A0A077ZHF9_TRITR Loading...

ADP,ATP carrier protein 1

AlphaFold DB , UniProt , Accession A0A077ZHF9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 65 aa.

						>A0A077ZHF9_TRITR|A0A077ZHF9
MASQDKGTPKSPSLPVKSGKKDDKSFNMKKFTVDLLTGGVAAAISKTAVAPIERVKLLLQVRLLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	64.4	Low	253 Å²	253	137.4 Å²	137.4	100%	1.246	79%	0.791	S	S	*	*				0	118	0	-86.1	134	87.7	0	0	108.3
2	A	64.6	Low	64.6	Low	99 Å²	99	136 Å²	136	82%	0.818	79%	0.791	S	S	*	*			trans	-90.8	164.1	174.9	0	0	0	0	0	110.2
3	S	62.2	Low	64.5	Low	111 Å²	111	133.5 Å²	133.5	78%	0.776	79%	0.786	S	S	*	*			trans	86.9	98.2	153	-144.5	0	0	0	0	117.3
4	Q	69.2	Low	64.5	Low	132 Å²	132	134.6 Å²	134.6	62%	0.617	79%	0.785	S	S	*	*				-178.1	96.9	95.4	-102.4	-175.2	18.2	0	0	109.6	K6	Q4-K6 VanDerWaalsContact C-N 3.33Å; Q4-K6 PolarHBondContact O-N 3.35Å; Q4-K6 VanDerWaalsContact OE1-CD 3.27Å; Q4-K6 VanDerWaalsContact OE1-NZ 3.13Å
5	D	66.9	Low	64.3	Low	162 Å²	162	134 Å²	134	87%	0.866	79%	0.787	S	S	*	*			trans	-63.9	97.6	144.8	174.2	39.6	0	0	0	107.2
6	K	68.2	Low	64.3	Low	149 Å²	149	133.3 Å²	133.3	65%	0.648	78%	0.784	S	S	*	*			trans	-108.3	86	166.1	-101.2	-175.6	-175.1	163.8	0	108	Q4 T8	Q4-K6 VanDerWaalsContact C-N 3.33Å; Q4-K6 PolarHBondContact O-N 3.35Å; Q4-K6 VanDerWaalsContact OE1-CD 3.27Å; Q4-K6 VanDerWaalsContact OE1-NZ 3.13Å; K6-T8 PolarHBondContact O-N 3.06Å
7	G	60.2	Low	63.9	Low	63 Å²	63	138.2 Å²	138.2	65%	0.649	79%	0.794	S	S	*	*			trans	-50.8	110.5	155.8	0	0	0	0	0	109.5
8	T	69.8	Low	63.5	Low	120 Å²	120	136.3 Å²	136.3	74%	0.736	79%	0.79	S	S	*	*			trans	-102.2	105.3	158.5	37.6	0	0	0	0	106.4	K6 K10	K6-T8 PolarHBondContact O-N 3.06Å; T8-K10 VanDerWaalsContact C-N 3.26Å; T8-K10 PolarHBondContact O-N 3.41Å
9	P	64.6	Low	63.2	Low	128 Å²	128	133.1 Å²	133.1	83%	0.831	79%	0.789	S	S	*	*			trans	-69.7	91.4	171.2	28	-30.9	0	0	0	106.9	S11	P9-S11 VanDerWaalsContact C-N 3.26Å; P9-S11 PolarHBondContact O-N 3.47Å
10	K	66.6	Low	63	Low	204 Å²	204	135.8 Å²	135.8	89%	0.887	79%	0.79	S	S	*	*			trans	-74	90.6	-179.6	-152.7	-177.7	-177.2	-173.1	0	107.9	T8	T8-K10 VanDerWaalsContact C-N 3.26Å; T8-K10 PolarHBondContact O-N 3.41Å
11	S	63.5	Low	62.4	Low	90 Å²	90	138.1 Å²	138.1	63%	0.629	79%	0.791	S	S	*	*			trans	4.6	122	162.7	-154	0	0	0	0	115.2	P9 S13	P9-S11 VanDerWaalsContact C-N 3.26Å; P9-S11 PolarHBondContact O-N 3.47Å; S11-S13 PolarHBondContact O-N 3.19Å
12	P	66.1	Low	62.6	Low	121 Å²	121	132.8 Å²	132.8	79%	0.786	77%	0.767	S	S	*	*			trans	-65.1	86.2	169.4	28.5	-32.1	0	0	0	107.9	L14	P12-L14 VanDerWaalsContact C-N 3.28Å; P12-L14 PolarHBondContact O-N 2.92Å
