A0A077ZHC1_TRITR Loading...

Ribosomal L23 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZHC1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 76 aa.

						>A0A077ZHC1_TRITR|A0A077ZHC1
MDEKKYTFEVDTRANKTLVKQAVEAAFDVKVKNVNIMNAKPKAKRMGKYQGFTKKRRKAVVTLTEDSKEIQIFDAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.5	Low	86	Confident	155 Å²	155	84.5 Å²	84.5	76%	0.764	42%	0.421	S	S	*	.				0	84.4	0	-91.4	-169.8	179.9	0	0	104.3	Y6	M1-Y6 HydrophobicContact SD-CD1 4.4Å
2	D	64.4	Low	86.3	Confident	156 Å²	156	81.6 Å²	81.6	83%	0.834	41%	0.411	S	S	*	.			trans	-104.1	-7.4	-148.9	-47.1	-44.1	0	0	0	113.4
3	E	80.6	Confident	86.8	Confident	125 Å²	125	92.2 Å²	92.2	58%	0.584	44%	0.443	S	S	*	.	S	Bend	trans	-137.5	45.1	-172.5	-60.5	176.3	106.7	0	0	112.8	K5	E3-K5 HydrophobicContact CB-CD 4.28Å; E3-K5 HydrophobicContact CB-CG 4.39Å; E3-K5 PolarHBondContact O-N 2.53Å; E3-K5 WeakPolarHBondContact OE2-CE 3.01Å; E3-K5 IonicContact OE2-NZ 2.79Å; E3-K5 PolarHBondContact OE2-NZ 2.79Å
4	K	87.2	Confident	87.3	Confident	56 Å²	56	86.8 Å²	86.8	24%	0.243	42%	0.421	C	S	.	.	S	Bend	trans	48.8	38	-174.9	-61.5	-172.1	173.2	-171.3	0	113.1	Y6 L63 E65 S67	K4-Y6 HydrophobicContact CB-CE2 4.4Å; K4-Y6 WeakPolarHBondContact O-CD2 3.49Å; K4-L63 HydrophobicContact CB-CB 4.11Å; K4-L63 PolarHBondContact O-N 2.82Å; K4-E65 PolarHBondContact NZ-O 3.12Å; K4-S67 PolarHBondContact NZ-O 3.4Å
5	K	91.7	Very high	87.8	Confident	78 Å²	78	86 Å²	86	34%	0.339	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	118.1	178.9	-75.5	174.2	-175	167.5	0	109.7	E3 V60 V61 T62	E3-K5 HydrophobicContact CB-CD 4.28Å; E3-K5 HydrophobicContact CB-CG 4.39Å; E3-K5 PolarHBondContact O-N 2.53Å; E3-K5 WeakPolarHBondContact OE2-CE 3.01Å; E3-K5 IonicContact OE2-NZ 2.79Å; E3-K5 PolarHBondContact OE2-NZ 2.79Å; K5-V60 HydrophobicContact CB-CG1 4.37Å; K5-V61 CarbonylContact C-O 3.57Å; K5-V61 WeakPolarHBondContact CA-O 3.38Å; K5-T62 HydrophobicContact CG-CG2 4.01Å
6	Y	92.7	Very high	88.3	Confident	23 Å²	23	87.1 Å²	87.1	9%	0.09	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	144.8	-179.5	-61	-88.1	0	0	0	110	M1 K4 V60 V61 L63 I70 I72	M1-Y6 HydrophobicContact SD-CD1 4.4Å; K4-Y6 HydrophobicContact CB-CE2 4.4Å; K4-Y6 WeakPolarHBondContact O-CD2 3.49Å; Y6-V60 CarbonylContact O-C 3.49Å; Y6-V60 VanDerWaalsContact O-CA 3.32Å; Y6-V60 WeakPolarHBondContact O-CA 2.98Å; Y6-V61 PolarHBondContact N-O 2.86Å; Y6-V61 PolarHBondContact O-N 3.05Å; Y6-L63 HydrophobicContact CD2-CD1 3.9Å; Y6-L63 HydrophobicContact CD2-CG 3.99Å; Y6-L63 HydrophobicContact CE2-CD1 3.46Å; Y6-L63 VanDerWaalsContact CE2-CD1 3.46Å; Y6-L63 HydrophobicContact CE2-CG 3.95Å; Y6-I70 HydrophobicContact CD1-CB 4.21Å; Y6-I70 HydrophobicContact CD2-CD1 4.01Å; Y6-I70 HydrophobicContact CE1-CB 3.87Å; Y6-I70 WeakPolarHBondContact CE1-O 3.49Å; Y6-I70 HydrophobicContact CE2-CB 4.35Å; Y6-I70 HydrophobicContact CE2-CD1 4.31Å; Y6-I70 HydrophobicContact CE2-CG1 4.32Å; Y6-I70 HydrophobicContact CG-CD1 4.16Å; Y6-I70 PolarHBondContact OH-N 2.87Å; Y6-I70 VanDerWaalsContact OH-N 3.14Å; Y6-I72 HydrophobicContact CD1-CG1 4.17Å; Y6-I72 HydrophobicContact CE1-CG1 4.31Å
7	T	92.8	Very high	88.8	Confident	73 Å²	73	87.3 Å²	87.3	45%	0.448	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	123.8	178.9	-57.2	0	0	0	0	110.3	K58 A59 V60	T7-K58 HydrophobicContact CG2-CB 4.22Å; T7-K58 HydrophobicContact CG2-CD 4.47Å; T7-A59 CarbonylContact C-O 3.5Å; T7-A59 WeakPolarHBondContact CA-O 2.97Å; T7-V60 HydrophobicContact CG2-CG2 4.32Å
8	F	92.9	Very high	89.2	Confident	40 Å²	40	87.6 Å²	87.6	18%	0.175	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	143.3	178.1	-61.3	-82.2	0	0	0	111	V10 V23 F27 K58 A59 V61 I70	F8-V10 HydrophobicContact CB-CG1 4.2Å; F8-V23 HydrophobicContact CD2-CG2 4.45Å; F8-V23 HydrophobicContact CE2-CG2 4.4Å; F8-F27 AromaticContact CE1-CE2 3.95Å; F8-F27 HydrophobicContact CE1-CE2 3.95Å; F8-F27 HydrophobicContact CE1-CZ 4.11Å; F8-F27 HydrophobicContact CZ-CE2 4.1Å; F8-K58 CarbonylContact O-C 3.58Å; F8-K58 WeakPolarHBondContact O-CA 3.49Å; F8-A59 PolarHBondContact N-O 3.19Å; F8-A59 PolarHBondContact O-N 2.91Å; F8-V61 HydrophobicContact CD2-CB 4.37Å; F8-V61 HydrophobicContact CD2-CG2 3.88Å; F8-V61 HydrophobicContact CE2-CB 4.26Å; F8-V61 HydrophobicContact CE2-CG2 4.19Å; F8-I70 HydrophobicContact CE2-CD1 4.49Å; F8-I70 HydrophobicContact CZ-CD1 3.99Å
9	E	94.6	Very high	89.6	Confident	102 Å²	102	83.4 Å²	83.4	48%	0.477	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	125.7	161.5	-174.8	170.3	151.4	0	0	108.1	K54 R56 R57	E9-K54 IonicContact OE1-NZ 3.82Å; E9-K54 PolarHBondContact OE1-NZ 3.15Å; E9-R56 HydrophobicContact CG-CG 4.5Å; E9-R56 WeakPolarHBondContact OE2-CD 3.45Å; E9-R56 IonicContact OE2-NH1 2.63Å; E9-R57 WeakPolarHBondContact CA-O 3.4Å
