A0A077ZHA9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHA9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 129 aa.

						>A0A077ZHA9_TRITR|A0A077ZHA9
MAYDGFGPHRIDVISQKQHYFVELTQLAAHGRDVTAKGFQVLPRRNVMLVERLQDRFKDAREPRYTGPVRPQCSSVRSKRSLYSWSFWAHKWRNGLSFEDSLSVLPTAPVSYGSEESRRARVFDGQRGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	32.1	Very low	32.7	Very low	238 Å²	238	146 Å²	146	100%	1.172	77%	0.771	S	S	*	*				0	91.7	0	-67.9	-178.6	174.3	0	0	107.3
2	A	32.3	Very low	32.7	Very low	95 Å²	95	141.8 Å²	141.8	79%	0.785	75%	0.75	S	S	*	*			trans	-90.7	118.1	175.5	0	0	0	0	0	106.8	D4	A2-D4 PolarHBondContact O-N 3.33Å
3	Y	31.7	Very low	33.2	Very low	226 Å²	226	137.8 Å²	137.8	89%	0.886	73%	0.734	S	S	*	*			trans	-66.3	117.5	169.3	-76.9	-91.5	0	0	0	107	G5	Y3-G5 VanDerWaalsContact C-N 3.26Å; Y3-G5 PolarHBondContact O-N 3.42Å
4	D	31.9	Very low	33.3	Very low	159 Å²	159	135.4 Å²	135.4	85%	0.85	72%	0.719	S	S	*	*			trans	-56.7	95.6	169	-72.6	-47.3	0	0	0	107.7	A2 F6	A2-D4 PolarHBondContact O-N 3.33Å; D4-F6 PolarHBondContact O-N 2.93Å
5	G	30	Very low	33.4	Very low	65 Å²	65	130.8 Å²	130.8	67%	0.67	70%	0.703	S	S	*	*			trans	-57.4	112.9	178.6	0	0	0	0	0	107.5	Y3 G7	Y3-G5 VanDerWaalsContact C-N 3.26Å; Y3-G5 PolarHBondContact O-N 3.42Å; G5-G7 PolarHBondContact O-N 3.44Å
6	F	35	Very low	33.7	Very low	182 Å²	182	128.8 Å²	128.8	80%	0.798	69%	0.688	S	S	*	*			trans	-21.2	101.5	163.2	-71.8	-94	0	0	0	109.8	D4 H9	D4-F6 PolarHBondContact O-N 2.93Å; F6-H9 AromaticContact CD1-NE2 3.67Å
7	G	27.8	Very low	33.8	Very low	49 Å²	49	128.5 Å²	128.5	51%	0.505	68%	0.679	S	S	.	*			trans	-48.6	138.6	174.6	0	0	0	0	0	107.3	G5 H9	G5-G7 PolarHBondContact O-N 3.44Å; G7-H9 PolarHBondContact O-N 3.19Å
8	P	35.8	Very low	33.9	Very low	114 Å²	114	128.4 Å²	128.4	74%	0.74	67%	0.674	S	S	*	*			trans	-51.7	107.9	-170.7	22.3	-32.8	0	0	0	106.7	R10	P8-R10 PolarHBondContact O-N 3.28Å
9	H	37.8	Very low	34.3	Very low	141 Å²	141	128.4 Å²	128.4	65%	0.653	67%	0.67	S	S	*	*			trans	-62.8	86.3	169.2	-72.2	-65.1	0	0	0	103.6	F6 G7 I11	F6-H9 AromaticContact CD1-NE2 3.67Å; G7-H9 PolarHBondContact O-N 3.19Å; H9-I11 HydrophobicContact CB-CD1 4.47Å; H9-I11 HydrophobicContact CB-CG1 3.88Å; H9-I11 PolarHBondContact O-N 2.9Å
10	R	31	Very low	34.6	Very low	225 Å²	225	129 Å²	129	85%	0.849	66%	0.664	S	S	*	*			trans	-62.4	72.2	154	-73.3	-179.4	169	-176.8	-2.5	103.3	P8 D12	P8-R10 PolarHBondContact O-N 3.28Å; R10-D12 VanDerWaalsContact C-N 3.25Å; R10-D12 PolarHBondContact O-N 3.31Å
11	I	34.4	Very low	34.7	Very low	112 Å²	112	129.4 Å²	129.4	57%	0.574	66%	0.661	S	S	*	*			trans	-57.6	106.7	165.6	-62.5	174.3	0	0	0	101.4	H9 V13	H9-I11 HydrophobicContact CB-CD1 4.47Å; H9-I11 HydrophobicContact CB-CG1 3.88Å; H9-I11 PolarHBondContact O-N 2.9Å; I11-V13 PolarHBondContact O-N 3.39Å
12	D	32.2	Very low	35	Very low	96 Å²	96	121.9 Å²	121.9	51%	0.513	63%	0.628	S	S	.	*			trans	-54	96.1	179.2	-93.4	-41.5	0	0	0	107.2	R10 I14 S15 Q16	R10-D12 VanDerWaalsContact C-N 3.25Å; R10-D12 PolarHBondContact O-N 3.31Å; D12-I14 PolarHBondContact O-N 3.12Å; D12-S15 WeakPolarHBondContact CB-OG 3.19Å; D12-S15 WeakPolarHBondContact O-CB 3.21Å; D12-S15 PolarHBondContact O-N 3.07Å; D12-Q16 PolarHBondContact O-N 2.82Å
13	V	39.7	Very low	35.3	Very low	90 Å²	90	122 Å²	122	55%	0.545	61%	0.612	S	S	.	*	H	α-helix	trans	-56.3	-22.8	171.2	-179.1	0	0	0	0	108.6	I11 Q16 K17	I11-V13 PolarHBondContact O-N 3.39Å; V13-Q16 PolarHBondContact O-N 2.83Å; V13-K17 HydrophobicContact CG1-CG 4.43Å; V13-K17 VanDerWaalsContact O-CB 3.31Å; V13-K17 WeakPolarHBondContact O-CB 2.99Å; V13-K17 VanDerWaalsContact O-CG 3.24Å; V13-K17 WeakPolarHBondContact O-CG 3.39Å; V13-K17 PolarHBondContact O-N 2.83Å
14	I	34	Very low	35.7	Very low	103 Å²	103	116.2 Å²	116.2	53%	0.528	60%	0.596	S	S	.	*	H	α-helix	trans	-59.7	-45.9	170.3	-54.8	175.5	0	0	0	111.3	D12 K17 Q18	D12-I14 PolarHBondContact O-N 3.12Å; I14-K17 WeakPolarHBondContact O-CB 3.46Å; I14-K17 PolarHBondContact O-N 2.83Å; I14-Q18 WeakPolarHBondContact O-CG 3.01Å; I14-Q18 PolarHBondContact O-N 3.21Å
15	S	35.7	Very low	36	Very low	67 Å²	67	112.6 Å²	112.6	47%	0.469	58%	0.58	S	S	.	*	H	α-helix	trans	-67.4	-39.8	179.8	-56.5	0	0	0	0	111.7	D12 Q18 H19	D12-S15 WeakPolarHBondContact CB-OG 3.19Å; D12-S15 WeakPolarHBondContact O-CB 3.21Å; D12-S15 PolarHBondContact O-N 3.07Å; S15-Q18 PolarHBondContact O-N 2.9Å; S15-H19 PolarHBondContact O-N 2.85Å
16	Q	37.4	Very low	36.5	Very low	99 Å²	99	115 Å²	115	46%	0.463	57%	0.574	S	S	.	*	H	α-helix	trans	-65.5	-43.3	171.6	-79.5	-171	-9.4	0	0	111.5	D12 V13 Q18 H19 Y20	D12-Q16 PolarHBondContact O-N 2.82Å; V13-Q16 PolarHBondContact O-N 2.83Å; Q16-Q18 VanDerWaalsContact C-N 3.28Å; Q16-Q18 PolarHBondContact O-N 3.09Å; Q16-H19 PolarHBondContact O-N 2.95Å; Q16-H19 VanDerWaalsContact O-N 3.16Å; Q16-Y20 HydrophobicContact CB-CD2 4.33Å; Q16-Y20 HydrophobicContact CB-CE2 4.09Å; Q16-Y20 WeakPolarHBondContact O-CD2 3.49Å; Q16-Y20 PolarHBondContact O-N 2.99Å
