A0A077ZH49_TRITR Loading...

Putative acyl-coenzyme A binding protein

AlphaFold DB , UniProt , Accession A0A077ZH49, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 76 aa.

						>A0A077ZH49_TRITR|A0A077ZH49
FKGTGRDTRLEYKLFSLFHRVSYITRVQLNAVKRFLSLKARSKWNAWKCCKGMSKEEAMKSYIEKAQALIGKYGLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	F	38.2	Very low	63.1	Low	269 Å²	269	137.2 Å²	137.2	100%	1.18	72%	0.715	S	S	*	*				0	125.3	0	-113.1	-104.2	0	0	0	108.1
2	K	42.2	Very low	65.1	Low	205 Å²	205	139.5 Å²	139.5	89%	0.891	71%	0.709	S	S	*	*			trans	-53.2	136	-175.4	-84	172.6	167.5	175.2	0	111.9	T4	K2-T4 PolarHBondContact O-N 2.83Å
3	G	45.8	Very low	67.2	Low	80 Å²	80	139.3 Å²	139.3	83%	0.825	70%	0.701	S	S	*	*			trans	-62.5	118.1	174.8	0	0	0	0	0	111.8
4	T	56.3	Low	68.9	Low	119 Å²	119	138.3 Å²	138.3	73%	0.73	70%	0.697	S	S	*	*			trans	-107.7	90.1	151.1	57.3	0	0	0	0	104.7	K2 R6	K2-T4 PolarHBondContact O-N 2.83Å; T4-R6 PolarHBondContact O-N 3.4Å
5	G	56.3	Low	70.4	Confident	78 Å²	78	137.2 Å²	137.2	80%	0.804	69%	0.687	S	S	*	*			trans	-60.7	89.1	167.5	0	0	0	0	0	106.7	D7	G5-D7 VanDerWaalsContact C-N 3.31Å; G5-D7 PolarHBondContact O-N 2.88Å
6	R	60.5	Low	71.8	Confident	183 Å²	183	133 Å²	133	69%	0.691	67%	0.674	S	S	*	*			trans	-55.2	107	167.6	-81.2	-175.6	-79.3	158	-5.9	104	T4 T8	T4-R6 PolarHBondContact O-N 3.4Å; R6-T8 PolarHBondContact O-N 2.89Å
7	D	68.7	Low	73.1	Confident	84 Å²	84	130.9 Å²	130.9	45%	0.449	66%	0.664	S	S	.	*			trans	-65.6	89.7	-179.1	-169.9	-18.7	0	0	0	106.1	G5 R9 L10 E11	G5-D7 VanDerWaalsContact C-N 3.31Å; G5-D7 PolarHBondContact O-N 2.88Å; D7-R9 PolarHBondContact O-N 3.45Å; D7-R9 WeakPolarHBondContact OD1-CB 3.48Å; D7-R9 PolarHBondContact OD1-N 3.37Å; D7-L10 HydrophobicContact CB-CB 4.27Å; D7-L10 HydrophobicContact CB-CD1 3.91Å; D7-L10 HydrophobicContact CB-CG 3.93Å; D7-L10 WeakPolarHBondContact O-CB 3.25Å; D7-L10 PolarHBondContact O-N 3.44Å; D7-E11 PolarHBondContact O-N 3Å
8	T	75.2	Confident	74.1	Confident	82 Å²	82	131.3 Å²	131.3	50%	0.503	66%	0.661	S	S	.	*	H	α-helix	trans	-53.2	-29.1	-177.5	50.9	0	0	0	0	110.1	R6 L10 E11 Y12	R6-T8 PolarHBondContact O-N 2.89Å; T8-L10 PolarHBondContact O-N 2.97Å; T8-E11 PolarHBondContact O-N 3.31Å; T8-Y12 WeakPolarHBondContact O-CD2 3.37Å; T8-Y12 PolarHBondContact O-N 3.49Å
9	R	80.8	Confident	74.9	Confident	201 Å²	201	129.4 Å²	129.4	76%	0.758	65%	0.65	S	S	*	*	H	α-helix	trans	-62.4	-40.4	174.3	-165.1	-176.2	179.4	-178	1.1	112.7	D7 K13	D7-R9 PolarHBondContact O-N 3.45Å; D7-R9 WeakPolarHBondContact OD1-CB 3.48Å; D7-R9 PolarHBondContact OD1-N 3.37Å; R9-K13 VanDerWaalsContact O-CB 3.32Å; R9-K13 WeakPolarHBondContact O-CB 3.33Å; R9-K13 PolarHBondContact O-N 2.84Å
10	L	84.4	Confident	75.7	Confident	111 Å²	111	131.9 Å²	131.9	58%	0.581	65%	0.651	S	S	*	*	H	α-helix	trans	-69.1	-41.1	176.5	-66.4	-179.4	0	0	0	111	D7 T8 K13 L14	D7-L10 HydrophobicContact CB-CB 4.27Å; D7-L10 HydrophobicContact CB-CD1 3.91Å; D7-L10 HydrophobicContact CB-CG 3.93Å; D7-L10 WeakPolarHBondContact O-CB 3.25Å; D7-L10 PolarHBondContact O-N 3.44Å; T8-L10 PolarHBondContact O-N 2.97Å; L10-K13 PolarHBondContact O-N 3.4Å; L10-L14 WeakPolarHBondContact O-CB 3.38Å; L10-L14 PolarHBondContact O-N 2.88Å
11	E	85.8	Confident	76.4	Confident	97 Å²	97	129.9 Å²	129.9	45%	0.453	65%	0.646	S	S	.	*	H	α-helix	trans	-61.1	-48.1	176	-65.6	-177.8	152.4	0	0	111.2	D7 T8 K13 L14 F15	D7-E11 PolarHBondContact O-N 3Å; T8-E11 PolarHBondContact O-N 3.31Å; E11-K13 VanDerWaalsContact C-N 3.32Å; E11-K13 PolarHBondContact O-N 3.23Å; E11-L14 PolarHBondContact O-N 3.2Å; E11-F15 WeakPolarHBondContact O-CB 3.49Å; E11-F15 PolarHBondContact O-N 3.42Å
12	Y	86.8	Confident	78.6	Confident	165 Å²	165	119.1 Å²	119.1	65%	0.647	60%	0.604	S	S	*	*	H	α-helix	trans	-62.7	-37.3	176.1	-75	-59.3	0	0	0	112.7	T8 S16	T8-Y12 WeakPolarHBondContact O-CD2 3.37Å; T8-Y12 PolarHBondContact O-N 3.49Å; Y12-S16 VanDerWaalsContact O-CB 3.32Å; Y12-S16 WeakPolarHBondContact O-CB 3.26Å; Y12-S16 PolarHBondContact O-N 3.42Å; Y12-S16 PolarHBondContact O-OG 3.03Å
13	K	92.4	Very high	80.6	Confident	137 Å²	137	117 Å²	117	60%	0.596	59%	0.592	S	S	*	*	H	α-helix	trans	-67.5	-43.8	177.5	-173.2	168.6	178.7	178.3	0	111.4	R9 L10 E11 S16 L17	R9-K13 VanDerWaalsContact O-CB 3.32Å; R9-K13 WeakPolarHBondContact O-CB 3.33Å; R9-K13 PolarHBondContact O-N 2.84Å; L10-K13 PolarHBondContact O-N 3.4Å; E11-K13 VanDerWaalsContact C-N 3.32Å; E11-K13 PolarHBondContact O-N 3.23Å; K13-S16 PolarHBondContact O-N 3.39Å; K13-L17 HydrophobicContact CG-CD1 4.27Å; K13-L17 WeakPolarHBondContact O-CB 3.34Å; K13-L17 VanDerWaalsContact O-CG 3.28Å; K13-L17 WeakPolarHBondContact O-CG 3.27Å; K13-L17 PolarHBondContact O-N 3.48Å