10	V	95.8	Very high	89.9	Confident	28 Å²	28	83.4 Å²	83.4	17%	0.17	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	161.9	-177.1	-60.5	0	0	0	0	110.4	F8 A14 V19 R57 A59	F8-V10 HydrophobicContact CB-CG1 4.2Å; V10-A14 HydrophobicContact CB-CB 4.5Å; V10-V19 HydrophobicContact CB-CG2 4.27Å; V10-V19 HydrophobicContact CG1-CG1 4.28Å; V10-V19 HydrophobicContact CG1-CG2 4Å; V10-V19 HydrophobicContact CG2-CG2 4.34Å; V10-R57 HydrophobicContact CG2-CB 3.96Å; V10-R57 HydrophobicContact CG2-CG 3.73Å; V10-R57 PolarHBondContact N-O 3.35Å; V10-A59 HydrophobicContact CG1-CB 3.79Å; V10-A59 HydrophobicContact CG2-CB 4.13Å
11	D	94.4	Very high	90.2	Very high	94 Å²	94	84.6 Å²	84.6	50%	0.503	41%	0.414	S	S	.	.			trans	-58.8	142.2	175.3	-178.9	-98	0	0	0	111.1	R13 A14 R57	D11-R13 PolarHBondContact O-N 3.4Å; D11-R13 VanDerWaalsContact O-N 3.12Å; D11-R13 WeakPolarHBondContact OD1-CA 3.41Å; D11-R13 WeakPolarHBondContact OD1-CB 3.35Å; D11-R13 PolarHBondContact OD1-N 3.44Å; D11-A14 HydrophobicContact CB-CB 4.43Å; D11-A14 VanDerWaalsContact O-CB 3.28Å; D11-A14 WeakPolarHBondContact O-CB 3.26Å; D11-A14 PolarHBondContact O-N 2.74Å; D11-R57 WeakPolarHBondContact O-CD 3.34Å
12	T	90.6	Very high	92	Very high	49 Å²	49	80 Å²	80	30%	0.301	40%	0.401	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.9	-22.1	-174.9	59.7	0	0	0	0	114.3	K55 R57	T12-K55 HydrophobicContact CG2-CD 4.25Å; T12-K55 HydrophobicContact CG2-CG 4.24Å; T12-R57 WeakPolarHBondContact O-CD 3.28Å; T12-R57 PolarHBondContact O-NH1 3.3Å
13	R	92.4	Very high	93.4	Very high	220 Å²	220	73.1 Å²	73.1	83%	0.83	36%	0.364	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.8	-9.5	177.7	-54	-180	175.3	121.5	-5.7	113	D11 N15	D11-R13 PolarHBondContact O-N 3.4Å; D11-R13 VanDerWaalsContact O-N 3.12Å; D11-R13 WeakPolarHBondContact OD1-CA 3.41Å; D11-R13 WeakPolarHBondContact OD1-CB 3.35Å; D11-R13 PolarHBondContact OD1-N 3.44Å; R13-N15 PolarHBondContact O-N 2.84Å
14	A	93.7	Very high	94.1	Very high	16 Å²	16	70 Å²	70	13%	0.132	35%	0.35	C	S	.	.			trans	-66	132.4	-177	0	0	0	0	0	112.6	V10 D11 V19 R57	V10-A14 HydrophobicContact CB-CB 4.5Å; D11-A14 HydrophobicContact CB-CB 4.43Å; D11-A14 VanDerWaalsContact O-CB 3.28Å; D11-A14 WeakPolarHBondContact O-CB 3.26Å; D11-A14 PolarHBondContact O-N 2.74Å; A14-V19 HydrophobicContact CB-CG2 3.98Å; A14-R57 PolarHBondContact O-NE 3.47Å; A14-R57 PolarHBondContact O-NH2 3Å
15	N	94.1	Very high	94.5	Very high	75 Å²	75	71 Å²	71	40%	0.401	37%	0.369	S	S	.	.			trans	-92.8	171.2	173.2	69.4	41.7	0	0	0	111.2	R13 T17 L18 V19	R13-N15 PolarHBondContact O-N 2.84Å; N15-T17 VanDerWaalsContact C-N 3.33Å; N15-T17 PolarHBondContact O-N 3.44Å; N15-T17 PolarHBondContact OD1-N 3.04Å; N15-T17 VanDerWaalsContact OD1-N 3.1Å; N15-L18 PolarHBondContact O-N 2.89Å; N15-L18 WeakPolarHBondContact OD1-CG 3.45Å; N15-L18 PolarHBondContact OD1-N 3.19Å; N15-V19 WeakPolarHBondContact O-CG2 3.41Å; N15-V19 PolarHBondContact O-N 2.73Å
16	K	96.5	Very high	94.5	Very high	104 Å²	104	70.6 Å²	70.6	45%	0.452	38%	0.38	S	S	.	.	H	α-helix	trans	-62.4	-38.2	-177.2	-70.6	-172.6	171.8	-156.5	0	113	V19 K20 V34 I36	K16-V19 PolarHBondContact O-N 2.99Å; K16-K20 WeakPolarHBondContact O-CB 2.93Å; K16-K20 PolarHBondContact O-N 2.88Å; K16-V34 VanDerWaalsContact CD-O 3.31Å; K16-V34 WeakPolarHBondContact CD-O 3.33Å; K16-V34 WeakPolarHBondContact CE-O 3.28Å; K16-V34 PolarHBondContact NZ-O 3.45Å; K16-I36 HydrophobicContact CB-CD1 4.28Å; K16-I36 HydrophobicContact CG-CD1 3.61Å; K16-I36 HydrophobicContact CG-CG1 3.96Å
17	T	96.5	Very high	94.4	Very high	90 Å²	90	73.5 Å²	73.5	55%	0.552	39%	0.393	S	S	*	.	H	α-helix	trans	-65.9	-45.6	-178.4	-47.8	0	0	0	0	111.6	N15 K20 Q21	N15-T17 VanDerWaalsContact C-N 3.33Å; N15-T17 PolarHBondContact O-N 3.44Å; N15-T17 PolarHBondContact OD1-N 3.04Å; N15-T17 VanDerWaalsContact OD1-N 3.1Å; T17-K20 WeakPolarHBondContact O-CB 3.3Å; T17-K20 PolarHBondContact O-N 2.63Å; T17-Q21 WeakPolarHBondContact O-CG 3.33Å; T17-Q21 PolarHBondContact O-N 3.06Å
18	L	96.3	Very high	94.4	Very high	92 Å²	92	76.1 Å²	76.1	48%	0.482	40%	0.404	S	S	.	.	H	α-helix	trans	-63	-43.5	177.4	-69.4	174.4	0	0	0	111.5	N15 K20 Q21 A22	N15-L18 PolarHBondContact O-N 2.89Å; N15-L18 WeakPolarHBondContact OD1-CG 3.45Å; N15-L18 PolarHBondContact OD1-N 3.19Å; L18-K20 VanDerWaalsContact C-N 3.33Å; L18-K20 PolarHBondContact O-N 3.12Å; L18-Q21 PolarHBondContact O-N 3.25Å; L18-A22 VanDerWaalsContact O-CB 3.23Å; L18-A22 WeakPolarHBondContact O-CB 3.5Å; L18-A22 PolarHBondContact O-N 3.47Å