17	K	35.4	Very low	36.8	Very low	124 Å²	124	111.7 Å²	111.7	54%	0.539	56%	0.564	S	S	.	*	H	α-helix	trans	-55.9	-44	175.2	-82.5	178.2	178.2	-175	0	111.5	V13 I14 F21	V13-K17 HydrophobicContact CG1-CG 4.43Å; V13-K17 VanDerWaalsContact O-CB 3.31Å; V13-K17 WeakPolarHBondContact O-CB 2.99Å; V13-K17 VanDerWaalsContact O-CG 3.24Å; V13-K17 WeakPolarHBondContact O-CG 3.39Å; V13-K17 PolarHBondContact O-N 2.83Å; I14-K17 WeakPolarHBondContact O-CB 3.46Å; I14-K17 PolarHBondContact O-N 2.83Å; K17-F21 WeakPolarHBondContact O-CB 3.26Å; K17-F21 PolarHBondContact O-N 3.26Å
18	Q	36.4	Very low	37.4	Very low	127 Å²	127	113.1 Å²	113.1	59%	0.593	57%	0.571	S	S	*	*	H	α-helix	trans	-64.6	-43.4	177.8	-74.2	-179.9	-5.8	0	0	111.6	I14 S15 Q16 Y20 F21 V22	I14-Q18 WeakPolarHBondContact O-CG 3.01Å; I14-Q18 PolarHBondContact O-N 3.21Å; S15-Q18 PolarHBondContact O-N 2.9Å; Q16-Q18 VanDerWaalsContact C-N 3.28Å; Q16-Q18 PolarHBondContact O-N 3.09Å; Q18-Y20 PolarHBondContact O-N 3.49Å; Q18-F21 PolarHBondContact O-N 3.09Å; Q18-V22 WeakPolarHBondContact O-CG2 3.15Å; Q18-V22 PolarHBondContact O-N 3.07Å
19	H	40.9	Very low	37.5	Very low	127 Å²	127	111.6 Å²	111.6	59%	0.588	57%	0.568	S	S	*	*	H	α-helix	trans	-63.7	-44	179.7	-143.7	-78.5	0	0	0	112.3	S15 Q16 F21 V22 E23	S15-H19 PolarHBondContact O-N 2.85Å; Q16-H19 PolarHBondContact O-N 2.95Å; Q16-H19 VanDerWaalsContact O-N 3.16Å; H19-F21 VanDerWaalsContact C-N 3.35Å; H19-F21 PolarHBondContact O-N 3.45Å; H19-V22 PolarHBondContact O-N 3.06Å; H19-E23 IonicContact CE1-OE1 3.59Å; H19-E23 IonicContact ND1-OE1 3.27Å; H19-E23 PolarHBondContact ND1-OE1 3.18Å; H19-E23 PolarHBondContact O-N 3.42Å; H19-E23 VanDerWaalsContact O-N 3.16Å
20	Y	40.4	Very low	37.4	Very low	140 Å²	140	110.2 Å²	110.2	55%	0.549	56%	0.561	S	S	.	*	H	α-helix	trans	-66.9	-34.7	176.2	-69.8	-64.2	0	0	0	112.7	Q16 Q18 L24	Q16-Y20 HydrophobicContact CB-CD2 4.33Å; Q16-Y20 HydrophobicContact CB-CE2 4.09Å; Q16-Y20 WeakPolarHBondContact O-CD2 3.49Å; Q16-Y20 PolarHBondContact O-N 2.99Å; Q18-Y20 PolarHBondContact O-N 3.49Å; Y20-L24 WeakPolarHBondContact O-CB 3.48Å; Y20-L24 WeakPolarHBondContact O-CG 3.43Å; Y20-L24 PolarHBondContact O-N 2.64Å
21	F	37.8	Very low	37.6	Very low	139 Å²	139	102.5 Å²	102.5	61%	0.61	55%	0.552	S	S	*	*	H	α-helix	trans	-66.5	-39.2	175.2	-106.8	-87.2	0	0	0	112.2	K17 Q18 H19 T25	K17-F21 WeakPolarHBondContact O-CB 3.26Å; K17-F21 PolarHBondContact O-N 3.26Å; Q18-F21 PolarHBondContact O-N 3.09Å; H19-F21 VanDerWaalsContact C-N 3.35Å; H19-F21 PolarHBondContact O-N 3.45Å; F21-T25 VanDerWaalsContact O-CB 3.31Å; F21-T25 WeakPolarHBondContact O-CB 3.3Å; F21-T25 PolarHBondContact O-N 2.87Å; F21-T25 PolarHBondContact O-OG1 3.2Å
22	V	36.6	Very low	37.7	Very low	80 Å²	80	108.3 Å²	108.3	49%	0.485	57%	0.567	S	S	.	*	H	α-helix	trans	-65.4	-45.4	177.6	174.9	0	0	0	0	110.6	Q18 H19 L24 T25 Q26	Q18-V22 WeakPolarHBondContact O-CG2 3.15Å; Q18-V22 PolarHBondContact O-N 3.07Å; H19-V22 PolarHBondContact O-N 3.06Å; V22-L24 PolarHBondContact O-N 2.98Å; V22-T25 PolarHBondContact O-N 3.26Å; V22-Q26 HydrophobicContact CG1-CG 4.46Å; V22-Q26 WeakPolarHBondContact O-CB 3.35Å; V22-Q26 WeakPolarHBondContact O-CG 3.46Å; V22-Q26 PolarHBondContact O-N 3.02Å
23	E	40.1	Very low	37.9	Very low	96 Å²	96	110 Å²	110	45%	0.449	58%	0.576	S	S	.	*	H	α-helix	trans	-62.7	-42.6	177.7	-75	177.1	-163.8	0	0	112.3	H19 L27	H19-E23 IonicContact CE1-OE1 3.59Å; H19-E23 IonicContact ND1-OE1 3.27Å; H19-E23 PolarHBondContact ND1-OE1 3.18Å; H19-E23 PolarHBondContact O-N 3.42Å; H19-E23 VanDerWaalsContact O-N 3.16Å; E23-L27 WeakPolarHBondContact O-CB 3.42Å; E23-L27 PolarHBondContact O-N 3.47Å
24	L	40.4	Very low	37.6	Very low	105 Å²	105	109.5 Å²	109.5	55%	0.55	57%	0.573	S	S	.	*	H	α-helix	trans	-68.4	-38.4	177.3	-80.5	165.1	0	0	0	112.7	Y20 V22 L27 A28	Y20-L24 WeakPolarHBondContact O-CB 3.48Å; Y20-L24 WeakPolarHBondContact O-CG 3.43Å; Y20-L24 PolarHBondContact O-N 2.64Å; V22-L24 PolarHBondContact O-N 2.98Å; L24-L27 PolarHBondContact O-N 3.46Å; L24-A28 WeakPolarHBondContact O-CB 3.24Å; L24-A28 PolarHBondContact O-N 2.99Å
25	T	36.2	Very low	37.6	Very low	84 Å²	84	111.1 Å²	111.1	52%	0.515	59%	0.587	S	S	.	*	H	α-helix	trans	-70.6	-37	178.7	-48.4	0	0	0	0	110.9	F21 V22 A28 A29	F21-T25 VanDerWaalsContact O-CB 3.31Å; F21-T25 WeakPolarHBondContact O-CB 3.3Å; F21-T25 PolarHBondContact O-N 2.87Å; F21-T25 PolarHBondContact O-OG1 3.2Å; V22-T25 PolarHBondContact O-N 3.26Å; T25-A28 PolarHBondContact O-N 3.22Å; T25-A29 VanDerWaalsContact O-CB 3.3Å; T25-A29 WeakPolarHBondContact O-CB 3.42Å; T25-A29 PolarHBondContact O-N 2.92Å
26	Q	42.1	Very low	37.4	Very low	115 Å²	115	111.4 Å²	111.4	54%	0.537	59%	0.594	S	S	.	*	H	α-helix	trans	-64.3	-42	172.3	-76.3	-180	-6.9	0	0	111.7	V22 A28 A29 H30	V22-Q26 HydrophobicContact CG1-CG 4.46Å; V22-Q26 WeakPolarHBondContact O-CB 3.35Å; V22-Q26 WeakPolarHBondContact O-CG 3.46Å; V22-Q26 PolarHBondContact O-N 3.02Å; Q26-A28 PolarHBondContact O-N 2.98Å; Q26-A29 PolarHBondContact O-N 3.39Å; Q26-H30 WeakPolarHBondContact O-CB 3.41Å; Q26-H30 PolarHBondContact O-CD2 2.85Å; Q26-H30 PolarHBondContact O-N 2.8Å
