A0A077ZHA4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHA4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 34 aa.

						>A0A077ZHA4_TRITR|A0A077ZHA4
MRSKAASGVRIPASPPFASVAQLDRVLGYEPSGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	71	Confident	240 Å²	240	155.2 Å²	155.2	100%	1.182	85%	0.851	S	S	*	*				0	110	0	-68.7	157.5	84.4	0	0	108
2	R	67.7	Low	71.3	Confident	248 Å²	248	151.3 Å²	151.3	94%	0.936	84%	0.839	S	S	*	*			trans	-128.7	97.6	172.2	-74.9	-166.5	-65.9	-122.1	1.3	107.9	K4	R2-K4 PolarHBondContact O-N 3.02Å
3	S	69.2	Low	71.6	Confident	122 Å²	122	146.9 Å²	146.9	85%	0.853	83%	0.834	S	S	*	*			trans	-71.4	110.8	174.2	-49.2	0	0	0	0	107.7	A5	S3-A5 PolarHBondContact O-N 3Å; S3-A5 VanDerWaalsContact O-N 3.11Å
4	K	71.1	Confident	71.5	Confident	208 Å²	208	143.7 Å²	143.7	90%	0.904	83%	0.826	S	S	*	*			trans	-62.7	110.7	175.1	-169.2	173.6	-178.1	-178.1	0	107.3	R2 A6	R2-K4 PolarHBondContact O-N 3.02Å; K4-A6 PolarHBondContact O-N 3.29Å; K4-A6 VanDerWaalsContact O-N 3.15Å
5	A	69.5	Low	71.4	Confident	91 Å²	91	140.4 Å²	140.4	75%	0.752	81%	0.811	S	S	*	*			trans	-55.3	120.7	-179.1	0	0	0	0	0	109.2	S3 S7	S3-A5 PolarHBondContact O-N 3Å; S3-A5 VanDerWaalsContact O-N 3.11Å; A5-S7 PolarHBondContact O-N 3.31Å
6	A	68	Low	71.2	Confident	100 Å²	100	138.8 Å²	138.8	83%	0.826	81%	0.807	S	S	*	*			trans	-60	107.4	172.5	0	0	0	0	0	107.5	K4 G8	K4-A6 PolarHBondContact O-N 3.29Å; K4-A6 VanDerWaalsContact O-N 3.15Å; A6-G8 PolarHBondContact O-N 2.84Å
7	S	72	Confident	71.1	Confident	112 Å²	112	140.7 Å²	140.7	78%	0.783	80%	0.804	S	S	*	*			trans	-73.1	73.8	172.6	66.6	0	0	0	0	107.9	A5 V9	A5-S7 PolarHBondContact O-N 3.31Å; S7-V9 PolarHBondContact O-N 3.48Å
8	G	75.9	Confident	71	Confident	58 Å²	58	137.6 Å²	137.6	60%	0.598	80%	0.798	S	S	*	*			trans	-66.2	104.3	170.9	0	0	0	0	0	107.9	A6 R10	A6-G8 PolarHBondContact O-N 2.84Å; G8-R10 PolarHBondContact O-N 3.25Å
9	V	78.5	Confident	70.9	Confident	140 Å²	140	136.4 Å²	136.4	85%	0.848	80%	0.798	S	S	*	*			trans	-55.5	111.5	167.4	172.8	0	0	0	0	106.6	S7	S7-V9 PolarHBondContact O-N 3.48Å
10	R	80.6	Confident	71.1	Confident	231 Å²	231	135.7 Å²	135.7	87%	0.872	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-83.3	122.7	174.5	-60.7	-166.5	-157.7	-121.6	6.3	107.7	G8 P12	G8-R10 PolarHBondContact O-N 3.25Å; R10-P12 WeakPolarHBondContact O-CD 3.42Å
11	I	76.8	Confident	71.4	Confident	157 Å²	157	133.1 Å²	133.1	81%	0.805	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-65.3	121.2	164.2	-58	175.2	0	0	0	105.6	A13	I11-A13 PolarHBondContact O-N 3.17Å