14	L	91.7	Very high	82.4	Confident	125 Å²	125	116.4 Å²	116.4	65%	0.654	57%	0.569	S	S	*	*	H	α-helix	trans	-60.1	-48.1	175.2	-179.9	62.2	0	0	0	111	L10 E11 S16 L17 F18	L10-L14 WeakPolarHBondContact O-CB 3.38Å; L10-L14 PolarHBondContact O-N 2.88Å; E11-L14 PolarHBondContact O-N 3.2Å; L14-S16 PolarHBondContact O-N 2.84Å; L14-L17 PolarHBondContact O-N 2.91Å; L14-F18 PolarHBondContact O-N 3Å
15	F	91.7	Very high	83.7	Confident	122 Å²	122	114 Å²	114	54%	0.535	55%	0.554	S	S	.	*	H	α-helix	trans	-57.3	-48.1	175.9	179.1	-98.2	0	0	0	111.9	E11 L17 F18 H19	E11-F15 WeakPolarHBondContact O-CB 3.49Å; E11-F15 PolarHBondContact O-N 3.42Å; F15-L17 VanDerWaalsContact C-N 3.34Å; F15-L17 PolarHBondContact O-N 3.34Å; F15-F18 PolarHBondContact O-N 2.93Å; F15-H19 AromaticContact CD1-CD2 3.88Å; F15-H19 AromaticContact CD2-CD2 3.77Å; F15-H19 AromaticContact CD2-NE2 3.82Å; F15-H19 AromaticContact CE1-CD2 3.56Å; F15-H19 AromaticContact CE1-NE2 3.72Å; F15-H19 AromaticContact CE2-CD2 3.46Å; F15-H19 VanDerWaalsContact CE2-CD2 3.46Å; F15-H19 WeakPolarHBondContact CE2-CD2 3.43Å; F15-H19 AromaticContact CE2-NE2 3.06Å; F15-H19 WeakPolarHBondContact CE2-NE2 3.21Å; F15-H19 AromaticContact CG-CD2 3.98Å; F15-H19 AromaticContact CZ-CD2 3.36Å; F15-H19 WeakPolarHBondContact CZ-CD2 3.33Å; F15-H19 AromaticContact CZ-CE1 3.86Å; F15-H19 AromaticContact CZ-NE2 3.01Å; F15-H19 WeakPolarHBondContact CZ-NE2 3.47Å; F15-H19 PolarHBondContact O-CD2 2.91Å; F15-H19 VanDerWaalsContact O-CD2 3.29Å; F15-H19 PolarHBondContact O-N 3.31Å
16	S	92.6	Very high	84.7	Confident	70 Å²	70	118.5 Å²	118.5	49%	0.49	55%	0.547	S	S	.	.	H	α-helix	trans	-62.6	-39.8	179.9	-60	0	0	0	0	112.5	Y12 K13 L14 R20	Y12-S16 VanDerWaalsContact O-CB 3.32Å; Y12-S16 WeakPolarHBondContact O-CB 3.26Å; Y12-S16 PolarHBondContact O-N 3.42Å; Y12-S16 PolarHBondContact O-OG 3.03Å; K13-S16 PolarHBondContact O-N 3.39Å; L14-S16 PolarHBondContact O-N 2.84Å; S16-R20 WeakPolarHBondContact O-CB 3.3Å; S16-R20 PolarHBondContact O-N 3.45Å
17	L	92.6	Very high	85.8	Confident	97 Å²	97	113 Å²	113	51%	0.508	53%	0.533	S	S	.	.	H	α-helix	trans	-65	-44.5	175.9	-72.5	171.3	0	0	0	111.5	K13 L14 F15 H19 R20 V21	K13-L17 HydrophobicContact CG-CD1 4.27Å; K13-L17 WeakPolarHBondContact O-CB 3.34Å; K13-L17 VanDerWaalsContact O-CG 3.28Å; K13-L17 WeakPolarHBondContact O-CG 3.27Å; K13-L17 PolarHBondContact O-N 3.48Å; L14-L17 PolarHBondContact O-N 2.91Å; F15-L17 VanDerWaalsContact C-N 3.34Å; F15-L17 PolarHBondContact O-N 3.34Å; L17-H19 PolarHBondContact O-N 3.19Å; L17-R20 PolarHBondContact O-N 3.27Å; L17-V21 WeakPolarHBondContact O-CG2 3.42Å; L17-V21 PolarHBondContact O-N 3.3Å
18	F	92.2	Very high	86.3	Confident	138 Å²	138	115 Å²	115	61%	0.605	54%	0.54	S	S	*	.	H	α-helix	trans	-59.2	-48.2	176.6	176	-100.5	0	0	0	112	L14 F15 R20 V21 S22	L14-F18 PolarHBondContact O-N 3Å; F15-F18 PolarHBondContact O-N 2.93Å; F18-R20 VanDerWaalsContact C-N 3.29Å; F18-R20 PolarHBondContact O-N 3.01Å; F18-V21 PolarHBondContact O-N 3.46Å; F18-S22 WeakPolarHBondContact O-CB 3.38Å; F18-S22 PolarHBondContact O-N 2.9Å
19	H	89.6	Confident	86.4	Confident	96 Å²	96	115.7 Å²	115.7	44%	0.444	54%	0.54	S	S	.	.	H	α-helix	trans	-60.6	-39.4	177.2	-86.4	-89.1	0	0	0	112.2	F15 L17 S22 Y23	F15-H19 AromaticContact CD1-CD2 3.88Å; F15-H19 AromaticContact CD2-CD2 3.77Å; F15-H19 AromaticContact CD2-NE2 3.82Å; F15-H19 AromaticContact CE1-CD2 3.56Å; F15-H19 AromaticContact CE1-NE2 3.72Å; F15-H19 AromaticContact CE2-CD2 3.46Å; F15-H19 VanDerWaalsContact CE2-CD2 3.46Å; F15-H19 WeakPolarHBondContact CE2-CD2 3.43Å; F15-H19 AromaticContact CE2-NE2 3.06Å; F15-H19 WeakPolarHBondContact CE2-NE2 3.21Å; F15-H19 AromaticContact CG-CD2 3.98Å; F15-H19 AromaticContact CZ-CD2 3.36Å; F15-H19 WeakPolarHBondContact CZ-CD2 3.33Å; F15-H19 AromaticContact CZ-CE1 3.86Å; F15-H19 AromaticContact CZ-NE2 3.01Å; F15-H19 WeakPolarHBondContact CZ-NE2 3.47Å; F15-H19 PolarHBondContact O-CD2 2.91Å; F15-H19 VanDerWaalsContact O-CD2 3.29Å; F15-H19 PolarHBondContact O-N 3.31Å; L17-H19 PolarHBondContact O-N 3.19Å; H19-S22 PolarHBondContact O-N 3.45Å; H19-Y23 WeakPolarHBondContact O-CB 3.38Å; H19-Y23 PolarHBondContact O-N 3.36Å
20	R	89.6	Confident	86.4	Confident	178 Å²	178	111 Å²	111	67%	0.672	53%	0.53	S	S	*	.	H	α-helix	trans	-64.9	-44.2	176.4	-174.3	166.9	-177.7	151.7	-0.2	112.2	S16 L17 F18 Y23 I24	S16-R20 WeakPolarHBondContact O-CB 3.3Å; S16-R20 PolarHBondContact O-N 3.45Å; L17-R20 PolarHBondContact O-N 3.27Å; F18-R20 VanDerWaalsContact C-N 3.29Å; F18-R20 PolarHBondContact O-N 3.01Å; R20-Y23 PolarHBondContact O-N 2.96Å; R20-I24 HydrophobicContact CG-CD1 3.75Å; R20-I24 HydrophobicContact CG-CG1 4.41Å; R20-I24 WeakPolarHBondContact O-CB 3.26Å; R20-I24 VanDerWaalsContact O-CG1 3.25Å; R20-I24 WeakPolarHBondContact O-CG1 3.42Å; R20-I24 PolarHBondContact O-N 3.36Å