19	V	96.5	Very high	94.4	Very high	9 Å²	9	74.6 Å²	74.6	6%	0.055	40%	0.398	C	S	.	.	H	α-helix	trans	-63.6	-41.8	176.8	175.1	0	0	0	0	110.9	V10 A14 N15 K16 A22 V23 V34 I36 A59 V61	V10-V19 HydrophobicContact CB-CG2 4.27Å; V10-V19 HydrophobicContact CG1-CG1 4.28Å; V10-V19 HydrophobicContact CG1-CG2 4Å; V10-V19 HydrophobicContact CG2-CG2 4.34Å; A14-V19 HydrophobicContact CB-CG2 3.98Å; N15-V19 WeakPolarHBondContact O-CG2 3.41Å; N15-V19 PolarHBondContact O-N 2.73Å; K16-V19 PolarHBondContact O-N 2.99Å; V19-A22 PolarHBondContact O-N 3.1Å; V19-V23 HydrophobicContact CG1-CG2 4.28Å; V19-V23 WeakPolarHBondContact O-CB 3.47Å; V19-V23 VanDerWaalsContact O-CG2 3.26Å; V19-V23 WeakPolarHBondContact O-CG2 3.23Å; V19-V23 PolarHBondContact O-N 3.16Å; V19-V34 HydrophobicContact CB-CG1 4.31Å; V19-V34 HydrophobicContact CG1-CG1 3.93Å; V19-I36 HydrophobicContact CG2-CD1 4.22Å; V19-A59 HydrophobicContact CG1-CB 3.85Å; V19-V61 HydrophobicContact CG1-CG2 4.26Å
20	K	96.3	Very high	94.4	Very high	82 Å²	82	75.5 Å²	75.5	36%	0.357	40%	0.401	S	S	.	.	H	α-helix	trans	-57.3	-56.5	175.9	-177.8	177.7	176.4	174.4	0	110.6	K16 T17 L18 A22 V23 E24 V31 V34	K16-K20 WeakPolarHBondContact O-CB 2.93Å; K16-K20 PolarHBondContact O-N 2.88Å; T17-K20 WeakPolarHBondContact O-CB 3.3Å; T17-K20 PolarHBondContact O-N 2.63Å; L18-K20 VanDerWaalsContact C-N 3.33Å; L18-K20 PolarHBondContact O-N 3.12Å; K20-A22 VanDerWaalsContact C-N 3.33Å; K20-A22 PolarHBondContact O-N 3.41Å; K20-V23 PolarHBondContact O-N 3.03Å; K20-E24 WeakPolarHBondContact CE-OE1 3.31Å; K20-E24 HydrophobicContact CG-CG 4.38Å; K20-E24 IonicContact NZ-OE1 3.4Å; K20-E24 VanDerWaalsContact O-CG 3.3Å; K20-E24 WeakPolarHBondContact O-CG 3.46Å; K20-E24 PolarHBondContact O-N 2.82Å; K20-V31 WeakPolarHBondContact CE-O 3.43Å; K20-V31 HydrophobicContact CG-CB 3.96Å; K20-V31 HydrophobicContact CG-CG1 4.05Å; K20-V31 PolarHBondContact NZ-O 3.37Å; K20-V34 HydrophobicContact CB-CG2 4.1Å
21	Q	96.7	Very high	94.4	Very high	110 Å²	110	74.4 Å²	74.4	51%	0.514	39%	0.394	S	S	.	.	H	α-helix	trans	-58.7	-43.5	-179.1	-70.8	170.8	-22.9	0	0	112.2	T17 L18 V23 E24 A25	T17-Q21 WeakPolarHBondContact O-CG 3.33Å; T17-Q21 PolarHBondContact O-N 3.06Å; L18-Q21 PolarHBondContact O-N 3.25Å; Q21-V23 PolarHBondContact O-N 2.85Å; Q21-E24 PolarHBondContact O-N 3.14Å; Q21-A25 VanDerWaalsContact O-CB 3.28Å; Q21-A25 WeakPolarHBondContact O-CB 3.38Å; Q21-A25 PolarHBondContact O-N 3.5Å
22	A	95.9	Very high	94.4	Very high	59 Å²	59	76.3 Å²	76.3	49%	0.488	40%	0.398	S	S	.	.	H	α-helix	trans	-64.5	-40.6	179.7	0	0	0	0	0	112.3	L18 V19 K20 A26	L18-A22 VanDerWaalsContact O-CB 3.23Å; L18-A22 WeakPolarHBondContact O-CB 3.5Å; L18-A22 PolarHBondContact O-N 3.47Å; V19-A22 PolarHBondContact O-N 3.1Å; K20-A22 VanDerWaalsContact C-N 3.33Å; K20-A22 PolarHBondContact O-N 3.41Å; A22-A26 WeakPolarHBondContact O-CB 3.46Å; A22-A26 PolarHBondContact O-N 3.27Å
23	V	94.1	Very high	94.6	Very high	10 Å²	10	77.8 Å²	77.8	6%	0.061	40%	0.404	C	S	.	.	H	α-helix	trans	-70.8	-41.6	178	172.8	0	0	0	0	111.2	F8 V19 K20 Q21 A25 A26 F27 V29 V31 V61	F8-V23 HydrophobicContact CD2-CG2 4.45Å; F8-V23 HydrophobicContact CE2-CG2 4.4Å; V19-V23 HydrophobicContact CG1-CG2 4.28Å; V19-V23 WeakPolarHBondContact O-CB 3.47Å; V19-V23 VanDerWaalsContact O-CG2 3.26Å; V19-V23 WeakPolarHBondContact O-CG2 3.23Å; V19-V23 PolarHBondContact O-N 3.16Å; K20-V23 PolarHBondContact O-N 3.03Å; Q21-V23 PolarHBondContact O-N 2.85Å; V23-A25 VanDerWaalsContact C-N 3.33Å; V23-A25 PolarHBondContact O-N 2.97Å; V23-A26 PolarHBondContact O-N 2.82Å; V23-F27 HydrophobicContact CG1-CD2 4.16Å; V23-F27 PolarHBondContact O-N 2.88Å; V23-F27 VanDerWaalsContact O-N 3.15Å; V23-V29 HydrophobicContact CG1-CG2 3.98Å; V23-V31 HydrophobicContact CB-CG2 4.3Å; V23-V31 HydrophobicContact CG1-CG2 3.91Å; V23-V61 HydrophobicContact CG1-CG1 4.23Å; V23-V61 HydrophobicContact CG2-CG2 4.32Å
24	E	95.1	Very high	94.8	Very high	60 Å²	60	67.7 Å²	67.7	28%	0.28	37%	0.366	S	S	.	.	H	α-helix	trans	-61.4	-42.9	176	-67.7	-178.6	152.8	0	0	111	K20 Q21 D28 V29 V31	K20-E24 WeakPolarHBondContact CE-OE1 3.31Å; K20-E24 HydrophobicContact CG-CG 4.38Å; K20-E24 IonicContact NZ-OE1 3.4Å; K20-E24 VanDerWaalsContact O-CG 3.3Å; K20-E24 WeakPolarHBondContact O-CG 3.46Å; K20-E24 PolarHBondContact O-N 2.82Å; Q21-E24 PolarHBondContact O-N 3.14Å; E24-D28 VanDerWaalsContact O-CA 3.23Å; E24-D28 WeakPolarHBondContact O-CA 3.47Å; E24-D28 PolarHBondContact O-N 3.47Å; E24-V29 WeakPolarHBondContact CA-O 3.42Å; E24-V29 WeakPolarHBondContact CG-O 3.43Å; E24-V31 HydrophobicContact CG-CB 4.09Å; E24-V31 HydrophobicContact CG-CG2 3.69Å; E24-V31 PolarHBondContact OE1-N 2.86Å; E24-V31 VanDerWaalsContact OE1-N 3.12Å