12	P	74.3	Confident	72.5	Confident	109 Å²	109	130.6 Å²	130.6	71%	0.708	78%	0.775	S	S	*	*	P	Polyproline II helix	trans	-60	141.4	175.9	25	-31.9	0	0	0	108.8	R10 S14	R10-P12 WeakPolarHBondContact O-CD 3.42Å; P12-S14 PolarHBondContact O-N 3.35Å
13	A	74.7	Confident	72.9	Confident	94 Å²	94	126.3 Å²	126.3	78%	0.777	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-50.4	136.5	164.8	0	0	0	0	0	107.7	I11	I11-A13 PolarHBondContact O-N 3.17Å
14	S	70.1	Confident	73.4	Confident	102 Å²	102	127.9 Å²	127.9	71%	0.713	77%	0.769	S	S	*	*			trans	-34.7	138.1	179.7	48.6	0	0	0	0	112	P12	P12-S14 PolarHBondContact O-N 3.35Å
15	P	70.2	Confident	73.9	Confident	94 Å²	94	129.6 Å²	129.6	61%	0.61	77%	0.77	S	S	*	*			trans	-50.9	139	-178.7	22.1	-32.6	0	0	0	109.6	F17	P15-F17 CarbonylContact O-C 3.52Å; P15-F17 PolarHBondContact O-N 3.03Å
16	P	68.4	Low	74.5	Confident	115 Å²	115	130.1 Å²	130.1	75%	0.747	76%	0.763	S	S	*	*	S	Bend	trans	-57.1	-17.9	-173.9	20.8	-32	0	0	0	113
17	F	69.7	Low	75.1	Confident	171 Å²	171	133.9 Å²	133.9	75%	0.75	77%	0.768	S	S	*	*	S	Bend	trans	-121.3	96.7	175	-49.2	-71.8	0	0	0	107.3	P15 S19	P15-F17 CarbonylContact O-C 3.52Å; P15-F17 PolarHBondContact O-N 3.03Å; F17-S19 VanDerWaalsContact C-N 3.29Å; F17-S19 PolarHBondContact O-N 2.88Å
18	A	69.9	Low	75.7	Confident	85 Å²	85	132.5 Å²	132.5	70%	0.702	77%	0.772	S	S	*	*			trans	-60.1	105.3	155.6	0	0	0	0	0	105	V20	A18-V20 PolarHBondContact O-N 2.77Å
19	S	68.8	Low	76	Confident	114 Å²	114	137.3 Å²	137.3	80%	0.797	77%	0.773	S	S	*	*			trans	-63.5	93.1	174.5	52.4	0	0	0	0	106.7	F17 A21	F17-S19 VanDerWaalsContact C-N 3.29Å; F17-S19 PolarHBondContact O-N 2.88Å; S19-A21 PolarHBondContact O-N 2.96Å
20	V	74.5	Confident	76	Confident	122 Å²	122	138.3 Å²	138.3	74%	0.739	77%	0.769	S	S	*	*			trans	-63.3	110.4	167.5	-175.6	0	0	0	0	104.4	A18 Q22	A18-V20 PolarHBondContact O-N 2.77Å; V20-Q22 PolarHBondContact O-N 2.87Å
21	A	76.8	Confident	75.8	Confident	83 Å²	83	131.3 Å²	131.3	69%	0.686	75%	0.753	S	S	*	*			trans	-59.1	105.1	171.5	0	0	0	0	0	106.7	S19 L23	S19-A21 PolarHBondContact O-N 2.96Å; A21-L23 PolarHBondContact O-N 3.34Å; A21-L23 VanDerWaalsContact O-N 3.17Å
22	Q	75.7	Confident	75.8	Confident	186 Å²	186	129.5 Å²	129.5	87%	0.869	75%	0.754	S	S	*	*			trans	-68	115.4	173.9	-63.7	-179.1	-72.6	0	0	106	V20	V20-Q22 PolarHBondContact O-N 2.87Å
23	L	76.7	Confident	75.7	Confident	158 Å²	158	127.8 Å²	127.8	83%	0.827	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-70.9	137.1	170.2	-62.4	177.8	0	0	0	107.8	A21 R25	A21-L23 PolarHBondContact O-N 3.34Å; A21-L23 VanDerWaalsContact O-N 3.17Å; L23-R25 PolarHBondContact O-N 2.81Å
24	D	80.2	Confident	75	Confident	155 Å²	155	138.7 Å²	138.7	83%	0.829	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-56.2	134.5	170.8	-75.9	-34.3	0	0	0	109	V26	D24-V26 PolarHBondContact O-N 3.48Å