21	V	90.4	Very high	86.2	Confident	91 Å²	91	107.2 Å²	107.2	55%	0.552	52%	0.515	S	S	*	.	H	α-helix	trans	-62.9	-44.2	176.5	172.9	0	0	0	0	110.8	L17 F18 Y23 I24 T25	L17-V21 WeakPolarHBondContact O-CG2 3.42Å; L17-V21 PolarHBondContact O-N 3.3Å; F18-V21 PolarHBondContact O-N 3.46Å; V21-Y23 PolarHBondContact O-N 2.92Å; V21-I24 PolarHBondContact O-N 3.43Å; V21-T25 WeakPolarHBondContact O-CB 3.33Å; V21-T25 PolarHBondContact O-N 3.41Å; V21-T25 PolarHBondContact O-OG1 3.31Å
22	S	86.2	Confident	86.1	Confident	42 Å²	42	106.5 Å²	106.5	29%	0.294	52%	0.517	S	S	.	.	H	α-helix	trans	-60.8	-43.5	177.3	-174.5	0	0	0	0	112.3	F18 H19 R26	F18-S22 WeakPolarHBondContact O-CB 3.38Å; F18-S22 PolarHBondContact O-N 2.9Å; H19-S22 PolarHBondContact O-N 3.45Å; S22-R26 WeakPolarHBondContact O-CB 3.34Å; S22-R26 VanDerWaalsContact O-CG 3.3Å; S22-R26 WeakPolarHBondContact O-CG 3.4Å; S22-R26 PolarHBondContact O-N 3.02Å; S22-R26 VanDerWaalsContact O-N 3.09Å
23	Y	83.3	Confident	85.9	Confident	162 Å²	162	105.1 Å²	105.1	64%	0.635	51%	0.514	S	S	*	.	H	α-helix	trans	-64.4	-49.7	176.3	178.3	-99	0	0	0	112.2	H19 R20 V21 T25 R26 V27	H19-Y23 WeakPolarHBondContact O-CB 3.38Å; H19-Y23 PolarHBondContact O-N 3.36Å; R20-Y23 PolarHBondContact O-N 2.96Å; V21-Y23 PolarHBondContact O-N 2.92Å; Y23-T25 VanDerWaalsContact C-N 3.34Å; Y23-T25 PolarHBondContact O-N 3.13Å; Y23-R26 PolarHBondContact O-N 3.25Å; Y23-V27 HydrophobicContact CD1-CG2 4.23Å; Y23-V27 HydrophobicContact CD2-CG2 4.18Å; Y23-V27 HydrophobicContact CE1-CG2 3.83Å; Y23-V27 HydrophobicContact CE2-CG2 3.78Å; Y23-V27 HydrophobicContact CG-CG2 4.4Å; Y23-V27 WeakPolarHBondContact O-CG2 3.37Å; Y23-V27 PolarHBondContact O-N 3.36Å
24	I	82.5	Confident	85.3	Confident	67 Å²	67	106.2 Å²	106.2	34%	0.344	51%	0.514	S	S	.	.	H	α-helix	trans	-58.2	-47.8	-179.8	-69.6	168.7	0	0	0	110.4	R20 V21 R26 V27 Q28	R20-I24 HydrophobicContact CG-CD1 3.75Å; R20-I24 HydrophobicContact CG-CG1 4.41Å; R20-I24 WeakPolarHBondContact O-CB 3.26Å; R20-I24 VanDerWaalsContact O-CG1 3.25Å; R20-I24 WeakPolarHBondContact O-CG1 3.42Å; R20-I24 PolarHBondContact O-N 3.36Å; V21-I24 PolarHBondContact O-N 3.43Å; I24-R26 PolarHBondContact O-N 3.41Å; I24-V27 PolarHBondContact O-N 3.13Å; I24-Q28 HydrophobicContact CG2-CG 4.33Å; I24-Q28 WeakPolarHBondContact O-CB 3.33Å; I24-Q28 WeakPolarHBondContact O-CG 3.48Å; I24-Q28 PolarHBondContact O-N 3.35Å
25	T	83.9	Confident	84.9	Confident	67 Å²	67	106.8 Å²	106.8	41%	0.411	51%	0.512	S	S	.	.	H	α-helix	trans	-61	-45.2	179.1	-60.4	0	0	0	0	111.7	V21 Y23 Q28 L29	V21-T25 WeakPolarHBondContact O-CB 3.33Å; V21-T25 PolarHBondContact O-N 3.41Å; V21-T25 PolarHBondContact O-OG1 3.31Å; Y23-T25 VanDerWaalsContact C-N 3.34Å; Y23-T25 PolarHBondContact O-N 3.13Å; T25-Q28 PolarHBondContact O-N 2.95Å; T25-L29 HydrophobicContact CG2-CD1 3.91Å; T25-L29 HydrophobicContact CG2-CG 4.39Å; T25-L29 WeakPolarHBondContact O-CB 3.41Å; T25-L29 VanDerWaalsContact O-CG 3.24Å; T25-L29 WeakPolarHBondContact O-CG 3.3Å; T25-L29 PolarHBondContact O-N 2.84Å
26	R	77.7	Confident	84.5	Confident	174 Å²	174	106.4 Å²	106.4	66%	0.657	52%	0.515	S	S	*	.	H	α-helix	trans	-63.2	-44.4	178.3	-74.7	177.6	-177.6	-128.3	0.6	112.4	S22 Y23 I24 N30	S22-R26 WeakPolarHBondContact O-CB 3.34Å; S22-R26 VanDerWaalsContact O-CG 3.3Å; S22-R26 WeakPolarHBondContact O-CG 3.4Å; S22-R26 PolarHBondContact O-N 3.02Å; S22-R26 VanDerWaalsContact O-N 3.09Å; Y23-R26 PolarHBondContact O-N 3.25Å; I24-R26 PolarHBondContact O-N 3.41Å; R26-N30 WeakPolarHBondContact O-CB 3.49Å; R26-N30 PolarHBondContact O-N 2.82Å; R26-N30 PolarHBondContact O-ND2 3.41Å
27	V	83.9	Confident	84.3	Confident	68 Å²	68	104.9 Å²	104.9	41%	0.412	50%	0.504	S	S	.	.	H	α-helix	trans	-65.1	-44.9	179.3	172.1	0	0	0	0	111.1	Y23 I24 N30 A31	Y23-V27 HydrophobicContact CD1-CG2 4.23Å; Y23-V27 HydrophobicContact CD2-CG2 4.18Å; Y23-V27 HydrophobicContact CE1-CG2 3.83Å; Y23-V27 HydrophobicContact CE2-CG2 3.78Å; Y23-V27 HydrophobicContact CG-CG2 4.4Å; Y23-V27 WeakPolarHBondContact O-CG2 3.37Å; Y23-V27 PolarHBondContact O-N 3.36Å; I24-V27 PolarHBondContact O-N 3.13Å; V27-N30 PolarHBondContact O-N 3.32Å; V27-A31 WeakPolarHBondContact O-CB 3.37Å; V27-A31 PolarHBondContact O-N 3.28Å
28	Q	78.6	Confident	84.1	Confident	126 Å²	126	104.2 Å²	104.2	59%	0.589	50%	0.501	S	S	*	.	H	α-helix	trans	-63.7	-45	178.2	-73.6	-176.6	-11.9	0	0	112	I24 T25 N30 A31 V32	I24-Q28 HydrophobicContact CG2-CG 4.33Å; I24-Q28 WeakPolarHBondContact O-CB 3.33Å; I24-Q28 WeakPolarHBondContact O-CG 3.48Å; I24-Q28 PolarHBondContact O-N 3.35Å; T25-Q28 PolarHBondContact O-N 2.95Å; Q28-N30 PolarHBondContact O-N 3.25Å; Q28-A31 PolarHBondContact O-N 2.94Å; Q28-V32 WeakPolarHBondContact O-CG2 3.44Å; Q28-V32 PolarHBondContact O-N 3Å