27	L	41.3	Very low	37.3	Very low	113 Å²	113	115.4 Å²	115.4	59%	0.592	61%	0.61	S	S	*	*	H	α-helix	trans	-63.7	-38.8	174.6	-103.7	144.7	0	0	0	112.8	E23 L24 G31	E23-L27 WeakPolarHBondContact O-CB 3.42Å; E23-L27 PolarHBondContact O-N 3.47Å; L24-L27 PolarHBondContact O-N 3.46Å; L27-G31 PolarHBondContact O-N 2.89Å
28	A	39.8	Very low	37	Very low	78 Å²	78	113.4 Å²	113.4	65%	0.645	62%	0.624	S	S	*	*	H	α-helix	trans	-70.8	-42.6	177	0	0	0	0	0	112.4	L24 T25 Q26 H30 G31	L24-A28 WeakPolarHBondContact O-CB 3.24Å; L24-A28 PolarHBondContact O-N 2.99Å; T25-A28 PolarHBondContact O-N 3.22Å; Q26-A28 PolarHBondContact O-N 2.98Å; A28-H30 VanDerWaalsContact C-N 3.33Å; A28-H30 PolarHBondContact O-N 3.5Å; A28-G31 PolarHBondContact O-N 3.47Å
29	A	36.9	Very low	36.9	Very low	82 Å²	82	115.1 Å²	115.1	68%	0.678	63%	0.63	S	S	*	*	H	α-helix	trans	-66.3	-35.1	178.4	0	0	0	0	0	112.2	T25 Q26 G31	T25-A29 VanDerWaalsContact O-CB 3.3Å; T25-A29 WeakPolarHBondContact O-CB 3.42Å; T25-A29 PolarHBondContact O-N 2.92Å; Q26-A29 PolarHBondContact O-N 3.39Å; A29-G31 VanDerWaalsContact C-N 3.33Å
30	H	36.8	Very low	36.5	Very low	112 Å²	112	118 Å²	118	52%	0.519	64%	0.644	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.6	2.5	177.6	-68.5	-62.4	0	0	0	114.2	Q26 A28 R32 D33 V34	Q26-H30 WeakPolarHBondContact O-CB 3.41Å; Q26-H30 PolarHBondContact O-CD2 2.85Å; Q26-H30 PolarHBondContact O-N 2.8Å; A28-H30 VanDerWaalsContact C-N 3.33Å; A28-H30 PolarHBondContact O-N 3.5Å; H30-R32 PolarHBondContact O-N 3.13Å; H30-D33 PolarHBondContact O-N 3.13Å; H30-V34 HydrophobicContact CB-CG2 3.49Å; H30-V34 VanDerWaalsContact CB-CG2 3.49Å; H30-V34 WeakPolarHBondContact O-CG2 3.31Å; H30-V34 PolarHBondContact O-N 3.35Å
31	G	35.3	Very low	36.4	Very low	63 Å²	63	115.8 Å²	115.8	65%	0.649	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	-2.4	-176.8	0	0	0	0	0	116.7	L27 A28 A29	L27-G31 PolarHBondContact O-N 2.89Å; A28-G31 PolarHBondContact O-N 3.47Å; A29-G31 VanDerWaalsContact C-N 3.33Å
32	R	37.2	Very low	36.4	Very low	234 Å²	234	115.8 Å²	115.8	88%	0.883	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.6	-20.1	169.5	-82.3	-175.1	175.3	173.2	-0.6	115.6	H30	H30-R32 PolarHBondContact O-N 3.13Å
33	D	35.2	Very low	36.4	Very low	132 Å²	132	117.3 Å²	117.3	71%	0.706	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-130.5	5.6	-172.5	-76.9	-36.3	0	0	0	116	H30 T35	H30-D33 PolarHBondContact O-N 3.13Å; D33-T35 PolarHBondContact O-N 2.91Å
34	V	34.3	Very low	36.4	Very low	80 Å²	80	123.4 Å²	123.4	49%	0.485	68%	0.681	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.3	53.4	164.1	-157.7	0	0	0	0	111.1	H30	H30-V34 HydrophobicContact CB-CG2 3.49Å; H30-V34 VanDerWaalsContact CB-CG2 3.49Å; H30-V34 WeakPolarHBondContact O-CG2 3.31Å; H30-V34 PolarHBondContact O-N 3.35Å
35	T	32.6	Very low	36.3	Very low	136 Å²	136	128.6 Å²	128.6	83%	0.834	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.9	-6	151.4	31.3	0	0	0	0	111.5	D33 K37	D33-T35 PolarHBondContact O-N 2.91Å; T35-K37 PolarHBondContact O-N 3Å
36	A	33.1	Very low	36.3	Very low	74 Å²	74	129.2 Å²	129.2	61%	0.612	69%	0.694	S	S	*	*	S	Bend	trans	-81.5	104.8	172.4	0	0	0	0	0	111
37	K	33.5	Very low	36.1	Very low	182 Å²	182	127.9 Å²	127.9	79%	0.791	69%	0.693	S	S	*	*	S	Bend	trans	84.2	80.7	168	-54	-177.9	178.8	179.6	0	116.2	T35 F39	T35-K37 PolarHBondContact O-N 3Å; K37-F39 WeakPolarHBondContact O-CD2 3.36Å; K37-F39 PolarHBondContact O-N 3.34Å; K37-F39 VanDerWaalsContact O-N 3.15Å
38	G	30.9	Very low	35.8	Very low	82 Å²	82	127.3 Å²	127.3	85%	0.845	69%	0.688	S	S	*	*	S	Bend	trans	81.2	1.2	137	0	0	0	0	0	118.6
39	F	34.1	Very low	35.7	Very low	164 Å²	164	128.3 Å²	128.3	72%	0.719	68%	0.682	S	S	*	*			trans	-103.9	95.1	174.5	-63.6	-77.2	0	0	0	110.5	K37 V41	K37-F39 WeakPolarHBondContact O-CD2 3.36Å; K37-F39 PolarHBondContact O-N 3.34Å; K37-F39 VanDerWaalsContact O-N 3.15Å; F39-V41 HydrophobicContact CB-CG2 4.41Å; F39-V41 PolarHBondContact O-N 3.48Å
40	Q	32.3	Very low	35.7	Very low	187 Å²	187	127.6 Å²	127.6	87%	0.874	67%	0.669	S	S	*	*			trans	-74.5	82.4	170.4	-158.3	177.3	46.1	0	0	108.4	L42	Q40-L42 PolarHBondContact O-N 3.17Å; Q40-L42 VanDerWaalsContact O-N 3.13Å
41	V	38.9	Very low	35.9	Very low	93 Å²	93	127.7 Å²	127.7	56%	0.564	67%	0.67	S	S	*	*			trans	-73.2	104.8	173.9	-178.6	0	0	0	0	107.8	F39 P43	F39-V41 HydrophobicContact CB-CG2 4.41Å; F39-V41 PolarHBondContact O-N 3.48Å; V41-P43 VanDerWaalsContact O-CD 3.24Å; V41-P43 WeakPolarHBondContact O-CD 3.41Å; V41-P43 VanDerWaalsContact O-N 3.08Å
42	L	36.2	Very low	36	Very low	139 Å²	139	131.9 Å²	131.9	73%	0.728	67%	0.666	S	S	*	*			trans	-52.8	109.6	177.5	-74.7	163.5	0	0	0	110.7	Q40 R44	Q40-L42 PolarHBondContact O-N 3.17Å; Q40-L42 VanDerWaalsContact O-N 3.13Å; L42-R44 PolarHBondContact O-N 3.37Å
43	P	38.3	Very low	36.2	Very low	113 Å²	113	124.5 Å²	124.5	73%	0.734	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	27	-156.5	31.9	-34.4	0	0	0	115.9	V41	V41-P43 VanDerWaalsContact O-CD 3.24Å; V41-P43 WeakPolarHBondContact O-CD 3.41Å; V41-P43 VanDerWaalsContact O-N 3.08Å