25	A	94.5	Very high	94.9	Very high	77 Å²	77	70.7 Å²	70.7	64%	0.636	38%	0.38	S	S	*	.	H	α-helix	trans	-74.8	-34.2	179.7	0	0	0	0	0	114.2	Q21 V23	Q21-A25 VanDerWaalsContact O-CB 3.28Å; Q21-A25 WeakPolarHBondContact O-CB 3.38Å; Q21-A25 PolarHBondContact O-N 3.5Å; V23-A25 VanDerWaalsContact C-N 3.33Å; V23-A25 PolarHBondContact O-N 2.97Å
26	A	92.3	Very high	95	Very high	69 Å²	69	68.9 Å²	68.9	57%	0.57	37%	0.37	S	S	*	.	H	α-helix	trans	-79.7	-28.7	-176.8	0	0	0	0	0	113.2	A22 V23	A22-A26 WeakPolarHBondContact O-CB 3.46Å; A22-A26 PolarHBondContact O-N 3.27Å; V23-A26 PolarHBondContact O-N 2.82Å
27	F	91.5	Very high	94.9	Very high	85 Å²	85	68.9 Å²	68.9	37%	0.373	37%	0.373	S	S	.	.	H	α-helix	trans	-121.1	-0.3	-173.7	-62.7	-76.4	0	0	0	113.9	F8 V23 V29 I70	F8-F27 AromaticContact CE1-CE2 3.95Å; F8-F27 HydrophobicContact CE1-CE2 3.95Å; F8-F27 HydrophobicContact CE1-CZ 4.11Å; F8-F27 HydrophobicContact CZ-CE2 4.1Å; V23-F27 HydrophobicContact CG1-CD2 4.16Å; V23-F27 PolarHBondContact O-N 2.88Å; V23-F27 VanDerWaalsContact O-N 3.15Å; F27-V29 HydrophobicContact CB-CG1 4.07Å; F27-V29 HydrophobicContact CB-CG2 4.08Å; F27-V29 WeakPolarHBondContact O-CG1 3.12Å; F27-V29 PolarHBondContact O-N 2.94Å; F27-I70 HydrophobicContact CB-CD1 4.44Å; F27-I70 HydrophobicContact CB-CG1 4.34Å; F27-I70 HydrophobicContact CD1-CG2 3.7Å; F27-I70 HydrophobicContact CD2-CD1 4.33Å; F27-I70 HydrophobicContact CE1-CG2 3.75Å; F27-I70 HydrophobicContact CG-CD1 4.27Å; F27-I70 HydrophobicContact CG-CG1 4.38Å; F27-I70 HydrophobicContact CG-CG2 4.25Å; F27-I70 HydrophobicContact CZ-CG2 4.34Å
28	D	91.8	Very high	94.7	Very high	127 Å²	127	69.1 Å²	69.1	68%	0.679	37%	0.371	S	S	*	.			trans	51.8	41.6	-177.2	-62.7	-54.7	0	0	0	113.2	E24	E24-D28 VanDerWaalsContact O-CA 3.23Å; E24-D28 WeakPolarHBondContact O-CA 3.47Å; E24-D28 PolarHBondContact O-N 3.47Å
29	V	93.9	Very high	94.6	Very high	9 Å²	9	66.1 Å²	66.1	6%	0.055	36%	0.359	C	S	.	.			trans	-110.9	161.9	179.2	-63.8	0	0	0	0	110.8	V23 E24 F27 V31 L63 K68 I70	V23-V29 HydrophobicContact CG1-CG2 3.98Å; E24-V29 WeakPolarHBondContact CA-O 3.42Å; E24-V29 WeakPolarHBondContact CG-O 3.43Å; F27-V29 HydrophobicContact CB-CG1 4.07Å; F27-V29 HydrophobicContact CB-CG2 4.08Å; F27-V29 WeakPolarHBondContact O-CG1 3.12Å; F27-V29 PolarHBondContact O-N 2.94Å; V29-V31 HydrophobicContact CG2-CG2 4.39Å; V29-L63 HydrophobicContact CB-CD1 4.3Å; V29-L63 HydrophobicContact CB-CD2 4.12Å; V29-L63 HydrophobicContact CG1-CD1 4.2Å; V29-L63 HydrophobicContact CG2-CD2 3.7Å; V29-K68 HydrophobicContact CG1-CB 4.42Å; V29-K68 WeakPolarHBondContact CG1-O 3.46Å; V29-I70 HydrophobicContact CG1-CG1 4.05Å; V29-I70 HydrophobicContact CG2-CD1 4.46Å
30	K	94.5	Very high	94.4	Very high	120 Å²	120	74.6 Å²	74.6	52%	0.522	40%	0.395	S	S	.	.			trans	-102	126.8	169.3	-53.9	176.9	-173	164	0	110.4	T64 D66 S67	K30-T64 HydrophobicContact CB-CG2 4.15Å; K30-T64 PolarHBondContact O-N 2.91Å; K30-T64 PolarHBondContact O-OG1 2.8Å; K30-D66 IonicContact NZ-OD2 3.99Å; K30-D66 PolarHBondContact NZ-OD2 2.89Å; K30-S67 WeakPolarHBondContact CA-OG 3.45Å; K30-S67 VanDerWaalsContact CB-OG 3.26Å; K30-S67 WeakPolarHBondContact CB-OG 3.31Å; K30-S67 PolarHBondContact N-OG 2.91Å; K30-S67 PolarHBondContact O-OG 3.48Å
31	V	94.7	Very high	94.3	Very high	5 Å²	5	72.5 Å²	72.5	3%	0.03	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	121.6	-176.4	172.4	0	0	0	0	110.6	K20 V23 E24 V29 V34 V61 L63	K20-V31 WeakPolarHBondContact CE-O 3.43Å; K20-V31 HydrophobicContact CG-CB 3.96Å; K20-V31 HydrophobicContact CG-CG1 4.05Å; K20-V31 PolarHBondContact NZ-O 3.37Å; V23-V31 HydrophobicContact CB-CG2 4.3Å; V23-V31 HydrophobicContact CG1-CG2 3.91Å; E24-V31 HydrophobicContact CG-CB 4.09Å; E24-V31 HydrophobicContact CG-CG2 3.69Å; E24-V31 PolarHBondContact OE1-N 2.86Å; E24-V31 VanDerWaalsContact OE1-N 3.12Å; V29-V31 HydrophobicContact CG2-CG2 4.39Å; V31-V34 HydrophobicContact CG1-CG2 3.61Å; V31-V61 HydrophobicContact CB-CG1 4.29Å; V31-V61 HydrophobicContact CG1-CG1 3.6Å; V31-V61 HydrophobicContact CG2-CG1 3.73Å; V31-L63 HydrophobicContact CG2-CD2 3.96Å
32	K	94.5	Very high	94.2	Very high	134 Å²	134	74.5 Å²	74.5	58%	0.583	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.9	-52	175.4	-175	174.7	-177	171.6	0	111.2	T62 T64	K32-T62 WeakPolarHBondContact CA-O 3.26Å; K32-T62 HydrophobicContact CB-CG2 4.5Å; K32-T62 WeakPolarHBondContact CB-O 3.46Å; K32-T62 HydrophobicContact CD-CG2 4.46Å; K32-T62 PolarHBondContact N-O 3.47Å; K32-T64 HydrophobicContact CB-CG2 3.88Å