29	L	78.7	Confident	83.8	Confident	95 Å²	95	104.4 Å²	104.4	50%	0.497	50%	0.501	S	S	.	.	H	α-helix	trans	-61.6	-42.9	177.3	-72.5	174.6	0	0	0	112.1	T25 K33	T25-L29 HydrophobicContact CG2-CD1 3.91Å; T25-L29 HydrophobicContact CG2-CG 4.39Å; T25-L29 WeakPolarHBondContact O-CB 3.41Å; T25-L29 VanDerWaalsContact O-CG 3.24Å; T25-L29 WeakPolarHBondContact O-CG 3.3Å; T25-L29 PolarHBondContact O-N 2.84Å; L29-K33 WeakPolarHBondContact O-CB 3.31Å; L29-K33 VanDerWaalsContact O-CG 3.25Å; L29-K33 WeakPolarHBondContact O-CG 3.3Å; L29-K33 PolarHBondContact O-N 3.25Å
30	N	80.7	Confident	83.7	Confident	104 Å²	104	102.6 Å²	102.6	56%	0.556	50%	0.503	S	S	*	.	H	α-helix	trans	-67.7	-38.2	177.5	-74	-18.7	0	0	0	112	R26 V27 Q28 R34	R26-N30 WeakPolarHBondContact O-CB 3.49Å; R26-N30 PolarHBondContact O-N 2.82Å; R26-N30 PolarHBondContact O-ND2 3.41Å; V27-N30 PolarHBondContact O-N 3.32Å; Q28-N30 PolarHBondContact O-N 3.25Å; N30-R34 VanDerWaalsContact O-CB 3.26Å; N30-R34 WeakPolarHBondContact O-CB 3.4Å; N30-R34 PolarHBondContact O-N 3Å
31	A	80.3	Confident	83.6	Confident	31 Å²	31	100.5 Å²	100.5	26%	0.256	50%	0.495	S	S	.	.	H	α-helix	trans	-62.5	-50.8	175	0	0	0	0	0	111.2	V27 Q28 K33 R34 F35	V27-A31 WeakPolarHBondContact O-CB 3.37Å; V27-A31 PolarHBondContact O-N 3.28Å; Q28-A31 PolarHBondContact O-N 2.94Å; A31-K33 PolarHBondContact O-N 3.01Å; A31-R34 WeakPolarHBondContact O-CB 3.33Å; A31-R34 PolarHBondContact O-N 3.37Å; A31-R34 VanDerWaalsContact O-N 3.14Å; A31-F35 HydrophobicContact CB-CE2 4.47Å; A31-F35 WeakPolarHBondContact O-CD2 3.25Å; A31-F35 PolarHBondContact O-N 3.29Å
32	V	82.4	Confident	83.6	Confident	82 Å²	82	100 Å²	100	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-59.9	-47.4	178.3	174.3	0	0	0	0	111	Q28 R34 F35 L36	Q28-V32 WeakPolarHBondContact O-CG2 3.44Å; Q28-V32 PolarHBondContact O-N 3Å; V32-R34 VanDerWaalsContact C-N 3.29Å; V32-R34 PolarHBondContact O-N 3.45Å; V32-F35 PolarHBondContact O-N 3.38Å; V32-L36 HydrophobicContact CG1-CD1 3.92Å; V32-L36 HydrophobicContact CG1-CG 4.29Å; V32-L36 WeakPolarHBondContact O-CB 3.24Å; V32-L36 VanDerWaalsContact O-CG 3.3Å; V32-L36 WeakPolarHBondContact O-CG 3.39Å; V32-L36 PolarHBondContact O-N 3.03Å
33	K	82.1	Confident	83.7	Confident	136 Å²	136	104.7 Å²	104.7	59%	0.591	51%	0.51	S	S	*	.	H	α-helix	trans	-56.8	-43.7	174.8	-75.4	176.3	-178.1	-178.2	0	111.7	L29 A31 L36 S37	L29-K33 WeakPolarHBondContact O-CB 3.31Å; L29-K33 VanDerWaalsContact O-CG 3.25Å; L29-K33 WeakPolarHBondContact O-CG 3.3Å; L29-K33 PolarHBondContact O-N 3.25Å; A31-K33 PolarHBondContact O-N 3.01Å; K33-L36 PolarHBondContact O-N 2.86Å; K33-S37 VanDerWaalsContact O-CB 3.31Å; K33-S37 WeakPolarHBondContact O-CB 3.36Å; K33-S37 PolarHBondContact O-N 3.47Å; K33-S37 PolarHBondContact O-OG 3.04Å
34	R	81.3	Confident	84.1	Confident	160 Å²	160	104 Å²	104	60%	0.604	51%	0.507	S	S	*	.	H	α-helix	trans	-63	-47.8	177.2	-168.5	170.4	70.6	170.5	2.7	111.2	N30 A31 V32 L36 S37 L38	N30-R34 VanDerWaalsContact O-CB 3.26Å; N30-R34 WeakPolarHBondContact O-CB 3.4Å; N30-R34 PolarHBondContact O-N 3Å; A31-R34 WeakPolarHBondContact O-CB 3.33Å; A31-R34 PolarHBondContact O-N 3.37Å; A31-R34 VanDerWaalsContact O-N 3.14Å; V32-R34 VanDerWaalsContact C-N 3.29Å; V32-R34 PolarHBondContact O-N 3.45Å; R34-L36 PolarHBondContact O-N 3.45Å; R34-S37 WeakPolarHBondContact CA-OG 3.07Å; R34-S37 PolarHBondContact O-N 3.5Å; R34-S37 PolarHBondContact O-OG 2.67Å; R34-L38 HydrophobicContact CG-CD1 4.26Å; R34-L38 HydrophobicContact CG-CG 4.47Å; R34-L38 VanDerWaalsContact O-CG 3.3Å; R34-L38 WeakPolarHBondContact O-CG 3.32Å; R34-L38 PolarHBondContact O-N 3.43Å
35	F	83.5	Confident	84.4	Confident	137 Å²	137	105.5 Å²	105.5	60%	0.601	52%	0.515	S	S	*	.	H	α-helix	trans	-61.4	-43.6	177.6	-78.4	-69.3	0	0	0	113.1	A31 V32 S37 L38 K39	A31-F35 HydrophobicContact CB-CE2 4.47Å; A31-F35 WeakPolarHBondContact O-CD2 3.25Å; A31-F35 PolarHBondContact O-N 3.29Å; V32-F35 PolarHBondContact O-N 3.38Å; F35-S37 VanDerWaalsContact C-N 3.34Å; F35-S37 PolarHBondContact O-N 3.27Å; F35-L38 PolarHBondContact O-N 3.14Å; F35-K39 PolarHBondContact O-N 3.12Å
36	L	82.8	Confident	84.6	Confident	114 Å²	114	105.1 Å²	105.1	60%	0.597	52%	0.519	S	S	*	.	H	α-helix	trans	-60.5	-45	175.1	-68.8	174.7	0	0	0	111.2	V32 K33 R34 L38 K39 A40	V32-L36 HydrophobicContact CG1-CD1 3.92Å; V32-L36 HydrophobicContact CG1-CG 4.29Å; V32-L36 WeakPolarHBondContact O-CB 3.24Å; V32-L36 VanDerWaalsContact O-CG 3.3Å; V32-L36 WeakPolarHBondContact O-CG 3.39Å; V32-L36 PolarHBondContact O-N 3.03Å; K33-L36 PolarHBondContact O-N 2.86Å; R34-L36 PolarHBondContact O-N 3.45Å; L36-L38 VanDerWaalsContact C-N 3.34Å; L36-L38 PolarHBondContact O-N 3.23Å; L36-K39 PolarHBondContact O-N 3.35Å; L36-A40 PolarHBondContact O-N 2.91Å