44	R	39.2	Very low	36.4	Very low	223 Å²	223	124.1 Å²	124.1	84%	0.842	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-132.9	-20	-176.6	-81.4	-172.2	168	-176.1	-4.1	118.7	L42	L42-R44 PolarHBondContact O-N 3.37Å
45	R	38.8	Very low	36.8	Very low	214 Å²	214	125.3 Å²	125.3	81%	0.808	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.8	-25.3	-178.2	-74.6	-174.7	174.8	176.2	-0.9	114.3
46	N	35.7	Very low	37.2	Very low	98 Å²	98	125.6 Å²	125.6	52%	0.524	63%	0.627	S	S	.	*	H	α-helix	trans	-84.8	-27.9	-174.1	-70.7	-7.4	0	0	0	113.9	M48 L49 V50	N46-M48 PolarHBondContact O-N 2.92Å; N46-L49 WeakPolarHBondContact O-CB 3.4Å; N46-L49 PolarHBondContact O-N 3Å; N46-V50 WeakPolarHBondContact O-CG2 3.24Å; N46-V50 PolarHBondContact O-N 3.03Å
47	V	37.6	Very low	37.6	Very low	86 Å²	86	128.4 Å²	128.4	52%	0.521	63%	0.626	S	S	.	*	H	α-helix	trans	-63	-43.8	178.9	-172.7	0	0	0	0	110.9	L49 V50 E51	V47-L49 PolarHBondContact O-N 3.47Å; V47-V50 PolarHBondContact O-N 3.16Å; V47-E51 PolarHBondContact O-N 3Å
48	M	35.1	Very low	38	Very low	101 Å²	101	128 Å²	128	50%	0.498	63%	0.625	S	S	.	*	H	α-helix	trans	-61.7	-31	174.2	-84.7	-159.8	-61.6	0	0	113.2	N46 R52	N46-M48 PolarHBondContact O-N 2.92Å; M48-R52 WeakPolarHBondContact O-CB 3.47Å; M48-R52 WeakPolarHBondContact O-CG 3.47Å; M48-R52 PolarHBondContact O-N 3.39Å; M48-R52 VanDerWaalsContact O-N 3.09Å
49	L	38.1	Very low	38.5	Very low	99 Å²	99	130.7 Å²	130.7	52%	0.518	62%	0.62	S	S	.	*	H	α-helix	trans	-71.9	-42	176.7	-101.6	161.5	0	0	0	111	N46 V47 L53	N46-L49 WeakPolarHBondContact O-CB 3.4Å; N46-L49 PolarHBondContact O-N 3Å; V47-L49 PolarHBondContact O-N 3.47Å; L49-L53 VanDerWaalsContact O-CB 3.26Å; L49-L53 WeakPolarHBondContact O-CB 3.42Å; L49-L53 WeakPolarHBondContact O-CD1 3.31Å; L49-L53 WeakPolarHBondContact O-CG 3.42Å; L49-L53 PolarHBondContact O-N 2.87Å
50	V	36.9	Very low	38.8	Very low	67 Å²	67	124.9 Å²	124.9	41%	0.406	60%	0.602	S	S	.	*	H	α-helix	trans	-66.9	-47.2	178.5	177.1	0	0	0	0	111	N46 V47 R52 L53 Q54	N46-V50 WeakPolarHBondContact O-CG2 3.24Å; N46-V50 PolarHBondContact O-N 3.03Å; V47-V50 PolarHBondContact O-N 3.16Å; V50-R52 PolarHBondContact O-N 3.04Å; V50-L53 PolarHBondContact O-N 3.15Å; V50-Q54 WeakPolarHBondContact O-CB 3.38Å; V50-Q54 PolarHBondContact O-N 3.49Å
51	E	41.2	Very low	39	Very low	115 Å²	115	127.4 Å²	127.4	54%	0.537	60%	0.603	S	S	.	*	H	α-helix	trans	-61.9	-45.3	176.8	-74.6	-178.4	163.1	0	0	111.4	V47 L53 Q54 D55	V47-E51 PolarHBondContact O-N 3Å; E51-L53 VanDerWaalsContact C-N 3.27Å; E51-L53 PolarHBondContact O-N 3.27Å; E51-Q54 PolarHBondContact O-N 2.93Å; E51-D55 PolarHBondContact O-N 2.7Å
52	R	37.5	Very low	38.8	Very low	150 Å²	150	131 Å²	131	57%	0.566	61%	0.614	S	S	*	*	H	α-helix	trans	-70.4	-20.1	177.4	-71.8	-178.7	-172.4	-177.7	3.6	114.3	M48 V50 R56	M48-R52 WeakPolarHBondContact O-CB 3.47Å; M48-R52 WeakPolarHBondContact O-CG 3.47Å; M48-R52 PolarHBondContact O-N 3.39Å; M48-R52 VanDerWaalsContact O-N 3.09Å; V50-R52 PolarHBondContact O-N 3.04Å; R52-R56 WeakPolarHBondContact O-CB 3.42Å; R52-R56 WeakPolarHBondContact O-CG 3.4Å; R52-R56 PolarHBondContact O-NE 3.29Å; R52-R56 VanDerWaalsContact O-NE 3.09Å
53	L	41.2	Very low	39	Very low	79 Å²	79	128.3 Å²	128.3	41%	0.414	61%	0.605	S	S	.	*	H	α-helix	trans	-81	-45.4	171.4	-77	168.7	0	0	0	109.7	L49 V50 E51 R56 F57	L49-L53 VanDerWaalsContact O-CB 3.26Å; L49-L53 WeakPolarHBondContact O-CB 3.42Å; L49-L53 WeakPolarHBondContact O-CD1 3.31Å; L49-L53 WeakPolarHBondContact O-CG 3.42Å; L49-L53 PolarHBondContact O-N 2.87Å; V50-L53 PolarHBondContact O-N 3.15Å; E51-L53 VanDerWaalsContact C-N 3.27Å; E51-L53 PolarHBondContact O-N 3.27Å; L53-R56 CarbonylContact O-C 3.58Å; L53-R56 PolarHBondContact O-N 2.84Å; L53-F57 HydrophobicContact CB-CD2 4.29Å; L53-F57 HydrophobicContact CB-CE2 4.22Å; L53-F57 HydrophobicContact CD2-CE2 4.05Å; L53-F57 WeakPolarHBondContact O-CD2 3Å; L53-F57 PolarHBondContact O-N 3.42Å
54	Q	39.8	Very low	38.7	Very low	125 Å²	125	134.1 Å²	134.1	58%	0.584	61%	0.612	S	S	*	*	H	α-helix	trans	-60.6	-45.6	177.1	-81.5	-171.6	-6.9	0	0	112.4	V50 E51 R56 F57 K58	V50-Q54 WeakPolarHBondContact O-CB 3.38Å; V50-Q54 PolarHBondContact O-N 3.49Å; E51-Q54 PolarHBondContact O-N 2.93Å; Q54-R56 VanDerWaalsContact C-N 3.28Å; Q54-R56 PolarHBondContact O-N 3.26Å; Q54-F57 PolarHBondContact O-N 3.05Å; Q54-F57 VanDerWaalsContact O-N 3.12Å; Q54-K58 PolarHBondContact O-N 2.88Å
55	D	42.8	Very low	38.6	Very low	104 Å²	104	133.6 Å²	133.6	56%	0.556	61%	0.611	S	S	*	*	H	α-helix	trans	-62.1	-39.4	175.9	-83.5	-9.3	0	0	0	111.2	E51 F57 K58 D59	E51-D55 PolarHBondContact O-N 2.7Å; D55-F57 VanDerWaalsContact C-N 3.34Å; D55-F57 PolarHBondContact O-N 3.34Å; D55-K58 PolarHBondContact O-N 3.34Å; D55-D59 PolarHBondContact O-N 3.25Å
56	R	39.3	Very low	38.3	Very low	142 Å²	142	130.3 Å²	130.3	54%	0.536	62%	0.616	S	S	.	*	H	α-helix	trans	-71.8	-24.6	175.7	-77.8	-168.4	-91.4	-161.9	-4.3	114	R52 L53 Q54 A60	R52-R56 WeakPolarHBondContact O-CB 3.42Å; R52-R56 WeakPolarHBondContact O-CG 3.4Å; R52-R56 PolarHBondContact O-NE 3.29Å; R52-R56 VanDerWaalsContact O-NE 3.09Å; L53-R56 CarbonylContact O-C 3.58Å; L53-R56 PolarHBondContact O-N 2.84Å; Q54-R56 VanDerWaalsContact C-N 3.28Å; Q54-R56 PolarHBondContact O-N 3.26Å; R56-A60 WeakPolarHBondContact O-CA 3.2Å; R56-A60 WeakPolarHBondContact O-CB 3.15Å; R56-A60 PolarHBondContact O-N 2.82Å