33	N	94.4	Very high	94.2	Very high	81 Å²	81	75.2 Å²	75.2	43%	0.433	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.5	153.4	-177.4	-166.8	10.1	0	0	0	112	T62	N33-T62 PolarHBondContact N-O 2.9Å; N33-T62 VanDerWaalsContact N-O 3.16Å; N33-T62 PolarHBondContact O-N 2.85Å
34	V	96.3	Very high	94.3	Very high	7 Å²	7	80.6 Å²	80.6	4%	0.042	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	120.8	175.7	-175.6	0	0	0	0	109.9	K16 V19 K20 V31 I36 A59 V61	K16-V34 VanDerWaalsContact CD-O 3.31Å; K16-V34 WeakPolarHBondContact CD-O 3.33Å; K16-V34 WeakPolarHBondContact CE-O 3.28Å; K16-V34 PolarHBondContact NZ-O 3.45Å; V19-V34 HydrophobicContact CB-CG1 4.31Å; V19-V34 HydrophobicContact CG1-CG1 3.93Å; K20-V34 HydrophobicContact CB-CG2 4.1Å; V31-V34 HydrophobicContact CG1-CG2 3.61Å; V34-I36 HydrophobicContact CG1-CD1 4.44Å; V34-I36 HydrophobicContact CG1-CG1 3.99Å; V34-A59 HydrophobicContact CG1-CB 4.35Å; V34-V61 HydrophobicContact CG1-CG2 4.25Å; V34-V61 HydrophobicContact CG2-CG1 4.39Å; V34-V61 HydrophobicContact CG2-CG2 4.3Å
35	N	95.9	Very high	94.4	Very high	79 Å²	79	86.3 Å²	86.3	42%	0.422	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	125.7	173.2	-71.3	-8.8	0	0	0	109.3	A59 V60	N35-A59 CarbonylContact O-C 3.55Å; N35-A59 WeakPolarHBondContact O-CA 3.32Å; N35-V60 HydrophobicContact CB-CB 4.32Å; N35-V60 PolarHBondContact N-O 3.24Å; N35-V60 PolarHBondContact O-N 3.49Å
36	I	96	Very high	94.3	Very high	37 Å²	37	89.4 Å²	89.4	19%	0.19	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	134.2	-177.8	-65.4	-176.7	0	0	0	109.2	K16 V19 V34 R57 K58 A59	K16-I36 HydrophobicContact CB-CD1 4.28Å; K16-I36 HydrophobicContact CG-CD1 3.61Å; K16-I36 HydrophobicContact CG-CG1 3.96Å; V19-I36 HydrophobicContact CG2-CD1 4.22Å; V34-I36 HydrophobicContact CG1-CD1 4.44Å; V34-I36 HydrophobicContact CG1-CG1 3.99Å; I36-R57 HydrophobicContact CG2-CG 3.67Å; I36-K58 WeakPolarHBondContact CA-O 3.33Å; I36-A59 HydrophobicContact CG1-CB 4.23Å
37	M	94.7	Very high	94.3	Very high	105 Å²	105	89.3 Å²	89.3	52%	0.517	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	140.1	175.4	63.8	-173.4	-57.3	0	0	111	K58	M37-K58 HydrophobicContact CG-CB 3.71Å; M37-K58 PolarHBondContact N-O 2.94Å; M37-K58 PolarHBondContact O-N 3.49Å; M37-K58 HydrophobicContact SD-CB 4.31Å; M37-K58 HydrophobicContact SD-CD 4.37Å
38	N	93.6	Very high	94.4	Very high	95 Å²	95	93.5 Å²	93.5	51%	0.508	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	122.8	174.7	-69.3	-43.1	0	0	0	109.5	R57	N38-R57 WeakPolarHBondContact OD1-CG 3.34Å
39	A	92.8	Very high	94.5	Very high	28 Å²	28	95 Å²	95	23%	0.231	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	116	173.4	0	0	0	0	0	109.6	R56	A39-R56 HydrophobicContact CB-CB 4.22Å; A39-R56 PolarHBondContact N-O 2.91Å; A39-R56 PolarHBondContact O-N 2.99Å
40	K	92.9	Very high	94.6	Very high	187 Å²	187	102.3 Å²	102.3	81%	0.813	50%	0.503	S	S	*	.	P	Polyproline II helix	trans	-63.7	136	178.4	-169.4	179.1	178.4	176.1	0	110.1
41	P	94.5	Very high	94.6	Very high	39 Å²	39	98.3 Å²	98.3	25%	0.253	50%	0.496	S	S	.	.	P	Polyproline II helix	trans	-63	138.9	171.6	29.3	-37.4	0	0	0	110.6	F52 T53	P41-F52 HydrophobicContact CB-CB 4.12Å; P41-F52 HydrophobicContact CB-CD1 4.43Å; P41-T53 WeakPolarHBondContact CB-O 3.13Å
42	K	95.3	Very high	94.5	Very high	151 Å²	151	105.5 Å²	105.5	66%	0.657	53%	0.527	S	S	*	.	P	Polyproline II helix	trans	-97.5	135.4	177.7	-66.2	-174.1	178.1	-175.2	0	109.4	K44 F52 T53	K42-K44 PolarHBondContact O-N 3.44Å; K42-F52 CarbonylContact O-C 3.55Å; K42-F52 WeakPolarHBondContact O-CA 3.44Å; K42-T53 HydrophobicContact CB-CG2 4.36Å; K42-T53 PolarHBondContact N-OG1 2.92Å; K42-T53 PolarHBondContact O-N 3.48Å
43	A	95.4	Very high	94.5	Very high	74 Å²	74	101.8 Å²	101.8	61%	0.612	52%	0.516	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-62.5	135	170.9	0	0	0	0	0	109.4	G51 F52	A43-G51 CarbonylContact C-O 3.59Å; A43-G51 WeakPolarHBondContact CA-O 3.36Å; A43-F52 HydrophobicContact CB-CD1 4.15Å; A43-F52 HydrophobicContact CB-CE1 3.84Å; A43-F52 HydrophobicContact CB-CZ 4.49Å
44	K	96.2	Very high	94.3	Very high	124 Å²	124	105.3 Å²	105.3	54%	0.539	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.4	149.4	179.4	-70.2	-65.2	-174.1	174.1	0	108.9	K42 G51 T53	K42-K44 PolarHBondContact O-N 3.44Å; K44-G51 PolarHBondContact N-O 3.5Å; K44-G51 PolarHBondContact O-N 2.98Å; K44-T53 HydrophobicContact CG-CG2 3.65Å