13	S	63.4	Low	62.4	Low	104 Å²	104	132.2 Å²	132.2	73%	0.727	75%	0.751	S	S	*	*			trans	-59.5	100.2	166.9	44.6	0	0	0	0	105.4	S11	S11-S13 PolarHBondContact O-N 3.19Å
14	L	64.9	Low	62.5	Low	148 Å²	148	136.9 Å²	136.9	78%	0.775	76%	0.757	S	S	*	*			trans	-42.8	121.8	174.8	-65	170.7	0	0	0	106.4	P12 V16	P12-L14 VanDerWaalsContact C-N 3.28Å; P12-L14 PolarHBondContact O-N 2.92Å; L14-V16 PolarHBondContact O-N 3.37Å
15	P	62.3	Low	62.5	Low	126 Å²	126	133.7 Å²	133.7	82%	0.818	75%	0.75	S	S	*	*			trans	-63.1	88.9	178.1	24.8	-32.7	0	0	0	107.5	K17	P15-K17 PolarHBondContact O-N 3.25Å
16	V	63.4	Low	62.8	Low	122 Å²	122	136.2 Å²	136.2	74%	0.739	75%	0.753	S	S	*	*			trans	-70.6	88.1	169	153.4	0	0	0	0	104.5	L14 S18	L14-V16 PolarHBondContact O-N 3.37Å; V16-S18 PolarHBondContact O-N 3.4Å
17	K	58.2	Low	63.7	Low	217 Å²	217	132.5 Å²	132.5	94%	0.943	74%	0.74	S	S	*	*			trans	-67.4	78.3	171.9	-173.4	177.9	-177.4	177.9	0	107.4	P15	P15-K17 PolarHBondContact O-N 3.25Å
18	S	56.5	Low	65	Low	105 Å²	105	136 Å²	136	73%	0.734	74%	0.741	S	S	*	*			trans	-117.8	134.7	-178.6	-156.7	0	0	0	0	109.7	V16	V16-S18 PolarHBondContact O-N 3.4Å
19	G	56.9	Low	66	Low	74 Å²	74	138.4 Å²	138.4	76%	0.763	74%	0.742	S	S	*	*			trans	98.6	74.1	167.6	0	0	0	0	0	115.4	K21	G19-K21 PolarHBondContact O-N 2.86Å
20	K	59.2	Low	67.2	Low	187 Å²	187	136 Å²	136	81%	0.813	72%	0.718	S	S	*	*			trans	-70.1	111.7	159.3	-168.6	173.5	-174.5	177.2	0	107.5
21	K	51.4	Low	68.3	Low	186 Å²	186	131.9 Å²	131.9	81%	0.809	70%	0.7	S	S	*	*			trans	-36.2	126.3	179.3	-137.9	173.1	-168.8	172.5	0	113.3	G19	G19-K21 PolarHBondContact O-N 2.86Å
22	D	56.6	Low	69.7	Low	140 Å²	140	130.5 Å²	130.5	75%	0.749	69%	0.688	S	S	*	*			trans	-94.5	80.2	-176.1	44.9	-54.5	0	0	0	111.1
23	D	60.1	Low	71	Confident	88 Å²	88	127.9 Å²	127.9	47%	0.471	67%	0.67	S	S	.	*			trans	-76.8	122.3	161.7	63.7	-60.3	0	0	0	109.2	S25	D23-S25 PolarHBondContact O-N 3.18Å
24	K	65.4	Low	72.3	Confident	208 Å²	208	126.6 Å²	126.6	90%	0.904	66%	0.655	S	S	*	*			trans	-66.4	17.6	-179.1	-69.1	-167.2	-67.2	173.4	0	114.6
25	S	67.6	Low	73.7	Confident	66 Å²	66	124.4 Å²	124.4	46%	0.462	64%	0.643	S	S	.	*			trans	-84.6	123.4	176.2	-176.2	0	0	0	0	109.8	D23 N27	D23-S25 PolarHBondContact O-N 3.18Å; S25-N27 PolarHBondContact O-N 2.9Å
26	F	74.9	Confident	75.3	Confident	215 Å²	215	123.8 Å²	123.8	94%	0.943	63%	0.633	S	S	*	*			trans	-67.9	75	174	-70.1	-84	0	0	0	110.6
27	N	86.8	Confident	76.8	Confident	70 Å²	70	122.2 Å²	122.2	37%	0.374	62%	0.624	S	S	.	*			trans	-81.8	117.8	175.2	-87.8	-59.5	0	0	0	109.8	S25 K29 K30 F31	S25-N27 PolarHBondContact O-N 2.9Å; N27-K29 PolarHBondContact O-N 2.95Å; N27-K30 HydrophobicContact CB-CB 3.83Å; N27-K30 CarbonylContact O-C 3.58Å; N27-K30 WeakPolarHBondContact O-CA 3.2Å; N27-K30 VanDerWaalsContact O-CB 3.31Å; N27-K30 WeakPolarHBondContact O-CB 3.4Å; N27-K30 PolarHBondContact O-N 3.36Å; N27-F31 PolarHBondContact O-N 3.47Å