57	F	41.7	Very low	37.9	Very low	133 Å²	133	128.1 Å²	128.1	58%	0.583	62%	0.616	S	S	*	*	H	α-helix	trans	-84.9	-23.8	175.1	-77.1	-64.2	0	0	0	113.2	L53 Q54 D55 D59 A60	L53-F57 HydrophobicContact CB-CD2 4.29Å; L53-F57 HydrophobicContact CB-CE2 4.22Å; L53-F57 HydrophobicContact CD2-CE2 4.05Å; L53-F57 WeakPolarHBondContact O-CD2 3Å; L53-F57 PolarHBondContact O-N 3.42Å; Q54-F57 PolarHBondContact O-N 3.05Å; Q54-F57 VanDerWaalsContact O-N 3.12Å; D55-F57 VanDerWaalsContact C-N 3.34Å; D55-F57 PolarHBondContact O-N 3.34Å; F57-D59 VanDerWaalsContact C-N 3.26Å; F57-A60 HydrophobicContact CD1-CB 4.48Å
58	K	41.8	Very low	37.6	Very low	175 Å²	175	129.8 Å²	129.8	76%	0.761	63%	0.628	S	S	*	*	H	α-helix	trans	-62.6	-38.6	165.6	-81.5	-176.9	176.9	175.3	0	111.1	Q54 D55	Q54-K58 PolarHBondContact O-N 2.88Å; D55-K58 PolarHBondContact O-N 3.34Å
59	D	42.6	Very low	37.8	Very low	138 Å²	138	131.3 Å²	131.3	74%	0.738	64%	0.643	S	S	*	*	H	α-helix	trans	-92.8	-20.2	-178.4	-68.5	-21.8	0	0	0	114.4	D55 F57 R61	D55-D59 PolarHBondContact O-N 3.25Å; F57-D59 VanDerWaalsContact C-N 3.26Å; D59-R61 PolarHBondContact O-N 3.5Å
60	A	40.5	Very low	37.6	Very low	42 Å²	42	137 Å²	137	35%	0.347	66%	0.658	S	S	.	*			trans	-77	72.9	177.2	0	0	0	0	0	111.1	R56 F57 E62	R56-A60 WeakPolarHBondContact O-CA 3.2Å; R56-A60 WeakPolarHBondContact O-CB 3.15Å; R56-A60 PolarHBondContact O-N 2.82Å; F57-A60 HydrophobicContact CD1-CB 4.48Å; A60-E62 PolarHBondContact O-N 3.05Å
61	R	35.4	Very low	37.5	Very low	239 Å²	239	138 Å²	138	90%	0.902	67%	0.665	S	S	*	*			trans	-44.6	114.8	143.6	-72.1	-179.4	175.4	-174.1	-1.6	107.2	D59	D59-R61 PolarHBondContact O-N 3.5Å
62	E	35.3	Very low	37.1	Very low	170 Å²	170	141.4 Å²	141.4	79%	0.794	68%	0.681	S	S	*	*			trans	7.4	106	176.2	-72.4	175.6	148.8	0	0	115.8	A60 R64	A60-E62 PolarHBondContact O-N 3.05Å; E62-R64 PolarHBondContact O-N 2.99Å
63	P	39.5	Very low	36.9	Very low	82 Å²	82	139.4 Å²	139.4	53%	0.532	69%	0.689	S	S	.	*			trans	-61.3	103.8	169.1	-7.1	16.7	0	0	0	109	Y65	P63-Y65 HydrophobicContact CB-CD2 3.55Å; P63-Y65 HydrophobicContact CB-CE2 4.08Å; P63-Y65 PolarHBondContact O-N 3.27Å
64	R	33.5	Very low	36.6	Very low	235 Å²	235	140.1 Å²	140.1	89%	0.887	70%	0.701	S	S	*	*			trans	-69.3	62.6	167.6	-65.8	-176.8	177.3	177.6	-0.5	109.7	E62 T66	E62-R64 PolarHBondContact O-N 2.99Å; R64-T66 PolarHBondContact O-N 3.16Å
65	Y	36.6	Very low	36.2	Very low	211 Å²	211	139.5 Å²	139.5	83%	0.827	71%	0.71	S	S	*	*			trans	-97.9	73.2	170.4	-78.1	-77.2	0	0	0	109.2	P63 G67	P63-Y65 HydrophobicContact CB-CD2 3.55Å; P63-Y65 HydrophobicContact CB-CE2 4.08Å; P63-Y65 PolarHBondContact O-N 3.27Å; Y65-G67 PolarHBondContact O-N 3.15Å
66	T	31.5	Very low	35.8	Very low	146 Å²	146	140.3 Å²	140.3	90%	0.896	72%	0.719	S	S	*	*			trans	-89.6	75.9	163.3	42.1	0	0	0	0	108.7	R64	R64-T66 PolarHBondContact O-N 3.16Å
67	G	28.6	Very low	35.3	Very low	52 Å²	52	145 Å²	145	54%	0.536	74%	0.737	S	S	.	*			trans	-132.6	123.5	170.9	0	0	0	0	0	109	Y65 V69	Y65-G67 PolarHBondContact O-N 3.15Å; G67-V69 PolarHBondContact O-N 3Å
68	P	31.8	Very low	34.9	Very low	120 Å²	120	143 Å²	143	78%	0.779	74%	0.739	S	S	*	*			trans	-66.4	110.1	-178.8	25.7	-31.6	0	0	0	109.5	R70	P68-R70 PolarHBondContact O-N 3.1Å
69	V	38.7	Very low	34.5	Very low	133 Å²	133	144 Å²	144	81%	0.806	74%	0.744	S	S	*	*			trans	-61.9	104.7	167.1	-179.5	0	0	0	0	106.2	G67 P71	G67-V69 PolarHBondContact O-N 3Å; V69-P71 WeakPolarHBondContact O-CD 3.43Å
70	R	32.7	Very low	34.1	Very low	220 Å²	220	149 Å²	149	83%	0.83	75%	0.752	S	S	*	*			trans	-78.7	109.2	172.1	-74.8	-176.7	175	-179.6	-1.3	107.8	P68 Q72	P68-R70 PolarHBondContact O-N 3.1Å; R70-Q72 PolarHBondContact O-N 2.99Å; R70-Q72 VanDerWaalsContact O-N 3.1Å
71	P	36.3	Very low	33.7	Very low	86 Å²	86	151.6 Å²	151.6	56%	0.558	77%	0.767	S	S	*	*			trans	-70.5	108.3	172.4	28.5	-29.8	0	0	0	108	V69 C73	V69-P71 WeakPolarHBondContact O-CD 3.43Å; P71-C73 VanDerWaalsContact C-N 3.33Å; P71-C73 PolarHBondContact O-N 2.93Å
72	Q	32.1	Very low	33.6	Very low	187 Å²	187	147.7 Å²	147.7	87%	0.874	76%	0.764	S	S	*	*			trans	-75.3	90.8	168.4	-73.8	-174.9	0.4	0	0	108.1	R70 S74	R70-Q72 PolarHBondContact O-N 2.99Å; R70-Q72 VanDerWaalsContact O-N 3.1Å; Q72-S74 PolarHBondContact O-N 3.01Å; Q72-S74 VanDerWaalsContact O-N 3.09Å
73	C	33.6	Very low	33.5	Very low	109 Å²	109	149.5 Å²	149.5	74%	0.736	77%	0.765	S	S	*	*			trans	-74.4	91.9	170.9	-62.8	0	0	0	0	108.9	P71 S75	P71-C73 VanDerWaalsContact C-N 3.33Å; P71-C73 PolarHBondContact O-N 2.93Å; C73-S75 PolarHBondContact O-N 3.18Å; C73-S75 VanDerWaalsContact O-N 3.12Å
74	S	34	Very low	33	Very low	94 Å²	94	150.3 Å²	150.3	66%	0.657	77%	0.772	S	S	*	*			trans	-70.6	105.6	166.1	57.9	0	0	0	0	108.5	Q72 V76	Q72-S74 PolarHBondContact O-N 3.01Å; Q72-S74 VanDerWaalsContact O-N 3.09Å; S74-V76 VanDerWaalsContact C-N 3.32Å; S74-V76 PolarHBondContact O-N 2.9Å