45	R	96	Very high	94.2	Very high	179 Å²	179	110.2 Å²	110.2	68%	0.675	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.4	130.1	176.1	-178.7	177.9	68.7	-176	2.6	108.8	G47 Y49 Q50	R45-G47 WeakPolarHBondContact CD-O 3.22Å; R45-G47 VanDerWaalsContact CG-O 3.23Å; R45-G47 WeakPolarHBondContact CG-O 3.23Å; R45-Y49 CarbonylContact C-O 3.53Å; R45-Y49 VanDerWaalsContact CA-O 3.31Å; R45-Y49 WeakPolarHBondContact CA-O 3.37Å; R45-Y49 WeakPolarHBondContact CG-O 3.34Å; R45-Q50 HydrophobicContact CB-CG 4.39Å; R45-Q50 HydrophobicContact CG-CG 4.04Å
46	M	92.8	Very high	94.1	Very high	142 Å²	142	111.8 Å²	111.8	70%	0.7	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.4	95.1	174.1	-58	-51.4	-66.7	0	0	108	K48 Y49	M46-K48 PolarHBondContact O-N 2.82Å; M46-Y49 PolarHBondContact N-O 2.74Å; M46-Y49 PolarHBondContact O-N 2.76Å
47	G	92.5	Very high	94.1	Very high	68 Å²	68	112.3 Å²	112.3	70%	0.701	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.8	-122	-172.7	0	0	0	0	0	111.8	R45 Y49	R45-G47 WeakPolarHBondContact CD-O 3.22Å; R45-G47 VanDerWaalsContact CG-O 3.23Å; R45-G47 WeakPolarHBondContact CG-O 3.23Å; G47-Y49 VanDerWaalsContact C-N 3.31Å
48	K	94	Very high	94.1	Very high	173 Å²	173	111 Å²	111	75%	0.752	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73	-19.1	177	69.7	-179.2	-176.8	-179.7	0	114.1	M46	M46-K48 PolarHBondContact O-N 2.82Å
49	Y	94.7	Very high	94.3	Very high	157 Å²	157	106.5 Å²	106.5	62%	0.616	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.6	128.4	-175.7	-57.4	-67.8	0	0	0	111	R45 M46 G47	R45-Y49 CarbonylContact C-O 3.53Å; R45-Y49 VanDerWaalsContact CA-O 3.31Å; R45-Y49 WeakPolarHBondContact CA-O 3.37Å; R45-Y49 WeakPolarHBondContact CG-O 3.34Å; M46-Y49 PolarHBondContact N-O 2.74Å; M46-Y49 PolarHBondContact O-N 2.76Å; G47-Y49 VanDerWaalsContact C-N 3.31Å
50	Q	94.2	Very high	94.4	Very high	164 Å²	164	106.8 Å²	106.8	77%	0.766	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.4	139.5	170	-60.7	-177.2	19.1	0	0	108.9	R45	R45-Q50 HydrophobicContact CB-CG 4.39Å; R45-Q50 HydrophobicContact CG-CG 4.04Å
51	G	94.4	Very high	94.4	Very high	36 Å²	36	98 Å²	98	37%	0.371	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.5	-167.9	-179.7	0	0	0	0	0	111.7	A43 K44	A43-G51 CarbonylContact C-O 3.59Å; A43-G51 WeakPolarHBondContact CA-O 3.36Å; K44-G51 PolarHBondContact N-O 3.5Å; K44-G51 PolarHBondContact O-N 2.98Å
52	F	94.2	Very high	94.4	Very high	156 Å²	156	97 Å²	97	68%	0.684	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.9	149	-179.5	-71.5	-85.8	0	0	0	110.2	P41 K42 A43	P41-F52 HydrophobicContact CB-CB 4.12Å; P41-F52 HydrophobicContact CB-CD1 4.43Å; K42-F52 CarbonylContact O-C 3.55Å; K42-F52 WeakPolarHBondContact O-CA 3.44Å; A43-F52 HydrophobicContact CB-CD1 4.15Å; A43-F52 HydrophobicContact CB-CE1 3.84Å; A43-F52 HydrophobicContact CB-CZ 4.49Å
53	T	93	Very high	94.4	Very high	56 Å²	56	90.1 Å²	90.1	34%	0.344	44%	0.439	S	S	.	.	P	Polyproline II helix	trans	-64.2	156.7	164.8	63.8	0	0	0	0	110.1	P41 K42 K44 K55	P41-T53 WeakPolarHBondContact CB-O 3.13Å; K42-T53 HydrophobicContact CB-CG2 4.36Å; K42-T53 PolarHBondContact N-OG1 2.92Å; K42-T53 PolarHBondContact O-N 3.48Å; K44-T53 HydrophobicContact CG-CG2 3.65Å; T53-K55 PolarHBondContact O-N 3.5Å
54	K	91.1	Very high	94.3	Very high	154 Å²	154	88 Å²	88	67%	0.67	42%	0.419	S	S	*	.	P	Polyproline II helix	trans	-54.3	136.2	173.6	-167.9	-174.9	174.6	-163	0	111.3	E9	E9-K54 IonicContact OE1-NZ 3.82Å; E9-K54 PolarHBondContact OE1-NZ 3.15Å
55	K	93.1	Very high	93.9	Very high	110 Å²	110	89.8 Å²	89.8	48%	0.478	43%	0.429	S	S	.	.	P	Polyproline II helix	trans	-67.5	131	167.2	-179.2	-179.7	179.7	-177.7	0	108.3	T12 T53	T12-K55 HydrophobicContact CG2-CD 4.25Å; T12-K55 HydrophobicContact CG2-CG 4.24Å; T53-K55 PolarHBondContact O-N 3.5Å
56	R	94.7	Very high	93.4	Very high	113 Å²	113	86.2 Å²	86.2	43%	0.426	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	148.5	178.9	-65.8	-173	-80.4	175.6	-5.3	110.1	E9 A39	E9-R56 HydrophobicContact CG-CG 4.5Å; E9-R56 WeakPolarHBondContact OE2-CD 3.45Å; E9-R56 IonicContact OE2-NH1 2.63Å; A39-R56 HydrophobicContact CB-CB 4.22Å; A39-R56 PolarHBondContact N-O 2.91Å; A39-R56 PolarHBondContact O-N 2.99Å
57	R	95.3	Very high	93.1	Very high	48 Å²	48	79.9 Å²	79.9	18%	0.181	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	123.9	167.7	-172.4	170.2	177.8	124	3.8	106.6	E9 V10 D11 T12 A14 I36 N38	E9-R57 WeakPolarHBondContact CA-O 3.4Å; V10-R57 HydrophobicContact CG2-CB 3.96Å; V10-R57 HydrophobicContact CG2-CG 3.73Å; V10-R57 PolarHBondContact N-O 3.35Å; D11-R57 WeakPolarHBondContact O-CD 3.34Å; T12-R57 WeakPolarHBondContact O-CD 3.28Å; T12-R57 PolarHBondContact O-NH1 3.3Å; A14-R57 PolarHBondContact O-NE 3.47Å; A14-R57 PolarHBondContact O-NH2 3Å; I36-R57 HydrophobicContact CG2-CG 3.67Å; N38-R57 WeakPolarHBondContact OD1-CG 3.34Å