28	M	87.7	Confident	78.6	Confident	136 Å²	136	113.8 Å²	113.8	67%	0.67	60%	0.598	S	S	*	*	H	α-helix	trans	-54	-39.4	178.5	-172	65.4	-172.6	0	0	112.7	K30 F31 T32	M28-K30 VanDerWaalsContact C-N 3.31Å; M28-K30 PolarHBondContact O-N 3.21Å; M28-F31 HydrophobicContact CE-CD1 4.24Å; M28-F31 WeakPolarHBondContact O-CB 3.49Å; M28-F31 PolarHBondContact O-N 2.92Å; M28-F31 HydrophobicContact SD-CD1 4.25Å; M28-T32 PolarHBondContact O-N 3.4Å; M28-T32 PolarHBondContact O-OG1 3.03Å
29	K	90.3	Very high	80.5	Confident	172 Å²	172	110.7 Å²	110.7	75%	0.748	58%	0.582	S	S	*	*	H	α-helix	trans	-59.8	-40.8	173.8	-69	-170.3	-71.1	-81.2	0	112.2	N27 V33	N27-K29 PolarHBondContact O-N 2.95Å; K29-V33 WeakPolarHBondContact O-CG2 3.42Å; K29-V33 PolarHBondContact O-N 3.39Å; K29-V33 VanDerWaalsContact O-N 3.14Å
30	K	88.9	Confident	82.3	Confident	77 Å²	77	111.4 Å²	111.4	34%	0.335	57%	0.572	S	S	.	*	H	α-helix	trans	-67.9	-43.2	176.3	-174.1	-179.7	-176.6	-64	0	110.6	N27 M28 T32 V33 D34	N27-K30 HydrophobicContact CB-CB 3.83Å; N27-K30 CarbonylContact O-C 3.58Å; N27-K30 WeakPolarHBondContact O-CA 3.2Å; N27-K30 VanDerWaalsContact O-CB 3.31Å; N27-K30 WeakPolarHBondContact O-CB 3.4Å; N27-K30 PolarHBondContact O-N 3.36Å; M28-K30 VanDerWaalsContact C-N 3.31Å; M28-K30 PolarHBondContact O-N 3.21Å; K30-T32 PolarHBondContact O-N 3.1Å; K30-V33 PolarHBondContact O-N 3.05Å; K30-D34 IonicContact NZ-OD1 2.7Å; K30-D34 IonicContact NZ-OD2 3.91Å; K30-D34 PolarHBondContact NZ-OD2 2.98Å; K30-D34 WeakPolarHBondContact O-CB 3.3Å; K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.05Å
31	F	90.3	Very high	84.1	Confident	117 Å²	117	105.2 Å²	105.2	51%	0.513	56%	0.555	S	S	.	*	H	α-helix	trans	-56.4	-47	174.1	173.8	-95.7	0	0	0	112	N27 M28 V33 D34 L35	N27-F31 PolarHBondContact O-N 3.47Å; M28-F31 HydrophobicContact CE-CD1 4.24Å; M28-F31 WeakPolarHBondContact O-CB 3.49Å; M28-F31 PolarHBondContact O-N 2.92Å; M28-F31 HydrophobicContact SD-CD1 4.25Å; F31-V33 VanDerWaalsContact C-N 3.34Å; F31-V33 PolarHBondContact O-N 3.41Å; F31-D34 PolarHBondContact O-N 2.83Å; F31-L35 HydrophobicContact CE1-CB 4.48Å; F31-L35 HydrophobicContact CE1-CD2 4.13Å; F31-L35 HydrophobicContact CZ-CD2 4.43Å; F31-L35 VanDerWaalsContact O-CB 3.23Å; F31-L35 WeakPolarHBondContact O-CB 3.49Å; F31-L35 PolarHBondContact O-N 3.17Å