75	S	32	Very low	32.7	Very low	111 Å²	111	149.2 Å²	149.2	78%	0.776	77%	0.768	S	S	*	*			trans	-59.4	88.6	171	168.3	0	0	0	0	110	C73 R77	C73-S75 PolarHBondContact O-N 3.18Å; C73-S75 VanDerWaalsContact O-N 3.12Å; S75-R77 PolarHBondContact O-N 3.17Å
76	V	33.3	Very low	32.4	Very low	122 Å²	122	142.8 Å²	142.8	74%	0.739	75%	0.754	S	S	*	*			trans	-78.3	101.1	168.3	179.5	0	0	0	0	106.9	S74 S78	S74-V76 VanDerWaalsContact C-N 3.32Å; S74-V76 PolarHBondContact O-N 2.9Å; V76-S78 PolarHBondContact O-N 2.63Å
77	R	29.7	Very low	32.3	Very low	240 Å²	240	143.1 Å²	143.1	91%	0.906	74%	0.743	S	S	*	*			trans	-72	63.6	179.9	-149.1	-177.7	-161.7	-171.2	5.9	110.5	S75 K79	S75-R77 PolarHBondContact O-N 3.17Å; R77-K79 PolarHBondContact O-N 2.74Å
78	S	34.2	Very low	32.4	Very low	92 Å²	92	147 Å²	147	64%	0.643	74%	0.742	S	S	*	*			trans	-87.9	107.7	175.4	-170.4	0	0	0	0	110	V76 R80	V76-S78 PolarHBondContact O-N 2.63Å; S78-R80 PolarHBondContact O-N 3.4Å
79	K	33.4	Very low	32.7	Very low	195 Å²	195	144.4 Å²	144.4	85%	0.848	73%	0.731	S	S	*	*			trans	-61.8	118.9	171.3	-74.8	174	175.6	175.7	0	108.5	R77	R77-K79 PolarHBondContact O-N 2.74Å
80	R	32.7	Very low	32.2	Very low	244 Å²	244	143.4 Å²	143.4	92%	0.921	72%	0.717	S	S	*	*	S	Bend	trans	57.9	80.3	161.5	-63	179.9	173.2	-176.9	-3.4	115.5	S78	S78-R80 PolarHBondContact O-N 3.4Å
81	S	33.3	Very low	32.3	Very low	95 Å²	95	140.1 Å²	140.1	66%	0.664	71%	0.709	S	S	*	*	S	Bend	trans	-176.6	120.5	139.7	-173.8	0	0	0	0	108.5
82	L	32.5	Very low	31.8	Very low	158 Å²	158	146.6 Å²	146.6	83%	0.827	72%	0.722	S	S	*	*			trans	29.9	93.5	155.5	-63.8	161.9	0	0	0	115.8	S84	L82-S84 PolarHBondContact O-N 2.98Å
83	Y	33.1	Very low	32	Very low	208 Å²	208	145.4 Å²	145.4	82%	0.816	71%	0.71	S	S	*	*			trans	-46.8	90.8	175.6	-71.4	-90.6	0	0	0	113.6	W85	Y83-W85 AromaticContact CD1-NE1 3.86Å
84	S	28.7	Very low	32.1	Very low	99 Å²	99	148.1 Å²	148.1	69%	0.692	72%	0.717	S	S	*	*			trans	-86	105.7	157.6	72.4	0	0	0	0	107.9	L82 S86	L82-S84 PolarHBondContact O-N 2.98Å; S84-S86 PolarHBondContact O-N 2.91Å; S84-S86 VanDerWaalsContact O-N 3.11Å
85	W	29.1	Very low	32	Very low	211 Å²	211	147 Å²	147	80%	0.799	72%	0.72	S	S	*	*			trans	-77.2	96.4	174.2	-68.7	61.4	0	0	0	107.9	Y83 F87	Y83-W85 AromaticContact CD1-NE1 3.86Å; W85-F87 PolarHBondContact O-N 3.06Å; W85-F87 VanDerWaalsContact O-N 3.13Å
86	S	29.2	Very low	31.8	Very low	76 Å²	76	147.4 Å²	147.4	53%	0.531	71%	0.713	S	S	.	*			trans	-76.1	96.8	169.5	-55.7	0	0	0	0	108.1	S84 W88	S84-S86 PolarHBondContact O-N 2.91Å; S84-S86 VanDerWaalsContact O-N 3.11Å; S86-W88 VanDerWaalsContact O-CD1 3.26Å; S86-W88 PolarHBondContact O-N 3.09Å; S86-W88 VanDerWaalsContact O-N 3.17Å
87	F	30.4	Very low	31.7	Very low	153 Å²	153	145.9 Å²	145.9	67%	0.671	71%	0.707	S	S	*	*			trans	-79.7	94.5	176.3	-158.5	-92.3	0	0	0	108.8	W85 A89	W85-F87 PolarHBondContact O-N 3.06Å; W85-F87 VanDerWaalsContact O-N 3.13Å; F87-A89 HydrophobicContact CD1-CB 4.45Å; F87-A89 PolarHBondContact O-N 3.17Å
88	W	30.6	Very low	31.8	Very low	134 Å²	134	140.1 Å²	140.1	51%	0.508	69%	0.689	S	S	.	*			trans	-75.5	91.7	175.1	-63.6	91.3	0	0	0	109.1	S86 H90 E99	S86-W88 VanDerWaalsContact O-CD1 3.26Å; S86-W88 PolarHBondContact O-N 3.09Å; S86-W88 VanDerWaalsContact O-N 3.17Å; W88-H90 VanDerWaalsContact C-N 3.3Å; W88-H90 PolarHBondContact O-N 3.13Å; W88-E99 HydrophobicContact CZ3-CB 4.3Å; W88-E99 HydrophobicContact CZ3-CG 4.4Å
89	A	36.8	Very low	31.7	Very low	65 Å²	65	142.3 Å²	142.3	54%	0.537	69%	0.689	S	S	.	*			trans	-74.1	88.2	169.4	0	0	0	0	0	108.7	F87 K91	F87-A89 HydrophobicContact CD1-CB 4.45Å; F87-A89 PolarHBondContact O-N 3.17Å; A89-K91 VanDerWaalsContact C-N 3.35Å; A89-K91 PolarHBondContact O-N 2.87Å
90	H	29.7	Very low	32	Very low	113 Å²	113	138.3 Å²	138.3	52%	0.523	68%	0.677	S	S	.	*			trans	-63.6	95.9	171.4	-108.8	-77.7	0	0	0	109.4	W88 W92	W88-H90 VanDerWaalsContact C-N 3.3Å; W88-H90 PolarHBondContact O-N 3.13Å; H90-W92 PolarHBondContact O-N 2.72Å
91	K	33	Very low	31.9	Very low	151 Å²	151	130.6 Å²	130.6	66%	0.657	66%	0.661	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86	97.4	176.9	-150.4	173.2	-170.6	172.3	0	108.4	A89 R93	A89-K91 VanDerWaalsContact C-N 3.35Å; A89-K91 PolarHBondContact O-N 2.87Å; K91-R93 PolarHBondContact O-N 3.1Å; K91-R93 VanDerWaalsContact O-N 3.13Å
92	W	27.1	Very low	32.1	Very low	221 Å²	221	132.9 Å²	132.9	84%	0.837	67%	0.665	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-68	107.5	172.2	-67.2	85.9	0	0	0	109	H90	H90-W92 PolarHBondContact O-N 2.72Å
93	R	35.5	Very low	31.9	Very low	162 Å²	162	130.2 Å²	130.2	61%	0.611	66%	0.66	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.5	107.8	175.2	-164	179.3	-173.7	-150.5	-4.1	108.3	K91 G95 L96	K91-R93 PolarHBondContact O-N 3.1Å; K91-R93 VanDerWaalsContact O-N 3.13Å; R93-G95 PolarHBondContact O-N 2.82Å; R93-L96 PolarHBondContact O-N 3.11Å
94	N	36	Very low	31.9	Very low	167 Å²	167	126.2 Å²	126.2	89%	0.893	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	39.8	47.2	175	-64.7	0.8	0	0	0	114.6	L96	N94-L96 PolarHBondContact O-N 3.12Å
