25Å; T88-V92 WeakPolarHBondContact O-CG2 3.36Å; T88-V92 PolarHBondContact O-N 3.06Å; L89-V92 PolarHBondContact O-N 2.88Å; V92-S94 VanDerWaalsContact C-N 3.32Å; V92-S94 PolarHBondContact O-N 3.26Å; V92-S95 PolarHBondContact O-N 3.1Å; V92-S95 PolarHBondContact O-OG 3.34Å; V92-V96 WeakPolarHBondContact O-CG2 3.41Å; V92-V96 PolarHBondContact O-N 3.01Å
93	C	83.7	Confident	81.4	Confident	86 Å²	86	104.7 Å²	104.7	58%	0.581	58%	0.579	S	S	*	*	H	α-helix	trans	-59.4	-42.8	178	-82.5	0	0	0	0	112	L89 L90 D91 S95 V96	L89-C93 WeakPolarHBondContact O-CB 3.31Å; L89-C93 PolarHBondContact O-N 3.18Å; L89-C93 PolarHBondContact O-SG 2.87Å; L90-C93 PolarHBondContact O-N 3.48Å; D91-C93 PolarHBondContact O-N 3.48Å; C93-S95 VanDerWaalsContact C-N 3.31Å; C93-S95 PolarHBondContact O-N 2.97Å; C93-V96 PolarHBondContact O-N 3.49Å
94	S	84.4	Confident	81.3	Confident	73 Å²	73	103 Å²	103	51%	0.51	57%	0.573	S	S	.	*	H	α-helix	trans	-70.3	-24.3	178	70.4	0	0	0	0	114.1	L90 D91 V92 V96	L90-S94 WeakPolarHBondContact O-CB 3.4Å; L90-S94 PolarHBondContact O-N 2.89Å; L90-S94 PolarHBondContact O-OG 3.05Å; D91-S94 PolarHBondContact O-N 3.2Å; D91-S94 PolarHBondContact O-OG 3.22Å; V92-S94 VanDerWaalsContact C-N 3.32Å; V92-S94 PolarHBondContact O-N 3.26Å; S94-V96 VanDerWaalsContact C-N 3.31Å
95	S	79.9	Confident	80.9	Confident	84 Å²	84	99.9 Å²	99.9	59%	0.587	56%	0.558	S	S	*	*	H	α-helix	trans	-78	-14.6	177	73.2	0	0	0	0	113.9	D91 V92 C93	D91-S95 WeakPolarHBondContact O-CB 3.5Å; D91-S95 PolarHBondContact O-N 3.29Å; V92-S95 PolarHBondContact O-N 3.1Å; V92-S95 PolarHBondContact O-OG 3.34Å; C93-S95 VanDerWaalsContact C-N 3.31Å; C93-S95 PolarHBondContact O-N 2.97Å
96	V	73.7	Confident	80.6	Confident	118 Å²	118	103.3 Å²	103.3	72%	0.715	58%	0.578	S	S	*	*			trans	-91.7	-13.7	-176.7	174.5	0	0	0	0	112.5	V92 C93 S94	V92-V96 WeakPolarHBondContact O-CG2 3.41Å; V92-V96 PolarHBondContact O-N 3.01Å; C93-V96 PolarHBondContact O-N 3.49Å; S94-V96 VanDerWaalsContact C-N 3.31Å
97	D	50.9	Low	80.1	Confident	205 Å²	205	99.2 Å²	99.2	100%	1.096	57%	0.568	S	S	*	*			trans	-78.8	0	171.9	-75.3	-27.4	0	0	0	112.2

Retrieved 97 of 97 residues in 69.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).