32	T	93.7	Very high	86.1	Confident	62 Å²	62	98.8 Å²	98.8	38%	0.38	54%	0.537	S	S	.	.	H	α-helix	trans	-63.4	-40.5	178.3	-52	0	0	0	0	111.7	M28 K30 L35 L36	M28-T32 PolarHBondContact O-N 3.4Å; M28-T32 PolarHBondContact O-OG1 3.03Å; K30-T32 PolarHBondContact O-N 3.1Å; T32-L35 PolarHBondContact O-N 3.34Å; T32-L36 HydrophobicContact CG2-CD1 4.27Å; T32-L36 WeakPolarHBondContact O-CB 3.37Å; T32-L36 VanDerWaalsContact O-CG 3.25Å; T32-L36 WeakPolarHBondContact O-CG 3.29Å; T32-L36 PolarHBondContact O-N 2.86Å
33	V	92.9	Very high	88	Confident	65 Å²	65	94.8 Å²	94.8	39%	0.394	52%	0.524	S	S	.	.	H	α-helix	trans	-65.1	-43.5	175.4	172.3	0	0	0	0	111.4	K29 K30 F31 L36 T37	K29-V33 WeakPolarHBondContact O-CG2 3.42Å; K29-V33 PolarHBondContact O-N 3.39Å; K29-V33 VanDerWaalsContact O-N 3.14Å; K30-V33 PolarHBondContact O-N 3.05Å; F31-V33 VanDerWaalsContact C-N 3.34Å; F31-V33 PolarHBondContact O-N 3.41Å; V33-L36 PolarHBondContact O-N 3.1Å; V33-T37 VanDerWaalsContact O-CB 3.24Å; V33-T37 WeakPolarHBondContact O-CB 3.4Å; V33-T37 PolarHBondContact O-N 3.38Å; V33-T37 PolarHBondContact O-OG1 3.15Å
34	D	91.3	Very high	89.7	Confident	77 Å²	77	95.8 Å²	95.8	41%	0.412	53%	0.528	S	S	.	.	H	α-helix	trans	-67.8	-36	178.3	-71.1	-6.3	0	0	0	111	K30 F31 G38	K30-D34 IonicContact NZ-OD1 2.7Å; K30-D34 IonicContact NZ-OD2 3.91Å; K30-D34 PolarHBondContact NZ-OD2 2.98Å; K30-D34 WeakPolarHBondContact O-CB 3.3Å; K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.05Å; F31-D34 PolarHBondContact O-N 2.83Å; D34-G38 WeakPolarHBondContact O-CA 3.21Å; D34-G38 PolarHBondContact O-N 3.16Å
35	L	94.3	Very high	91.1	Very high	102 Å²	102	89 Å²	89	53%	0.534	51%	0.507	S	S	.	.	H	α-helix	trans	-66.9	-44.7	174.5	-178.2	71.1	0	0	0	111.3	F31 T32 G39	F31-L35 HydrophobicContact CE1-CB 4.48Å; F31-L35 HydrophobicContact CE1-CD2 4.13Å; F31-L35 HydrophobicContact CZ-CD2 4.43Å; F31-L35 VanDerWaalsContact O-CB 3.23Å; F31-L35 WeakPolarHBondContact O-CB 3.49Å; F31-L35 PolarHBondContact O-N 3.17Å; T32-L35 PolarHBondContact O-N 3.34Å; L35-G39 VanDerWaalsContact O-CA 3.31Å; L35-G39 WeakPolarHBondContact O-CA 3.36Å; L35-G39 PolarHBondContact O-N 3.45Å
36	L	95.5	Very high	92.2	Very high	114 Å²	114	93.9 Å²	93.9	60%	0.597	52%	0.52	S	S	*	.	H	α-helix	trans	-66.5	-46.4	176.7	-70.6	175	0	0	0	110.9	T32 V33 G39 V40	T32-L36 HydrophobicContact CG2-CD1 4.27Å; T32-L36 WeakPolarHBondContact O-CB 3.37Å; T32-L36 VanDerWaalsContact O-CG 3.25Å; T32-L36 WeakPolarHBondContact O-CG 3.29Å; T32-L36 PolarHBondContact O-N 2.86Å; V33-L36 PolarHBondContact O-N 3.1Å; L36-G39 PolarHBondContact O-N 3.04Å; L36-V40 WeakPolarHBondContact O-CB 3.4Å; L36-V40 VanDerWaalsContact O-CG2 3.27Å; L36-V40 WeakPolarHBondContact O-CG2 3.43Å; L36-V40 PolarHBondContact O-N 2.97Å