37	S	87.7	Confident	85	Confident	38 Å²	38	103.3 Å²	103.3	27%	0.266	51%	0.513	S	S	.	.	H	α-helix	trans	-67.2	-31.6	178.1	74.2	0	0	0	0	113.4	K33 R34 F35 R41	K33-S37 VanDerWaalsContact O-CB 3.31Å; K33-S37 WeakPolarHBondContact O-CB 3.36Å; K33-S37 PolarHBondContact O-N 3.47Å; K33-S37 PolarHBondContact O-OG 3.04Å; R34-S37 WeakPolarHBondContact CA-OG 3.07Å; R34-S37 PolarHBondContact O-N 3.5Å; R34-S37 PolarHBondContact O-OG 2.67Å; F35-S37 VanDerWaalsContact C-N 3.34Å; F35-S37 PolarHBondContact O-N 3.27Å; S37-R41 VanDerWaalsContact O-CB 3.32Å; S37-R41 WeakPolarHBondContact O-CB 3.47Å; S37-R41 VanDerWaalsContact O-CG 3.3Å; S37-R41 WeakPolarHBondContact O-CG 3.3Å; S37-R41 PolarHBondContact O-N 2.96Å; S37-R41 PolarHBondContact O-NE 2.86Å; S37-R41 VanDerWaalsContact O-NE 3.1Å; S37-R41 PolarHBondContact OG-NH2 3.25Å
38	L	87.9	Confident	85.3	Confident	83 Å²	83	106.4 Å²	106.4	44%	0.435	52%	0.52	S	S	.	.	H	α-helix	trans	-69.4	-45.1	175.3	-73	173.4	0	0	0	110.4	R34 F35 L36 A40 R41 S42	R34-L38 HydrophobicContact CG-CD1 4.26Å; R34-L38 HydrophobicContact CG-CG 4.47Å; R34-L38 VanDerWaalsContact O-CG 3.3Å; R34-L38 WeakPolarHBondContact O-CG 3.32Å; R34-L38 PolarHBondContact O-N 3.43Å; F35-L38 PolarHBondContact O-N 3.14Å; L36-L38 VanDerWaalsContact C-N 3.34Å; L36-L38 PolarHBondContact O-N 3.23Å; L38-A40 PolarHBondContact O-N 3.47Å; L38-R41 PolarHBondContact O-N 2.92Å; L38-S42 PolarHBondContact O-N 2.74Å; L38-S42 PolarHBondContact O-OG 3.24Å; L38-S42 VanDerWaalsContact O-OG 3.12Å
39	K	86.1	Confident	85.6	Confident	141 Å²	141	105.6 Å²	105.6	61%	0.613	53%	0.528	S	S	*	.	H	α-helix	trans	-60.8	-43.4	176.3	-171.2	173.8	-175.3	173.8	0	112	F35 L36 K43	F35-K39 PolarHBondContact O-N 3.12Å; L36-K39 PolarHBondContact O-N 3.35Å; K39-K43 WeakPolarHBondContact O-CG 3.34Å; K39-K43 PolarHBondContact O-N 2.93Å; K39-K43 VanDerWaalsContact O-N 3.14Å
40	A	87.6	Confident	85.8	Confident	59 Å²	59	104.3 Å²	104.3	49%	0.488	53%	0.526	S	S	.	.	H	α-helix	trans	-63.4	-44.6	176.2	0	0	0	0	0	111.8	L36 L38 K43 W44	L36-A40 PolarHBondContact O-N 2.91Å; L38-A40 PolarHBondContact O-N 3.47Å; A40-K43 PolarHBondContact O-N 3.1Å; A40-W44 PolarHBondContact O-N 3.47Å
41	R	89.3	Confident	85.8	Confident	134 Å²	134	105.3 Å²	105.3	51%	0.506	53%	0.525	S	S	.	.	H	α-helix	trans	-63.7	-42.3	176.8	-81.4	-179.1	-85	-149	1.5	113.1	S37 L38 K43 W44 N45	S37-R41 VanDerWaalsContact O-CB 3.32Å; S37-R41 WeakPolarHBondContact O-CB 3.47Å; S37-R41 VanDerWaalsContact O-CG 3.3Å; S37-R41 WeakPolarHBondContact O-CG 3.3Å; S37-R41 PolarHBondContact O-N 2.96Å; S37-R41 PolarHBondContact O-NE 2.86Å; S37-R41 VanDerWaalsContact O-NE 3.1Å; S37-R41 PolarHBondContact OG-NH2 3.25Å; L38-R41 PolarHBondContact O-N 2.92Å; R41-K43 VanDerWaalsContact C-N 3.32Å; R41-K43 PolarHBondContact O-N 3.14Å; R41-W44 PolarHBondContact O-N 3.4Å; R41-N45 WeakPolarHBondContact O-CB 3.26Å; R41-N45 VanDerWaalsContact O-CG 3.27Å; R41-N45 PolarHBondContact O-N 2.99Å
42	S	89.2	Confident	86	Confident	79 Å²	79	108 Å²	108	55%	0.552	56%	0.556	S	S	*	*	H	α-helix	trans	-61.9	-41.5	176.7	-63	0	0	0	0	111.7	L38 A46	L38-S42 PolarHBondContact O-N 2.74Å; L38-S42 PolarHBondContact O-OG 3.24Å; L38-S42 VanDerWaalsContact O-OG 3.12Å; S42-A46 WeakPolarHBondContact O-CB 3.41Å; S42-A46 PolarHBondContact O-N 2.98Å
43	K	89.3	Confident	86.2	Confident	141 Å²	141	108.1 Å²	108.1	61%	0.613	55%	0.552	S	S	*	*	H	α-helix	trans	-63.1	-45.1	174	-72.4	-178.6	175	-166.7	0	112.1	K39 A40 R41 A46 W47	K39-K43 WeakPolarHBondContact O-CG 3.34Å; K39-K43 PolarHBondContact O-N 2.93Å; K39-K43 VanDerWaalsContact O-N 3.14Å; A40-K43 PolarHBondContact O-N 3.1Å; R41-K43 VanDerWaalsContact C-N 3.32Å; R41-K43 PolarHBondContact O-N 3.14Å; K43-A46 PolarHBondContact O-N 2.9Å; K43-W47 PolarHBondContact O-N 3.44Å
44	W	90	Very high	86.5	Confident	148 Å²	148	104.3 Å²	104.3	56%	0.561	54%	0.543	S	S	*	.	H	α-helix	trans	-62.4	-44.9	177.9	179.2	-100.4	0	0	0	112.3	A40 R41 W47 K48	A40-W44 PolarHBondContact O-N 3.47Å; R41-W44 PolarHBondContact O-N 3.4Å; W44-W47 HydrophobicContact CD2-CE3 4.41Å; W44-W47 AromaticContact CE3-CE3 3.83Å; W44-W47 HydrophobicContact CE3-CE3 3.83Å; W44-W47 HydrophobicContact CE3-CZ3 4.04Å; W44-W47 HydrophobicContact CH2-CE3 4.11Å; W44-W47 AromaticContact CH2-CZ3 3.51Å; W44-W47 HydrophobicContact CH2-CZ3 3.51Å; W44-W47 HydrophobicContact CZ2-CZ3 4.24Å; W44-W47 AromaticContact CZ3-CE3 3.67Å; W44-W47 HydrophobicContact CZ3-CE3 3.67Å; W44-W47 HydrophobicContact CZ3-CH2 4.46Å; W44-W47 AromaticContact CZ3-CZ3 3.37Å; W44-W47 HydrophobicContact CZ3-CZ3 3.37Å; W44-W47 PolarHBondContact O-N 3.05Å; W44-K48 WeakPolarHBondContact O-CB 3.41Å; W44-K48 PolarHBondContact O-N 2.88Å