58	K	95.7	Very high	92.7	Very high	77 Å²	77	83.9 Å²	83.9	34%	0.335	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	133.5	179.5	-60.9	-177.3	176.3	-170.6	0	108.3	T7 F8 I36 M37	T7-K58 HydrophobicContact CG2-CB 4.22Å; T7-K58 HydrophobicContact CG2-CD 4.47Å; F8-K58 CarbonylContact O-C 3.58Å; F8-K58 WeakPolarHBondContact O-CA 3.49Å; I36-K58 WeakPolarHBondContact CA-O 3.33Å; M37-K58 HydrophobicContact CG-CB 3.71Å; M37-K58 PolarHBondContact N-O 2.94Å; M37-K58 PolarHBondContact O-N 3.49Å; M37-K58 HydrophobicContact SD-CB 4.31Å; M37-K58 HydrophobicContact SD-CD 4.37Å
59	A	96.5	Very high	92.2	Very high	0 Å²	0	82.2 Å²	82.2	0%	0	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	116.6	170.6	0	0	0	0	0	108.8	T7 F8 V10 V19 V34 N35 I36 V61	T7-A59 CarbonylContact C-O 3.5Å; T7-A59 WeakPolarHBondContact CA-O 2.97Å; F8-A59 PolarHBondContact N-O 3.19Å; F8-A59 PolarHBondContact O-N 2.91Å; V10-A59 HydrophobicContact CG1-CB 3.79Å; V10-A59 HydrophobicContact CG2-CB 4.13Å; V19-A59 HydrophobicContact CG1-CB 3.85Å; V34-A59 HydrophobicContact CG1-CB 4.35Å; N35-A59 CarbonylContact O-C 3.55Å; N35-A59 WeakPolarHBondContact O-CA 3.32Å; I36-A59 HydrophobicContact CG1-CB 4.23Å; A59-V61 HydrophobicContact CB-CG2 4.47Å
60	V	95	Very high	91.8	Very high	35 Å²	35	75.2 Å²	75.2	21%	0.212	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	110.1	168.6	-176.1	0	0	0	0	107.4	K5 Y6 T7 N35	K5-V60 HydrophobicContact CB-CG1 4.37Å; Y6-V60 CarbonylContact O-C 3.49Å; Y6-V60 VanDerWaalsContact O-CA 3.32Å; Y6-V60 WeakPolarHBondContact O-CA 2.98Å; T7-V60 HydrophobicContact CG2-CG2 4.32Å; N35-V60 HydrophobicContact CB-CB 4.32Å; N35-V60 PolarHBondContact N-O 3.24Å; N35-V60 PolarHBondContact O-N 3.49Å
61	V	94.5	Very high	91.2	Very high	1 Å²	1	75.7 Å²	75.7	1%	0.006	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	124.3	-178	-178.1	0	0	0	0	108.2	K5 Y6 F8 V19 V23 V31 V34 A59 L63	K5-V61 CarbonylContact C-O 3.57Å; K5-V61 WeakPolarHBondContact CA-O 3.38Å; Y6-V61 PolarHBondContact N-O 2.86Å; Y6-V61 PolarHBondContact O-N 3.05Å; F8-V61 HydrophobicContact CD2-CB 4.37Å; F8-V61 HydrophobicContact CD2-CG2 3.88Å; F8-V61 HydrophobicContact CE2-CB 4.26Å; F8-V61 HydrophobicContact CE2-CG2 4.19Å; V19-V61 HydrophobicContact CG1-CG2 4.26Å; V23-V61 HydrophobicContact CG1-CG1 4.23Å; V23-V61 HydrophobicContact CG2-CG2 4.32Å; V31-V61 HydrophobicContact CB-CG1 4.29Å; V31-V61 HydrophobicContact CG1-CG1 3.6Å; V31-V61 HydrophobicContact CG2-CG1 3.73Å; V34-V61 HydrophobicContact CG1-CG2 4.25Å; V34-V61 HydrophobicContact CG2-CG1 4.39Å; V34-V61 HydrophobicContact CG2-CG2 4.3Å; A59-V61 HydrophobicContact CB-CG2 4.47Å; V61-L63 HydrophobicContact CG1-CD2 4.11Å
62	T	94.3	Very high	90.3	Very high	20 Å²	20	78.2 Å²	78.2	12%	0.123	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	121.1	173.2	-49.3	0	0	0	0	107.8	K5 K32 N33	K5-T62 HydrophobicContact CG-CG2 4.01Å; K32-T62 WeakPolarHBondContact CA-O 3.26Å; K32-T62 HydrophobicContact CB-CG2 4.5Å; K32-T62 WeakPolarHBondContact CB-O 3.46Å; K32-T62 HydrophobicContact CD-CG2 4.46Å; K32-T62 PolarHBondContact N-O 3.47Å; N33-T62 PolarHBondContact N-O 2.9Å; N33-T62 VanDerWaalsContact N-O 3.16Å; N33-T62 PolarHBondContact O-N 2.85Å
63	L	93.8	Very high	89.5	Confident	5 Å²	5	79.4 Å²	79.4	3%	0.026	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	163.3	174.3	-54.6	-175.8	0	0	0	110.9	K4 Y6 V29 V31 V61 I70	K4-L63 HydrophobicContact CB-CB 4.11Å; K4-L63 PolarHBondContact O-N 2.82Å; Y6-L63 HydrophobicContact CD2-CD1 3.9Å; Y6-L63 HydrophobicContact CD2-CG 3.99Å; Y6-L63 HydrophobicContact CE2-CD1 3.46Å; Y6-L63 VanDerWaalsContact CE2-CD1 3.46Å; Y6-L63 HydrophobicContact CE2-CG 3.95Å; V29-L63 HydrophobicContact CB-CD1 4.3Å; V29-L63 HydrophobicContact CB-CD2 4.12Å; V29-L63 HydrophobicContact CG1-CD1 4.2Å; V29-L63 HydrophobicContact CG2-CD2 3.7Å; V31-L63 HydrophobicContact CG2-CD2 3.96Å; V61-L63 HydrophobicContact CG1-CD2 4.11Å; L63-I70 HydrophobicContact CD1-CD1 3.96Å; L63-I70 HydrophobicContact CD1-CG1 3.92Å; L63-I70 HydrophobicContact CD2-CD1 4.39Å
64	T	93.3	Very high	88.5	Confident	30 Å²	30	83.9 Å²	83.9	18%	0.184	39%	0.393	C	S	.	.	P	Polyproline II helix	trans	-74.2	159.7	168.5	62.7	0	0	0	0	110.9	K30 K32 D66 S67	K30-T64 HydrophobicContact CB-CG2 4.15Å; K30-T64 PolarHBondContact O-N 2.91Å; K30-T64 PolarHBondContact O-OG1 2.8Å; K32-T64 HydrophobicContact CB-CG2 3.88Å; T64-D66 VanDerWaalsContact C-N 3.28Å; T64-D66 WeakPolarHBondContact CB-OD1 3.44Å; T64-D66 PolarHBondContact O-N 2.82Å; T64-D66 PolarHBondContact OG1-OD1 3.45Å; T64-S67 WeakPolarHBondContact O-CB 3.23Å; T64-S67 PolarHBondContact O-N 3.42Å; T64-S67 PolarHBondContact OG1-OG 2.79Å