25	R	80.9	Confident	75.2	Confident	244 Å²	244	140.5 Å²	140.5	92%	0.921	78%	0.781	S	S	*	*	P	Polyproline II helix	trans	-65.6	125.2	174.6	-66.4	-178.9	-175.6	155.2	0.3	107.9	L23 L27	L23-R25 PolarHBondContact O-N 2.81Å; R25-L27 PolarHBondContact O-N 3.04Å
26	V	81.4	Confident	75.5	Confident	102 Å²	102	142.9 Å²	142.9	62%	0.618	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-72.3	118	171.3	179.1	0	0	0	0	107.7	D24 G28 Y29	D24-V26 PolarHBondContact O-N 3.48Å; V26-G28 PolarHBondContact O-N 3.01Å; V26-Y29 WeakPolarHBondContact O-CB 3.43Å; V26-Y29 PolarHBondContact O-N 2.97Å
27	L	80.8	Confident	75.9	Confident	179 Å²	179	144.5 Å²	144.5	94%	0.937	79%	0.792	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.1	127.3	179	-176.1	66.6	0	0	0	110.1	R25 Y29	R25-L27 PolarHBondContact O-N 3.04Å; L27-Y29 VanDerWaalsContact C-N 3.29Å
28	G	85.6	Confident	76.2	Confident	83 Å²	83	142.9 Å²	142.9	86%	0.856	80%	0.795	S	S	*	*	T	Hydrogen-bonded Turn	trans	82.9	-1.9	-177.7	0	0	0	0	0	114.9	V26	V26-G28 PolarHBondContact O-N 3.01Å
29	Y	80.5	Confident	76.6	Confident	160 Å²	160	146.6 Å²	146.6	63%	0.627	80%	0.801	S	S	*	*			trans	-93.6	106.2	168.9	-176.4	-102.9	0	0	0	110.1	V26 L27 P31	V26-Y29 WeakPolarHBondContact O-CB 3.43Å; V26-Y29 PolarHBondContact O-N 2.97Å; L27-Y29 VanDerWaalsContact C-N 3.29Å; Y29-P31 HydrophobicContact CE1-CB 4.02Å; Y29-P31 WeakPolarHBondContact O-CD 3.46Å
30	E	79.2	Confident	77.1	Confident	160 Å²	160	148.7 Å²	148.7	75%	0.748	80%	0.801	S	S	*	*			trans	-88.2	112.4	165.8	-86.1	-62	143.8	0	0	109	S32	E30-S32 PolarHBondContact O-N 3.15Å
31	P	76.5	Confident	77.3	Confident	84 Å²	84	150.6 Å²	150.6	55%	0.545	81%	0.805	S	S	.	*			trans	-62.6	113.7	169.9	26.5	-30.6	0	0	0	107.6	Y29 G33	Y29-P31 HydrophobicContact CE1-CB 4.02Å; Y29-P31 WeakPolarHBondContact O-CD 3.46Å; P31-G33 VanDerWaalsContact C-N 3.31Å; P31-G33 PolarHBondContact O-N 3.24Å
32	S	76.8	Confident	77.4	Confident	119 Å²	119	155.8 Å²	155.8	83%	0.832	81%	0.814	S	S	*	*			trans	-67.8	93.2	173.4	-62.7	0	0	0	0	108.7	E30 R34	E30-S32 PolarHBondContact O-N 3.15Å; S32-R34 PolarHBondContact O-N 3.11Å
33	G	72.4	Confident	77.5	Confident	74 Å²	74	153.3 Å²	153.3	76%	0.763	81%	0.81	S	S	*	*			trans	-69.3	123.1	169.1	0	0	0	0	0	109.2	P31	P31-G33 VanDerWaalsContact C-N 3.31Å; P31-G33 PolarHBondContact O-N 3.24Å
34	R	59.2	Low	77.6	Confident	322 Å²	322	152.9 Å²	152.9	100%	1.215	81%	0.808	S	S	*	*			trans	-84.9	0	159.6	-79.4	-173.7	177.5	-176.6	-0.2	109.4	S32	S32-R34 PolarHBondContact O-N 3.11Å

Retrieved 34 of 34 residues in 14 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).