45	N	88.7	Confident	86.7	Confident	98 Å²	98	103.6 Å²	103.6	52%	0.524	54%	0.544	S	S	.	.	H	α-helix	trans	-63.9	-41.6	178.3	-73.4	-14	0	0	0	111.7	R41 K48 C49	R41-N45 WeakPolarHBondContact O-CB 3.26Å; R41-N45 VanDerWaalsContact O-CG 3.27Å; R41-N45 PolarHBondContact O-N 2.99Å; N45-K48 PolarHBondContact O-N 3.36Å; N45-C49 WeakPolarHBondContact O-CB 3.33Å; N45-C49 PolarHBondContact O-N 2.89Å
46	A	88.5	Confident	87	Confident	59 Å²	59	103 Å²	103	49%	0.488	54%	0.543	S	S	.	.	H	α-helix	trans	-61	-46.8	174.7	0	0	0	0	0	111.4	S42 K43 C49 C50	S42-A46 WeakPolarHBondContact O-CB 3.41Å; S42-A46 PolarHBondContact O-N 2.98Å; K43-A46 PolarHBondContact O-N 2.9Å; A46-C49 WeakPolarHBondContact O-CB 3.4Å; A46-C49 PolarHBondContact O-N 3.41Å; A46-C50 PolarHBondContact O-N 3.41Å; A46-C50 PolarHBondContact O-SG 3.09Å
47	W	87	Confident	87.3	Confident	137 Å²	137	102.8 Å²	102.8	52%	0.519	54%	0.539	S	S	.	.	H	α-helix	trans	-63.7	-41.5	176.4	-180	66	0	0	0	112.7	K43 W44 C49 C50 K51	K43-W47 PolarHBondContact O-N 3.44Å; W44-W47 HydrophobicContact CD2-CE3 4.41Å; W44-W47 AromaticContact CE3-CE3 3.83Å; W44-W47 HydrophobicContact CE3-CE3 3.83Å; W44-W47 HydrophobicContact CE3-CZ3 4.04Å; W44-W47 HydrophobicContact CH2-CE3 4.11Å; W44-W47 AromaticContact CH2-CZ3 3.51Å; W44-W47 HydrophobicContact CH2-CZ3 3.51Å; W44-W47 HydrophobicContact CZ2-CZ3 4.24Å; W44-W47 AromaticContact CZ3-CE3 3.67Å; W44-W47 HydrophobicContact CZ3-CE3 3.67Å; W44-W47 HydrophobicContact CZ3-CH2 4.46Å; W44-W47 AromaticContact CZ3-CZ3 3.37Å; W44-W47 HydrophobicContact CZ3-CZ3 3.37Å; W44-W47 PolarHBondContact O-N 3.05Å; W47-C49 VanDerWaalsContact C-N 3.29Å; W47-C49 PolarHBondContact O-N 2.97Å; W47-C50 PolarHBondContact O-N 3.49Å; W47-C50 VanDerWaalsContact O-N 3.13Å; W47-K51 PolarHBondContact O-N 2.93Å
48	K	89	Confident	87.3	Confident	132 Å²	132	103 Å²	103	57%	0.574	54%	0.543	S	S	*	.	H	α-helix	trans	-61.6	-37.5	176	-173.4	-178.4	175.8	-174.9	0	111.8	W44 N45 C50 K51	W44-K48 WeakPolarHBondContact O-CB 3.41Å; W44-K48 PolarHBondContact O-N 2.88Å; N45-K48 PolarHBondContact O-N 3.36Å; K48-C50 PolarHBondContact O-N 3.46Å; K48-K51 WeakPolarHBondContact O-CB 3.25Å; K48-K51 PolarHBondContact O-N 3.27Å; K48-K51 VanDerWaalsContact O-N 3.13Å
49	C	84.7	Confident	87.5	Confident	110 Å²	110	103.9 Å²	103.9	74%	0.743	55%	0.546	S	S	*	.	H	α-helix	trans	-65.2	-29.4	176.3	-174.2	0	0	0	0	112.4	N45 A46 W47 K51	N45-C49 WeakPolarHBondContact O-CB 3.33Å; N45-C49 PolarHBondContact O-N 2.89Å; A46-C49 WeakPolarHBondContact O-CB 3.4Å; A46-C49 PolarHBondContact O-N 3.41Å; W47-C49 VanDerWaalsContact C-N 3.29Å; W47-C49 PolarHBondContact O-N 2.97Å; C49-K51 VanDerWaalsContact C-N 3.34Å
50	C	83.1	Confident	87.8	Confident	68 Å²	68	103.6 Å²	103.6	46%	0.459	55%	0.545	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.9	-9.1	174	-60.6	0	0	0	0	113.9	A46 W47 K48 G52 M53	A46-C50 PolarHBondContact O-N 3.41Å; A46-C50 PolarHBondContact O-SG 3.09Å; W47-C50 PolarHBondContact O-N 3.49Å; W47-C50 VanDerWaalsContact O-N 3.13Å; K48-C50 PolarHBondContact O-N 3.46Å; C50-G52 PolarHBondContact O-N 2.94Å; C50-M53 WeakPolarHBondContact O-CB 3.47Å; C50-M53 PolarHBondContact O-N 3.26Å
51	K	81.9	Confident	87.9	Confident	125 Å²	125	102.6 Å²	102.6	54%	0.543	53%	0.534	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68	127.1	177.3	-73.3	-168.5	174.6	-169.8	0	110	W47 K48 C49	W47-K51 PolarHBondContact O-N 2.93Å; K48-K51 WeakPolarHBondContact O-CB 3.25Å; K48-K51 PolarHBondContact O-N 3.27Å; K48-K51 VanDerWaalsContact O-N 3.13Å; C49-K51 VanDerWaalsContact C-N 3.34Å
52	G	85	Confident	87.9	Confident	88 Å²	88	104.5 Å²	104.5	91%	0.907	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	99.6	-8.2	-176.4	0	0	0	0	0	114.1	C50	C50-G52 PolarHBondContact O-N 2.94Å
53	M	85.3	Confident	88.1	Confident	83 Å²	83	105 Å²	105	41%	0.409	54%	0.539	S	S	.	.			trans	-75.5	137.2	171	-169.4	173.1	-82	0	0	110.1	C50 E57 A58	C50-M53 WeakPolarHBondContact O-CB 3.47Å; C50-M53 PolarHBondContact O-N 3.26Å; M53-E57 HydrophobicContact CG-CB 3.53Å; M53-E57 HydrophobicContact SD-CB 4.26Å; M53-A58 HydrophobicContact CG-CB 4.1Å; M53-A58 WeakPolarHBondContact SD-CA 3.3Å; M53-A58 HydrophobicContact SD-CB 3.78Å
54	S	87.8	Confident	88.2	Confident	57 Å²	57	104.2 Å²	104.2	40%	0.399	54%	0.537	S	S	.	.			trans	-66.4	158.1	170.8	65.8	0	0	0	0	110.4	E56 E57 A58	S54-E56 PolarHBondContact O-N 3.37Å; S54-E57 PolarHBondContact O-N 3.25Å; S54-E57 WeakPolarHBondContact OG-CB 3.41Å; S54-E57 VanDerWaalsContact OG-CG 3.26Å; S54-E57 WeakPolarHBondContact OG-CG 3.5Å; S54-E57 PolarHBondContact OG-N 3.26Å; S54-A58 WeakPolarHBondContact O-CB 3.47Å; S54-A58 PolarHBondContact O-N 3.03Å