37	T	95.1	Very high	93.1	Very high	89 Å²	89	88.5 Å²	88.5	55%	0.546	50%	0.504	S	S	.	.	H	α-helix	trans	-64	-48.2	179.3	-54.1	0	0	0	0	110.8	V33 A41	V33-T37 VanDerWaalsContact O-CB 3.24Å; V33-T37 WeakPolarHBondContact O-CB 3.4Å; V33-T37 PolarHBondContact O-N 3.38Å; V33-T37 PolarHBondContact O-OG1 3.15Å; T37-A41 VanDerWaalsContact O-CB 3.26Å; T37-A41 WeakPolarHBondContact O-CB 3.32Å; T37-A41 PolarHBondContact O-N 2.83Å
38	G	94.8	Very high	93.3	Very high	39 Å²	39	88 Å²	88	40%	0.402	51%	0.51	S	S	.	.	H	α-helix	trans	-66.9	-38	177	0	0	0	0	0	112.8	D34 A41 A42	D34-G38 WeakPolarHBondContact O-CA 3.21Å; D34-G38 PolarHBondContact O-N 3.16Å; G38-A41 PolarHBondContact O-N 2.84Å; G38-A42 VanDerWaalsContact O-CB 3.24Å; G38-A42 WeakPolarHBondContact O-CB 3.35Å; G38-A42 PolarHBondContact O-N 2.98Å
39	G	96.1	Very high	93.5	Very high	40 Å²	40	84.6 Å²	84.6	41%	0.412	50%	0.497	S	S	.	.	H	α-helix	trans	-64.2	-48.2	177.4	0	0	0	0	0	112.2	L35 L36 A42 A43	L35-G39 VanDerWaalsContact O-CA 3.31Å; L35-G39 WeakPolarHBondContact O-CA 3.36Å; L35-G39 PolarHBondContact O-N 3.45Å; L36-G39 PolarHBondContact O-N 3.04Å; G39-A42 PolarHBondContact O-N 3.42Å; G39-A43 PolarHBondContact O-N 3.31Å
40	V	95.9	Very high	93.6	Very high	90 Å²	90	77.8 Å²	77.8	55%	0.545	47%	0.473	S	S	.	.	H	α-helix	trans	-63	-45	174.6	174.3	0	0	0	0	110.6	L36 A42 A43 I44	L36-V40 WeakPolarHBondContact O-CB 3.4Å; L36-V40 VanDerWaalsContact O-CG2 3.27Å; L36-V40 WeakPolarHBondContact O-CG2 3.43Å; L36-V40 PolarHBondContact O-N 2.97Å; V40-A42 VanDerWaalsContact C-N 3.33Å; V40-A42 PolarHBondContact O-N 3.35Å; V40-A43 PolarHBondContact O-N 2.87Å; V40-I44 HydrophobicContact CG1-CD1 3.8Å; V40-I44 VanDerWaalsContact O-CG1 3.32Å; V40-I44 WeakPolarHBondContact O-CG1 3.47Å; V40-I44 PolarHBondContact O-N 3.39Å
41	A	95.7	Very high	93.6	Very high	56 Å²	56	77.4 Å²	77.4	46%	0.463	48%	0.478	S	S	.	.	H	α-helix	trans	-60	-41.1	176.8	0	0	0	0	0	112.4	T37 G38 S45	T37-A41 VanDerWaalsContact O-CB 3.26Å; T37-A41 WeakPolarHBondContact O-CB 3.32Å; T37-A41 PolarHBondContact O-N 2.83Å; G38-A41 PolarHBondContact O-N 2.84Å; A41-S45 WeakPolarHBondContact O-CB 3.5Å; A41-S45 PolarHBondContact O-N 2.98Å
42	A	95	Very high	93.6	Very high	51 Å²	51	77.1 Å²	77.1	42%	0.421	48%	0.481	S	S	.	.	H	α-helix	trans	-67.3	-41.5	177.8	0	0	0	0	0	112.5	G38 G39 V40 S45 K46	G38-A42 VanDerWaalsContact O-CB 3.24Å; G38-A42 WeakPolarHBondContact O-CB 3.35Å; G38-A42 PolarHBondContact O-N 2.98Å; G39-A42 PolarHBondContact O-N 3.42Å; V40-A42 VanDerWaalsContact C-N 3.33Å; V40-A42 PolarHBondContact O-N 3.35Å; A42-S45 PolarHBondContact O-N 2.82Å; A42-K46 PolarHBondContact O-N 3.35Å