95	G	32.4	Very low	32	Very low	70 Å²	70	128 Å²	128	72%	0.722	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.5	5.5	175.4	0	0	0	0	0	116.9	R93	R93-G95 PolarHBondContact O-N 2.82Å
96	L	27.7	Very low	32.2	Very low	120 Å²	120	123.1 Å²	123.1	63%	0.628	65%	0.653	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.1	119	177.7	-66.4	170	0	0	0	110.5	R93 N94 F98	R93-L96 PolarHBondContact O-N 3.11Å; N94-L96 PolarHBondContact O-N 3.12Å; L96-F98 HydrophobicContact CB-CE2 4.22Å
97	S	31.2	Very low	32.4	Very low	89 Å²	89	125.9 Å²	125.9	62%	0.622	67%	0.667	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-76.6	122.2	176.8	57.1	0	0	0	0	110.3
98	F	32	Very low	32.5	Very low	120 Å²	120	121.9 Å²	121.9	53%	0.526	66%	0.662	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.4	117.3	168.7	-79.6	-93.5	0	0	0	108.6	L96 D100	L96-F98 HydrophobicContact CB-CE2 4.22Å; F98-D100 PolarHBondContact O-N 2.87Å; F98-D100 VanDerWaalsContact O-N 3.15Å
99	E	32.4	Very low	32.5	Very low	138 Å²	138	121.6 Å²	121.6	65%	0.645	68%	0.678	S	S	*	*			trans	-78.8	84.8	170.4	-68.1	-152.9	170.3	0	0	109.4	W88 S101	W88-E99 HydrophobicContact CZ3-CB 4.3Å; W88-E99 HydrophobicContact CZ3-CG 4.4Å; E99-S101 VanDerWaalsContact C-N 3.32Å; E99-S101 PolarHBondContact O-N 2.88Å; E99-S101 VanDerWaalsContact O-N 3.17Å
100	D	38.7	Very low	32.5	Very low	110 Å²	110	123.8 Å²	123.8	59%	0.588	68%	0.684	S	S	*	*			trans	-83.5	82.1	167.5	-73.3	-25.7	0	0	0	108.1	F98 L102	F98-D100 PolarHBondContact O-N 2.87Å; F98-D100 VanDerWaalsContact O-N 3.15Å; D100-L102 VanDerWaalsContact C-N 3.31Å; D100-L102 PolarHBondContact O-N 2.79Å
101	S	31.8	Very low	32.5	Very low	83 Å²	83	123.6 Å²	123.6	58%	0.58	70%	0.695	S	S	*	*			trans	-70.7	86.3	173	61.8	0	0	0	0	109.8	E99 S103	E99-S101 VanDerWaalsContact C-N 3.32Å; E99-S101 PolarHBondContact O-N 2.88Å; E99-S101 VanDerWaalsContact O-N 3.17Å; S101-S103 PolarHBondContact O-N 2.93Å
102	L	36.4	Very low	32.7	Very low	142 Å²	142	126.2 Å²	126.2	74%	0.743	70%	0.703	S	S	*	*			trans	-79.9	91	169.1	-68	172.1	0	0	0	108.6	D100 V104	D100-L102 VanDerWaalsContact C-N 3.31Å; D100-L102 PolarHBondContact O-N 2.79Å; L102-V104 VanDerWaalsContact C-N 3.27Å; L102-V104 PolarHBondContact O-N 2.8Å
103	S	28.8	Very low	32.9	Very low	103 Å²	103	118.4 Å²	118.4	72%	0.72	69%	0.691	S	S	*	*			trans	-71.9	87.5	163.9	48.1	0	0	0	0	108.5	S101 L105	S101-S103 PolarHBondContact O-N 2.93Å; S103-L105 VanDerWaalsContact C-N 3.26Å; S103-L105 PolarHBondContact O-N 3Å
104	V	33.2	Very low	33.1	Very low	124 Å²	124	113.2 Å²	113.2	75%	0.752	68%	0.679	S	S	*	*			trans	-69.3	92.8	165.6	-177.2	0	0	0	0	106.2	L102 P106	L102-V104 VanDerWaalsContact C-N 3.27Å; L102-V104 PolarHBondContact O-N 2.8Å; V104-P106 WeakPolarHBondContact O-CD 3.18Å
105	L	29.7	Very low	33.6	Very low	136 Å²	136	112.6 Å²	112.6	71%	0.712	67%	0.671	S	S	*	*			trans	-62.2	116.3	162.6	-117.6	97.9	0	0	0	105.9	S103 T107	S103-L105 VanDerWaalsContact C-N 3.26Å; S103-L105 PolarHBondContact O-N 3Å; L105-T107 PolarHBondContact O-N 2.84Å; L105-T107 PolarHBondContact O-OG1 2.83Å
106	P	32.9	Very low	34	Very low	109 Å²	109	116.1 Å²	116.1	71%	0.708	67%	0.669	S	S	*	*			trans	-69.9	89.3	172.7	27.5	-30.2	0	0	0	108	V104 A108	V104-P106 WeakPolarHBondContact O-CD 3.18Å; P106-A108 PolarHBondContact O-N 3.2Å; P106-A108 VanDerWaalsContact O-N 3.1Å
107	T	35.3	Very low	34.6	Very low	134 Å²	134	113.9 Å²	113.9	82%	0.822	66%	0.663	S	S	*	*	S	Bend	trans	-70.1	104.5	168.6	-17.9	0	0	0	0	106.6	L105	L105-T107 PolarHBondContact O-N 2.84Å; L105-T107 PolarHBondContact O-OG1 2.83Å
108	A	31.3	Very low	35.2	Very low	69 Å²	69	119.4 Å²	119.4	57%	0.57	67%	0.67	S	S	*	*	S	Bend	trans	81.3	130.2	-174.7	0	0	0	0	0	115.1	P106 V110	P106-A108 PolarHBondContact O-N 3.2Å; P106-A108 VanDerWaalsContact O-N 3.1Å; A108-V110 PolarHBondContact O-N 3.47Å
109	P	31.1	Very low	35.8	Very low	128 Å²	128	122.7 Å²	122.7	83%	0.831	68%	0.679	S	S	*	*			trans	-61.7	107.7	171.6	26.3	-31.6	0	0	0	107.7	S111	P109-S111 VanDerWaalsContact C-N 3.27Å; P109-S111 PolarHBondContact O-N 3.05Å
110	V	36.5	Very low	36.6	Very low	111 Å²	111	119 Å²	119	67%	0.673	67%	0.672	S	S	*	*			trans	-59.9	103	160.2	179.5	0	0	0	0	104.7	A108 Y112	A108-V110 PolarHBondContact O-N 3.47Å; V110-Y112 HydrophobicContact CB-CD2 4.48Å; V110-Y112 HydrophobicContact CB-CE2 4.33Å; V110-Y112 HydrophobicContact CG1-CD2 4.3Å; V110-Y112 HydrophobicContact CG1-CE2 4.24Å; V110-Y112 WeakPolarHBondContact O-CD2 3.41Å; V110-Y112 PolarHBondContact O-N 3.42Å
111	S	30.4	Very low	36.8	Very low	109 Å²	109	124.4 Å²	124.4	76%	0.762	68%	0.684	S	S	*	*			trans	-60.5	91.8	166.5	176.7	0	0	0	0	105.8	P109 G113	P109-S111 VanDerWaalsContact C-N 3.27Å; P109-S111 PolarHBondContact O-N 3.05Å; S111-G113 PolarHBondContact O-N 2.73Å
112	Y	37	Very low	37.6	Very low	206 Å²	206	125.4 Å²	125.4	81%	0.808	69%	0.687	S	S	*	*			trans	-60.5	101.4	161.5	-79.8	-91.3	0	0	0	104.1	V110 S114	V110-Y112 HydrophobicContact CB-CD2 4.48Å; V110-Y112 HydrophobicContact CB-CE2 4.33Å; V110-Y112 HydrophobicContact CG1-CD2 4.3Å; V110-Y112 HydrophobicContact CG1-CE2 4.24Å; V110-Y112 WeakPolarHBondContact O-CD2 3.41Å; V110-Y112 PolarHBondContact O-N 3.42Å; Y112-S114 PolarHBondContact O-N 3.37Å