65	E	88	Confident	87.3	Confident	161 Å²	161	81.6 Å²	81.6	75%	0.752	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.8	-33.4	-179.3	-71.4	161.7	-147.8	0	0	112	K4 S67	K4-E65 PolarHBondContact NZ-O 3.12Å; E65-S67 VanDerWaalsContact C-N 3.29Å; E65-S67 PolarHBondContact O-N 3.01Å
66	D	87.3	Confident	85.3	Confident	104 Å²	104	88.9 Å²	88.9	56%	0.556	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.1	-9.3	177.2	65.4	-47.8	0	0	0	114.1	K30 T64	K30-D66 IonicContact NZ-OD2 3.99Å; K30-D66 PolarHBondContact NZ-OD2 2.89Å; T64-D66 VanDerWaalsContact C-N 3.28Å; T64-D66 WeakPolarHBondContact CB-OD1 3.44Å; T64-D66 PolarHBondContact O-N 2.82Å; T64-D66 PolarHBondContact OG1-OD1 3.45Å
67	S	84.7	Confident	84.8	Confident	10 Å²	10	87.7 Å²	87.7	7%	0.07	44%	0.439	C	S	.	.	S	Bend	trans	-78.5	149.4	-176.6	-74.2	0	0	0	0	113.4	K4 K30 T64 E65	K4-S67 PolarHBondContact NZ-O 3.4Å; K30-S67 WeakPolarHBondContact CA-OG 3.45Å; K30-S67 VanDerWaalsContact CB-OG 3.26Å; K30-S67 WeakPolarHBondContact CB-OG 3.31Å; K30-S67 PolarHBondContact N-OG 2.91Å; K30-S67 PolarHBondContact O-OG 3.48Å; T64-S67 WeakPolarHBondContact O-CB 3.23Å; T64-S67 PolarHBondContact O-N 3.42Å; T64-S67 PolarHBondContact OG1-OG 2.79Å; E65-S67 VanDerWaalsContact C-N 3.29Å; E65-S67 PolarHBondContact O-N 3.01Å
68	K	84.9	Confident	84.3	Confident	151 Å²	151	89.8 Å²	89.8	66%	0.657	45%	0.452	S	S	*	.	P	Polyproline II helix	trans	-56.7	144	167.5	-62.8	178.8	-176.6	173.8	0	110.2	V29	V29-K68 HydrophobicContact CG1-CB 4.42Å; V29-K68 WeakPolarHBondContact CG1-O 3.46Å
69	E	84.3	Confident	83.6	Confident	138 Å²	138	90.5 Å²	90.5	65%	0.645	46%	0.459	S	S	*	.	P	Polyproline II helix	trans	-75.8	142.2	173.2	-64.4	-173.8	173.6	0	0	110	Q71	E69-Q71 PolarHBondContact O-N 2.88Å
70	I	85.6	Confident	82.9	Confident	11 Å²	11	95.8 Å²	95.8	6%	0.056	49%	0.486	C	S	.	.			trans	-84.8	115.4	175.5	-56.6	172	0	0	0	107.3	Y6 F8 F27 V29 L63 I72	Y6-I70 HydrophobicContact CD1-CB 4.21Å; Y6-I70 HydrophobicContact CD2-CD1 4.01Å; Y6-I70 HydrophobicContact CE1-CB 3.87Å; Y6-I70 WeakPolarHBondContact CE1-O 3.49Å; Y6-I70 HydrophobicContact CE2-CB 4.35Å; Y6-I70 HydrophobicContact CE2-CD1 4.31Å; Y6-I70 HydrophobicContact CE2-CG1 4.32Å; Y6-I70 HydrophobicContact CG-CD1 4.16Å; Y6-I70 PolarHBondContact OH-N 2.87Å; Y6-I70 VanDerWaalsContact OH-N 3.14Å; F8-I70 HydrophobicContact CE2-CD1 4.49Å; F8-I70 HydrophobicContact CZ-CD1 3.99Å; F27-I70 HydrophobicContact CB-CD1 4.44Å; F27-I70 HydrophobicContact CB-CG1 4.34Å; F27-I70 HydrophobicContact CD1-CG2 3.7Å; F27-I70 HydrophobicContact CD2-CD1 4.33Å; F27-I70 HydrophobicContact CE1-CG2 3.75Å; F27-I70 HydrophobicContact CG-CD1 4.27Å; F27-I70 HydrophobicContact CG-CG1 4.38Å; F27-I70 HydrophobicContact CG-CG2 4.25Å; F27-I70 HydrophobicContact CZ-CG2 4.34Å; V29-I70 HydrophobicContact CG1-CG1 4.05Å; V29-I70 HydrophobicContact CG2-CD1 4.46Å; L63-I70 HydrophobicContact CD1-CD1 3.96Å; L63-I70 HydrophobicContact CD1-CG1 3.92Å; L63-I70 HydrophobicContact CD2-CD1 4.39Å; I70-I72 HydrophobicContact CB-CD1 4.38Å; I70-I72 HydrophobicContact CG2-CD1 3.47Å; I70-I72 VanDerWaalsContact CG2-CD1 3.47Å; I70-I72 HydrophobicContact CG2-CG1 4.18Å; I70-I72 PolarHBondContact O-N 2.82Å
71	Q	80.8	Confident	82.1	Confident	174 Å²	174	99.6 Å²	99.6	81%	0.813	50%	0.503	S	S	*	.			trans	-76.7	110.7	173.2	-66.9	177.9	-20.3	0	0	108.6	E69	E69-Q71 PolarHBondContact O-N 2.88Å
72	I	77.1	Confident	81.3	Confident	89 Å²	89	106.2 Å²	106.2	46%	0.456	54%	0.536	S	S	.	.			trans	-102.4	-29.7	-178.6	-57.3	-66.4	0	0	0	111.6	Y6 I70	Y6-I72 HydrophobicContact CD1-CG1 4.17Å; Y6-I72 HydrophobicContact CE1-CG1 4.31Å; I70-I72 HydrophobicContact CB-CD1 4.38Å; I70-I72 HydrophobicContact CG2-CD1 3.47Å; I70-I72 VanDerWaalsContact CG2-CD1 3.47Å; I70-I72 HydrophobicContact CG2-CG1 4.18Å; I70-I72 PolarHBondContact O-N 2.82Å
73	F	76.5	Confident	80.3	Confident	180 Å²	180	112.4 Å²	112.4	79%	0.789	57%	0.566	S	S	*	*	S	Bend	trans	-116	120	177.5	-58	-77.3	0	0	0	106.9	A75	F73-A75 PolarHBondContact O-N 3.04Å
74	D	72.3	Confident	79.3	Confident	151 Å²	151	120.6 Å²	120.6	81%	0.807	61%	0.607	S	S	*	*			trans	-63.6	121.1	157.8	-71	-42.9	0	0	0	105.9	E76	D74-E76 PolarHBondContact O-N 3.26Å
75	A	65.9	Low	78.1	Confident	106 Å²	106	128.2 Å²	128.2	88%	0.876	64%	0.642	S	S	*	*			trans	-68	100.4	171.6	0	0	0	0	0	106.9	F73	F73-A75 PolarHBondContact O-N 3.04Å
76	E	50.3	Low	77.2	Confident	263 Å²	263	125.2 Å²	125.2	100%	1.229	63%	0.632	S	S	*	*			trans	-78.8	0	164.6	-155.2	177.7	-167.5	0	0	110.1	D74	D74-E76 PolarHBondContact O-N 3.26Å

Retrieved 76 of 76 residues in 30 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).