43	A	95.5	Very high	93.6	Very high	57 Å²	57	79.2 Å²	79.2	47%	0.471	49%	0.486	S	S	.	.	H	α-helix	trans	-61.8	-44.4	176.6	0	0	0	0	0	111.4	G39 V40 T47	G39-A43 PolarHBondContact O-N 3.31Å; V40-A43 PolarHBondContact O-N 2.87Å; A43-T47 WeakPolarHBondContact O-CB 2.93Å; A43-T47 PolarHBondContact O-N 3.19Å; A43-T47 VanDerWaalsContact O-N 3.16Å; A43-T47 PolarHBondContact O-OG1 2.71Å
44	I	95.6	Very high	93.5	Very high	108 Å²	108	84.1 Å²	84.1	55%	0.554	50%	0.497	S	S	*	.	H	α-helix	trans	-65.1	-45.8	176	-64.8	169	0	0	0	110.2	V40 K46 T47 A48	V40-I44 HydrophobicContact CG1-CD1 3.8Å; V40-I44 VanDerWaalsContact O-CG1 3.32Å; V40-I44 WeakPolarHBondContact O-CG1 3.47Å; V40-I44 PolarHBondContact O-N 3.39Å; I44-K46 PolarHBondContact O-N 2.94Å; I44-T47 PolarHBondContact O-N 3.05Å; I44-T47 VanDerWaalsContact O-N 3.15Å; I44-A48 WeakPolarHBondContact O-CB 3.24Å; I44-A48 PolarHBondContact O-N 2.66Å
45	S	94.9	Very high	93.5	Very high	67 Å²	67	84.9 Å²	84.9	47%	0.469	51%	0.505	S	S	.	.	H	α-helix	trans	-58.4	-48.1	-179.6	-178.7	0	0	0	0	112.4	A41 A42 T47 A48 V49	A41-S45 WeakPolarHBondContact O-CB 3.5Å; A41-S45 PolarHBondContact O-N 2.98Å; A42-S45 PolarHBondContact O-N 2.82Å; S45-T47 VanDerWaalsContact C-N 3.31Å; S45-T47 PolarHBondContact O-N 2.87Å; S45-A48 PolarHBondContact O-N 2.85Å; S45-V49 VanDerWaalsContact O-CG2 3.3Å; S45-V49 WeakPolarHBondContact O-CG2 3.3Å; S45-V49 PolarHBondContact O-N 2.82Å
46	K	90.2	Very high	93.3	Very high	168 Å²	168	85.8 Å²	85.8	73%	0.73	50%	0.504	S	S	*	.	H	α-helix	trans	-64.5	-34.9	176.7	-75.9	-173.2	175.9	-178.5	0	112.7	A42 I44 A50	A42-K46 PolarHBondContact O-N 3.35Å; I44-K46 PolarHBondContact O-N 2.94Å; K46-A50 WeakPolarHBondContact O-CB 3.42Å; K46-A50 PolarHBondContact O-N 3.43Å
47	T	94	Very high	93.1	Very high	101 Å²	101	85.5 Å²	85.5	62%	0.62	50%	0.503	S	S	*	.	H	α-helix	trans	-71.5	-39.5	178.1	-56.2	0	0	0	0	111.9	A43 I44 S45 P51	A43-T47 WeakPolarHBondContact O-CB 2.93Å; A43-T47 PolarHBondContact O-N 3.19Å; A43-T47 VanDerWaalsContact O-N 3.16Å; A43-T47 PolarHBondContact O-OG1 2.71Å; I44-T47 PolarHBondContact O-N 3.05Å; I44-T47 VanDerWaalsContact O-N 3.15Å; S45-T47 VanDerWaalsContact C-N 3.31Å; S45-T47 PolarHBondContact O-N 2.87Å; T47-P51 WeakPolarHBondContact O-CD 3.39Å
48	A	91.9	Very high	92.6	Very high	59 Å²	59	85.7 Å²	85.7	49%	0.488	50%	0.5	S	S	.	.	H	α-helix	trans	-71.7	-34.2	-179.9	0	0	0	0	0	112.7	I44 S45 P51	I44-A48 WeakPolarHBondContact O-CB 3.24Å; I44-A48 PolarHBondContact O-N 2.66Å; S45-A48 PolarHBondContact O-N 2.85Å; A48-P51 WeakPolarHBondContact O-CD 3.42Å