55	K	87	Confident	88.2	Confident	144 Å²	144	103.5 Å²	103.5	63%	0.626	54%	0.538	S	S	*	.	H	α-helix	trans	-59.4	-37.4	-178.7	-178.5	-177.8	175.8	-173.7	0	111.1	A58 M59	K55-A58 PolarHBondContact O-N 2.95Å; K55-M59 HydrophobicContact CD-CE 4.28Å; K55-M59 HydrophobicContact CG-CE 3.98Å; K55-M59 HydrophobicContact CG-SD 4.46Å; K55-M59 WeakPolarHBondContact O-CG 3.46Å; K55-M59 PolarHBondContact O-N 3Å
56	E	89.4	Confident	88.4	Confident	126 Å²	126	100.2 Å²	100.2	59%	0.589	52%	0.524	S	S	*	.	H	α-helix	trans	-69.3	-46.2	-177.7	-61.6	66.5	-141.3	0	0	111.1	S54 A58 M59 K60	S54-E56 PolarHBondContact O-N 3.37Å; E56-A58 VanDerWaalsContact C-N 3.31Å; E56-A58 PolarHBondContact O-N 3.5Å; E56-M59 PolarHBondContact O-N 2.95Å; E56-K60 PolarHBondContact O-N 3.41Å
57	E	88.4	Confident	88.6	Confident	108 Å²	108	103.7 Å²	103.7	51%	0.505	53%	0.53	S	S	.	.	H	α-helix	trans	-62.2	-40.5	175.1	-75.8	-80.9	98.3	0	0	111.2	M53 S54 K60 S61	M53-E57 HydrophobicContact CG-CB 3.53Å; M53-E57 HydrophobicContact SD-CB 4.26Å; S54-E57 PolarHBondContact O-N 3.25Å; S54-E57 WeakPolarHBondContact OG-CB 3.41Å; S54-E57 VanDerWaalsContact OG-CG 3.26Å; S54-E57 WeakPolarHBondContact OG-CG 3.5Å; S54-E57 PolarHBondContact OG-N 3.26Å; E57-K60 PolarHBondContact O-N 2.95Å; E57-S61 WeakPolarHBondContact O-CB 3.37Å; E57-S61 PolarHBondContact O-N 2.97Å
58	A	89	Confident	88.7	Confident	42 Å²	42	100.1 Å²	100.1	35%	0.347	53%	0.53	S	S	.	.	H	α-helix	trans	-64.2	-41.5	177.3	0	0	0	0	0	112.2	M53 S54 K55 E56 Y62	M53-A58 HydrophobicContact CG-CB 4.1Å; M53-A58 WeakPolarHBondContact SD-CA 3.3Å; M53-A58 HydrophobicContact SD-CB 3.78Å; S54-A58 WeakPolarHBondContact O-CB 3.47Å; S54-A58 PolarHBondContact O-N 3.03Å; K55-A58 PolarHBondContact O-N 2.95Å; E56-A58 VanDerWaalsContact C-N 3.31Å; E56-A58 PolarHBondContact O-N 3.5Å; A58-Y62 VanDerWaalsContact O-CB 3.3Å; A58-Y62 WeakPolarHBondContact O-CB 3.43Å; A58-Y62 PolarHBondContact O-N 3.44Å
59	M	91.3	Very high	88.8	Confident	102 Å²	102	98.3 Å²	98.3	50%	0.502	53%	0.526	S	S	.	.	H	α-helix	trans	-64.4	-47.1	175.3	-75.4	177.7	175	0	0	111.7	K55 E56 S61 Y62 I63	K55-M59 HydrophobicContact CD-CE 4.28Å; K55-M59 HydrophobicContact CG-CE 3.98Å; K55-M59 HydrophobicContact CG-SD 4.46Å; K55-M59 WeakPolarHBondContact O-CG 3.46Å; K55-M59 PolarHBondContact O-N 3Å; E56-M59 PolarHBondContact O-N 2.95Å; M59-S61 PolarHBondContact O-N 3.25Å; M59-Y62 WeakPolarHBondContact O-CB 3.28Å; M59-Y62 PolarHBondContact O-N 3Å; M59-I63 WeakPolarHBondContact O-CG1 3.49Å; M59-I63 PolarHBondContact O-N 3.46Å
60	K	92.1	Very high	89	Confident	136 Å²	136	97.2 Å²	97.2	59%	0.591	51%	0.512	S	S	*	.	H	α-helix	trans	-59.3	-48.7	178.2	-175.5	-178.2	174.3	-172.2	0	111.3	E56 E57 Y62 I63 E64	E56-K60 PolarHBondContact O-N 3.41Å; E57-K60 PolarHBondContact O-N 2.95Å; K60-Y62 VanDerWaalsContact C-N 3.3Å; K60-Y62 PolarHBondContact O-N 3.45Å; K60-I63 PolarHBondContact O-N 3.31Å; K60-E64 PolarHBondContact O-N 3.39Å
61	S	89.7	Confident	89.3	Confident	38 Å²	38	97.1 Å²	97.1	27%	0.266	52%	0.523	S	S	.	.	H	α-helix	trans	-63.5	-35.1	177.9	-171.1	0	0	0	0	112.5	E57 M59 K65	E57-S61 WeakPolarHBondContact O-CB 3.37Å; E57-S61 PolarHBondContact O-N 2.97Å; M59-S61 PolarHBondContact O-N 3.25Å; S61-K65 WeakPolarHBondContact O-CB 3.45Å; S61-K65 WeakPolarHBondContact O-CG 3.06Å; S61-K65 PolarHBondContact O-N 2.89Å
62	Y	89.7	Confident	89.7	Confident	173 Å²	173	98.5 Å²	98.5	68%	0.678	53%	0.529	S	S	*	.	H	α-helix	trans	-64.5	-47.8	175.3	179.3	-95	0	0	0	112	A58 M59 K60 K65 A66	A58-Y62 VanDerWaalsContact O-CB 3.3Å; A58-Y62 WeakPolarHBondContact O-CB 3.43Å; A58-Y62 PolarHBondContact O-N 3.44Å; M59-Y62 WeakPolarHBondContact O-CB 3.28Å; M59-Y62 PolarHBondContact O-N 3Å; K60-Y62 VanDerWaalsContact C-N 3.3Å; K60-Y62 PolarHBondContact O-N 3.45Å; Y62-K65 PolarHBondContact O-N 3.36Å; Y62-A66 WeakPolarHBondContact O-CB 3.36Å; Y62-A66 PolarHBondContact O-N 3.28Å
63	I	92.9	Very high	89.9	Confident	91 Å²	91	101.6 Å²	101.6	47%	0.467	51%	0.514	S	S	.	.	H	α-helix	trans	-60.7	-47.6	178.7	-66.8	165.9	0	0	0	110.3	M59 K60 K65 A66 Q67	M59-I63 WeakPolarHBondContact O-CG1 3.49Å; M59-I63 PolarHBondContact O-N 3.46Å; K60-I63 PolarHBondContact O-N 3.31Å; I63-K65 VanDerWaalsContact C-N 3.35Å; I63-K65 PolarHBondContact O-N 2.97Å; I63-A66 PolarHBondContact O-N 2.9Å; I63-Q67 HydrophobicContact CG2-CG 4.39Å; I63-Q67 WeakPolarHBondContact O-CB 3.46Å; I63-Q67 WeakPolarHBondContact O-CG 3.39Å; I63-Q67 PolarHBondContact O-N 2.93Å
64	E	92.8	Very high	89.6	Confident	123 Å²	123	100 Å²	100	58%	0.575	52%	0.519	S	S	*	.	H	α-helix	trans	-58.9	-45.5	178.5	-173.9	-178.6	87.4	0	0	111.5	K60 Q67 A68	K60-E64 PolarHBondContact O-N 3.39Å; E64-Q67 PolarHBondContact O-N 2.75Å; E64-A68 WeakPolarHBondContact O-CB 3.41Å; E64-A68 PolarHBondContact O-N 3.33Å