113	G	31.6	Very low	38	Very low	57 Å²	57	127 Å²	127	59%	0.588	69%	0.688	S	S	*	*			trans	-52.4	103.6	163.3	0	0	0	0	0	105.5	S111 E115	S111-G113 PolarHBondContact O-N 2.73Å; G113-E115 PolarHBondContact O-N 2.88Å
114	S	39.2	Very low	38.8	Very low	53 Å²	53	129.5 Å²	129.5	37%	0.371	69%	0.693	S	S	.	*			trans	-43.5	137.7	177.5	173.5	0	0	0	0	107	Y112 E116 S117	Y112-S114 PolarHBondContact O-N 3.37Å; S114-E116 CarbonylContact O-C 3.53Å; S114-E116 PolarHBondContact O-N 2.91Å; S114-E116 WeakPolarHBondContact OG-CB 3.34Å; S114-E116 WeakPolarHBondContact OG-CG 3.41Å; S114-E116 PolarHBondContact OG-N 3.25Å; S114-E116 PolarHBondContact OG-OE2 3.26Å; S114-S117 WeakPolarHBondContact O-CB 3.44Å; S114-S117 PolarHBondContact O-N 2.77Å
115	E	46	Very low	39.4	Very low	153 Å²	153	126.8 Å²	126.8	72%	0.715	69%	0.69	S	S	*	*	H	α-helix	trans	-49.5	-21.8	172	-97	-176.1	137.3	0	0	111.9	G113 R118 R119	G113-E115 PolarHBondContact O-N 2.88Å; E115-R118 CarbonylContact O-C 3.59Å; E115-R118 WeakPolarHBondContact O-CA 3.36Å; E115-R118 WeakPolarHBondContact O-CB 3.35Å; E115-R118 PolarHBondContact O-N 3.33Å; E115-R119 PolarHBondContact O-N 3.1Å
116	E	40	Very low	40	Very low	145 Å²	145	129 Å²	129	68%	0.678	70%	0.697	S	S	*	*	H	α-helix	trans	-60	-38.7	169.4	-65.9	165.8	145.3	0	0	113.5	S114 R118 R119 A120	S114-E116 CarbonylContact O-C 3.53Å; S114-E116 PolarHBondContact O-N 2.91Å; S114-E116 WeakPolarHBondContact OG-CB 3.34Å; S114-E116 WeakPolarHBondContact OG-CG 3.41Å; S114-E116 PolarHBondContact OG-N 3.25Å; S114-E116 PolarHBondContact OG-OE2 3.26Å; E116-R118 VanDerWaalsContact C-N 3.26Å; E116-R118 PolarHBondContact O-N 3.25Å; E116-R119 PolarHBondContact O-N 3.38Å; E116-A120 WeakPolarHBondContact O-CB 3.45Å; E116-A120 PolarHBondContact O-N 3.48Å
117	S	41.5	Very low	40.4	Very low	72 Å²	72	135.8 Å²	135.8	50%	0.503	71%	0.708	S	S	.	*	H	α-helix	trans	-66	-30.1	171	-82	0	0	0	0	112.3	S114 R121	S114-S117 WeakPolarHBondContact O-CB 3.44Å; S114-S117 PolarHBondContact O-N 2.77Å; S117-R121 PolarHBondContact O-N 2.8Å
118	R	42.5	Very low	40.6	Very low	206 Å²	206	132.8 Å²	132.8	78%	0.777	70%	0.704	S	S	*	*	H	α-helix	trans	-72.6	-34.6	174.4	-133.8	-179.9	-168.7	167.5	2.9	111.4	E115 E116	E115-R118 CarbonylContact O-C 3.59Å; E115-R118 WeakPolarHBondContact O-CA 3.36Å; E115-R118 WeakPolarHBondContact O-CB 3.35Å; E115-R118 PolarHBondContact O-N 3.33Å; E116-R118 VanDerWaalsContact C-N 3.26Å; E116-R118 PolarHBondContact O-N 3.25Å
119	R	46	Very low	41.1	Very low	189 Å²	189	142.5 Å²	142.5	71%	0.713	74%	0.738	S	S	*	*	H	α-helix	trans	-76.2	-34.6	173.3	-73.7	-173.8	-177.8	177.8	2.1	113.3	E115 E116 R121 V122	E115-R119 PolarHBondContact O-N 3.1Å; E116-R119 PolarHBondContact O-N 3.38Å; R119-R121 VanDerWaalsContact C-N 3.31Å; R119-R121 PolarHBondContact O-N 3.24Å; R119-V122 PolarHBondContact O-N 2.93Å; R119-V122 VanDerWaalsContact O-N 3.1Å
120	A	48.1	Very low	41.6	Very low	60 Å²	60	143.3 Å²	143.3	50%	0.496	73%	0.733	S	S	.	*	H	α-helix	trans	-63.1	-36.9	179.9	0	0	0	0	0	112.2	E116 V122 F123	E116-A120 WeakPolarHBondContact O-CB 3.45Å; E116-A120 PolarHBondContact O-N 3.48Å; A120-V122 PolarHBondContact O-N 3.29Å; A120-F123 PolarHBondContact O-N 2.8Å
121	R	44	Very low	41.8	Very low	223 Å²	223	144.9 Å²	144.9	84%	0.842	74%	0.736	S	S	*	*	H	α-helix	trans	-72.6	-8.7	176.4	-66.3	-167.1	-164.6	-166.9	5	114.7	S117 R119	S117-R121 PolarHBondContact O-N 2.8Å; R119-R121 VanDerWaalsContact C-N 3.31Å; R119-R121 PolarHBondContact O-N 3.24Å
122	V	48.4	Very low	42.5	Very low	105 Å²	105	146.9 Å²	146.9	64%	0.636	74%	0.735	S	S	*	*	H	α-helix	trans	-86.3	-20.4	176.6	-178.1	0	0	0	0	111.1	R119 A120	R119-V122 PolarHBondContact O-N 2.93Å; R119-V122 VanDerWaalsContact O-N 3.1Å; A120-V122 PolarHBondContact O-N 3.29Å
123	F	44.9	Very low	42.8	Very low	176 Å²	176	143.5 Å²	143.5	77%	0.772	73%	0.73	S	S	*	*	H	α-helix	trans	-84.6	-17.1	-175.9	-94	-82	0	0	0	115.6	A120	A120-F123 PolarHBondContact O-N 2.8Å
124	D	45.9	Very low	43.5	Very low	155 Å²	155	148.9 Å²	148.9	83%	0.829	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.8	-0.5	177.8	-75.2	-30	0	0	0	114
125	G	45.9	Very low	43.8	Very low	66 Å²	66	155.3 Å²	155.3	68%	0.68	76%	0.764	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	-6.4	-178	0	0	0	0	0	115.8
126	Q	42	Very low	43.6	Very low	184 Å²	184	155.4 Å²	155.4	86%	0.86	77%	0.767	S	S	*	*			trans	-130.8	71.9	-178	-73	-172.1	-2.6	0	0	111.4
127	R	41	Very low	43.9	Very low	250 Å²	250	156.2 Å²	156.2	94%	0.943	77%	0.774	S	S	*	*			trans	-126.4	68.5	152.9	-142.6	-179.8	-160.2	-163.4	4.1	108
128	G	38.8	Very low	44.1	Very low	71 Å²	71	163.3 Å²	163.3	73%	0.732	80%	0.797	S	S	*	*			trans	-93.8	114.1	160.5	0	0	0	0	0	107.5
129	E	41.7	Very low	44.3	Very low	274 Å²	274	159.4 Å²	159.4	100%	1.28	80%	0.799	S	S	*	*			trans	161.3	0	144.8	-87.7	-178.6	-174.7	0	0	109.6

Retrieved 129 of 129 residues in 57.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).