49	V	91.3	Very high	92.2	Very high	66 Å²	66	88.6 Å²	88.6	40%	0.4	51%	0.506	S	S	.	.	H	α-helix	trans	-79.6	-27.4	179.4	176.3	0	0	0	0	112.1	S45 I52 E53	S45-V49 VanDerWaalsContact O-CG2 3.3Å; S45-V49 WeakPolarHBondContact O-CG2 3.3Å; S45-V49 PolarHBondContact O-N 2.82Å; V49-I52 WeakPolarHBondContact O-CB 3.22Å; V49-I52 PolarHBondContact O-N 2.77Å; V49-E53 HydrophobicContact CG1-CG 3.95Å; V49-E53 PolarHBondContact O-N 3.45Å
50	A	92.4	Very high	91.5	Very high	29 Å²	29	92.4 Å²	92.4	24%	0.24	51%	0.513	C	S	.	.	H	α-helix	trans	-57.4	-42.7	-179.6	0	0	0	0	0	114.9	K46 I52 R54	K46-A50 WeakPolarHBondContact O-CB 3.42Å; K46-A50 PolarHBondContact O-N 3.43Å; A50-I52 VanDerWaalsContact C-N 3.28Å; A50-I52 PolarHBondContact O-N 2.85Å; A50-R54 WeakPolarHBondContact O-CB 3.32Å; A50-R54 VanDerWaalsContact O-CG 3.24Å; A50-R54 WeakPolarHBondContact O-CG 3.47Å; A50-R54 PolarHBondContact O-N 2.74Å; A50-R54 VanDerWaalsContact O-N 3.1Å
51	P	88.1	Confident	91.2	Very high	69 Å²	69	91.7 Å²	91.7	45%	0.448	51%	0.508	S	S	.	.	H	α-helix	trans	-56.4	-39.9	171.3	-27.7	33.3	0	0	0	113.4	T47 A48 V55	T47-P51 WeakPolarHBondContact O-CD 3.39Å; A48-P51 WeakPolarHBondContact O-CD 3.42Å; P51-V55 WeakPolarHBondContact O-CG2 3.26Å; P51-V55 PolarHBondContact O-N 2.79Å; P51-V55 VanDerWaalsContact O-N 3.1Å
52	I	92	Very high	90.7	Very high	111 Å²	111	97.6 Å²	97.6	57%	0.569	52%	0.519	S	S	*	.	H	α-helix	trans	-71.8	-46.3	-175.8	-61	168.6	0	0	0	110.6	V49 A50 R54 V55 K56	V49-I52 WeakPolarHBondContact O-CB 3.22Å; V49-I52 PolarHBondContact O-N 2.77Å; A50-I52 VanDerWaalsContact C-N 3.28Å; A50-I52 PolarHBondContact O-N 2.85Å; I52-R54 VanDerWaalsContact C-N 3.31Å; I52-R54 PolarHBondContact O-N 2.7Å; I52-V55 PolarHBondContact O-N 3.27Å; I52-K56 PolarHBondContact O-N 2.92Å
53	E	93.1	Very high	90.1	Very high	105 Å²	105	102 Å²	102	49%	0.491	53%	0.534	S	S	.	.	H	α-helix	trans	-62.3	-38.4	176.9	-74.5	-66.9	125.8	0	0	111.9	V49 K56 L57	V49-E53 HydrophobicContact CG1-CG 3.95Å; V49-E53 PolarHBondContact O-N 3.45Å; E53-K56 PolarHBondContact O-N 3.25Å; E53-L57 PolarHBondContact O-N 2.7Å
54	R	91.1	Very high	89.4	Confident	168 Å²	168	106.9 Å²	106.9	63%	0.634	55%	0.552	S	S	*	*	H	α-helix	trans	-63.2	-42.7	174.4	-72.8	173.7	-173.3	145.7	1.2	112	A50 I52 L57 L58	A50-R54 WeakPolarHBondContact O-CB 3.32Å; A50-R54 VanDerWaalsContact O-CG 3.24Å; A50-R54 WeakPolarHBondContact O-CG 3.47Å; A50-R54 PolarHBondContact O-N 2.74Å; A50-R54 VanDerWaalsContact O-N 3.1Å; I52-R54 VanDerWaalsContact C-N 3.31Å; I52-R54 PolarHBondContact O-N 2.7Å; R54-L57 PolarHBondContact O-N 3.14Å; R54-L58 WeakPolarHBondContact O-CB 3.27Å; R54-L58 WeakPolarHBondContact O-CG 3.24Å; R54-L58 PolarHBondContact O-N 2.75Å