65	K	90	Very high	88.5	Confident	133 Å²	133	103.1 Å²	103.1	58%	0.578	53%	0.531	S	S	*	.	H	α-helix	trans	-65.7	-39.7	176	-76.7	-176.2	-179.1	177.9	0	112.7	S61 Y62 I63 A68 L69	S61-K65 WeakPolarHBondContact O-CB 3.45Å; S61-K65 WeakPolarHBondContact O-CG 3.06Å; S61-K65 PolarHBondContact O-N 2.89Å; Y62-K65 PolarHBondContact O-N 3.36Å; I63-K65 VanDerWaalsContact C-N 3.35Å; I63-K65 PolarHBondContact O-N 2.97Å; K65-A68 PolarHBondContact O-N 3.4Å; K65-L69 WeakPolarHBondContact O-CB 3.32Å; K65-L69 VanDerWaalsContact O-CG 3.27Å; K65-L69 WeakPolarHBondContact O-CG 3.01Å; K65-L69 PolarHBondContact O-N 3.29Å
66	A	91.5	Very high	87.4	Confident	30 Å²	30	107.1 Å²	107.1	25%	0.248	56%	0.556	C	S	.	*	H	α-helix	trans	-63.4	-47.7	177.7	0	0	0	0	0	110.7	Y62 I63 A68 L69 I70	Y62-A66 WeakPolarHBondContact O-CB 3.36Å; Y62-A66 PolarHBondContact O-N 3.28Å; I63-A66 PolarHBondContact O-N 2.9Å; A66-A68 VanDerWaalsContact C-N 3.34Å; A66-A68 PolarHBondContact O-N 3.4Å; A66-L69 PolarHBondContact O-N 3.34Å; A66-I70 VanDerWaalsContact O-CG1 3.25Å; A66-I70 WeakPolarHBondContact O-CG1 2.95Å; A66-I70 PolarHBondContact O-N 2.84Å
67	Q	92.3	Very high	87.3	Confident	131 Å²	131	106.2 Å²	106.2	61%	0.612	56%	0.555	S	S	*	*	H	α-helix	trans	-60.2	-43.3	175.5	-72.2	176.6	-21.4	0	0	111.8	I63 E64 L69 I70 G71	I63-Q67 HydrophobicContact CG2-CG 4.39Å; I63-Q67 WeakPolarHBondContact O-CB 3.46Å; I63-Q67 WeakPolarHBondContact O-CG 3.39Å; I63-Q67 PolarHBondContact O-N 2.93Å; E64-Q67 PolarHBondContact O-N 2.75Å; Q67-L69 VanDerWaalsContact C-N 3.34Å; Q67-L69 PolarHBondContact O-N 2.92Å; Q67-I70 PolarHBondContact O-N 3.02Å; Q67-G71 PolarHBondContact O-N 3.3Å
68	A	90.2	Very high	87.2	Confident	63 Å²	63	106.1 Å²	106.1	52%	0.521	56%	0.557	S	S	.	*	H	α-helix	trans	-62.7	-38.6	175.7	0	0	0	0	0	112.7	E64 K65 A66 K72	E64-A68 WeakPolarHBondContact O-CB 3.41Å; E64-A68 PolarHBondContact O-N 3.33Å; K65-A68 PolarHBondContact O-N 3.4Å; A66-A68 VanDerWaalsContact C-N 3.34Å; A66-A68 PolarHBondContact O-N 3.4Å; A68-K72 WeakPolarHBondContact O-CB 3.32Å; A68-K72 PolarHBondContact O-N 2.88Å
69	L	90	Very high	87.1	Confident	93 Å²	93	109.6 Å²	109.6	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-70.3	-41.9	176.9	-74.8	171.9	0	0	0	112.2	K65 A66 Q67 G71 K72 Y73	K65-L69 WeakPolarHBondContact O-CB 3.32Å; K65-L69 VanDerWaalsContact O-CG 3.27Å; K65-L69 WeakPolarHBondContact O-CG 3.01Å; K65-L69 PolarHBondContact O-N 3.29Å; A66-L69 PolarHBondContact O-N 3.34Å; Q67-L69 VanDerWaalsContact C-N 3.34Å; Q67-L69 PolarHBondContact O-N 2.92Å; L69-G71 VanDerWaalsContact C-N 3.34Å; L69-K72 PolarHBondContact O-N 3.27Å; L69-Y73 HydrophobicContact CD2-CD2 3.99Å; L69-Y73 HydrophobicContact CD2-CE2 3.75Å; L69-Y73 PolarHBondContact O-N 3.5Å
70	I	89.9	Confident	86.9	Confident	88 Å²	88	110.1 Å²	110.1	45%	0.451	57%	0.573	S	S	.	*	H	α-helix	trans	-59.9	-47.7	174.3	-68.5	166.4	0	0	0	109.4	A66 Q67 K72 G74	A66-I70 VanDerWaalsContact O-CG1 3.25Å; A66-I70 WeakPolarHBondContact O-CG1 2.95Å; A66-I70 PolarHBondContact O-N 2.84Å; Q67-I70 PolarHBondContact O-N 3.02Å; I70-K72 PolarHBondContact O-N 3.03Å; I70-G74 VanDerWaalsContact O-CA 3.26Å; I70-G74 WeakPolarHBondContact O-CA 3.1Å; I70-G74 PolarHBondContact O-N 2.74Å
71	G	90.1	Very high	86.5	Confident	66 Å²	66	108.4 Å²	108.4	68%	0.68	57%	0.572	S	S	*	*	H	α-helix	trans	-63.7	-37.1	176.9	0	0	0	0	0	113.6	Q67 L69	Q67-G71 PolarHBondContact O-N 3.3Å; L69-G71 VanDerWaalsContact C-N 3.34Å
72	K	89.3	Confident	86.3	Confident	154 Å²	154	113.1 Å²	113.1	67%	0.67	59%	0.592	S	S	*	*	H	α-helix	trans	-75.7	-42.2	-178.4	-176.5	176.6	-179	-178.6	0	113.6	A68 L69 I70	A68-K72 WeakPolarHBondContact O-CB 3.32Å; A68-K72 PolarHBondContact O-N 2.88Å; L69-K72 PolarHBondContact O-N 3.27Å; I70-K72 PolarHBondContact O-N 3.03Å
73	Y	88.9	Confident	86.1	Confident	152 Å²	152	108.9 Å²	108.9	60%	0.596	59%	0.586	S	S	*	*	H	α-helix	trans	-102.3	-4.6	-174.5	-68.6	-74.3	0	0	0	113.4	L69 L75	L69-Y73 HydrophobicContact CD2-CD2 3.99Å; L69-Y73 HydrophobicContact CD2-CE2 3.75Å; L69-Y73 PolarHBondContact O-N 3.5Å; Y73-L75 VanDerWaalsContact C-N 3.26Å; Y73-L75 PolarHBondContact O-N 3.29Å
74	G	78.8	Confident	85.6	Confident	49 Å²	49	110.2 Å²	110.2	51%	0.505	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	59.8	38.1	-179.2	0	0	0	0	0	112.3	I70 I76	I70-G74 VanDerWaalsContact O-CA 3.26Å; I70-G74 WeakPolarHBondContact O-CA 3.1Å; I70-G74 PolarHBondContact O-N 2.74Å; G74-I76 PolarHBondContact O-N 2.74Å
75	L	66.3	Low	85	Confident	124 Å²	124	109.2 Å²	109.2	65%	0.649	60%	0.597	S	S	*	*			trans	-71.9	78.4	171.1	-76.2	167	0	0	0	108.1	Y73	Y73-L75 VanDerWaalsContact C-N 3.26Å; Y73-L75 PolarHBondContact O-N 3.29Å
76	I	62.4	Low	84.5	Confident	227 Å²	227	107 Å²	107	100%	1.164	60%	0.598	S	S	*	*			trans	-82.7	0	165.3	-54.9	175.7	0	0	0	107.7	G74	G74-I76 PolarHBondContact O-N 2.74Å

Retrieved 76 of 76 residues in 192.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).