55	V	90.5	Very high	88.3	Confident	93 Å²	93	111.5 Å²	111.5	56%	0.564	58%	0.577	S	S	*	*	H	α-helix	trans	-66.2	-40.7	177.5	172.3	0	0	0	0	111.3	P51 I52 L58 L59	P51-V55 WeakPolarHBondContact O-CG2 3.26Å; P51-V55 PolarHBondContact O-N 2.79Å; P51-V55 VanDerWaalsContact O-N 3.1Å; I52-V55 PolarHBondContact O-N 3.27Å; V55-L58 PolarHBondContact O-N 3.44Å; V55-L59 WeakPolarHBondContact O-CB 3.4Å; V55-L59 PolarHBondContact O-N 3.21Å
56	K	90.8	Very high	88	Confident	122 Å²	122	113.8 Å²	113.8	53%	0.53	58%	0.582	S	S	.	*	H	α-helix	trans	-59.8	-48.2	175.6	-178.3	-177.8	174.6	-172.8	0	111.6	I52 E53 L59 Q60	I52-K56 PolarHBondContact O-N 2.92Å; E53-K56 PolarHBondContact O-N 3.25Å; K56-L59 PolarHBondContact O-N 3.43Å; K56-Q60 WeakPolarHBondContact O-CB 3.31Å; K56-Q60 PolarHBondContact O-N 3.25Å
57	L	90.2	Very high	87.9	Confident	108 Å²	108	110.9 Å²	110.9	57%	0.565	57%	0.574	S	S	*	*	H	α-helix	trans	-62.9	-45.6	176.8	-173.9	68.7	0	0	0	111.3	E53 R54 L59 Q60 V61	E53-L57 PolarHBondContact O-N 2.7Å; R54-L57 PolarHBondContact O-N 3.14Å; L57-L59 VanDerWaalsContact C-N 3.32Å; L57-L59 PolarHBondContact O-N 2.9Å; L57-Q60 PolarHBondContact O-N 3.43Å; L57-V61 HydrophobicContact CD1-CG1 4.44Å; L57-V61 HydrophobicContact CG-CG1 4.5Å; L57-V61 WeakPolarHBondContact O-CG1 3.37Å; L57-V61 WeakPolarHBondContact O-CG2 3.25Å; L57-V61 PolarHBondContact O-N 2.86Å
58	L	86	Confident	87.5	Confident	92 Å²	92	111.4 Å²	111.4	48%	0.482	57%	0.572	S	S	.	*	H	α-helix	trans	-60.2	-39.1	177.3	-74.4	174.4	0	0	0	112.7	R54 V55 V61 R62	R54-L58 WeakPolarHBondContact O-CB 3.27Å; R54-L58 WeakPolarHBondContact O-CG 3.24Å; R54-L58 PolarHBondContact O-N 2.75Å; V55-L58 PolarHBondContact O-N 3.44Å; L58-V61 VanDerWaalsContact O-CG2 3.29Å; L58-V61 WeakPolarHBondContact O-CG2 3.45Å; L58-R62 WeakPolarHBondContact O-CB 3.43Å; L58-R62 WeakPolarHBondContact O-CD 3.34Å; L58-R62 WeakPolarHBondContact O-CG 3.23Å; L58-R62 PolarHBondContact O-N 3.41Å
59	L	86.2	Confident	87.3	Confident	101 Å²	101	114.5 Å²	114.5	53%	0.529	58%	0.577	S	S	.	*	H	α-helix	trans	-72.5	-39	177.3	-165.6	65	0	0	0	111.2	V55 K56 L57 R62 L63	V55-L59 WeakPolarHBondContact O-CB 3.4Å; V55-L59 PolarHBondContact O-N 3.21Å; K56-L59 PolarHBondContact O-N 3.43Å; L57-L59 VanDerWaalsContact C-N 3.32Å; L57-L59 PolarHBondContact O-N 2.9Å; L59-R62 PolarHBondContact O-N 3.16Å; L59-L63 HydrophobicContact CG-CD1 4.12Å; L59-L63 WeakPolarHBondContact O-CB 3.24Å; L59-L63 VanDerWaalsContact O-CG 3.3Å; L59-L63 WeakPolarHBondContact O-CG 3.31Å; L59-L63 PolarHBondContact O-N 2.95Å
60	Q	81.7	Confident	87	Confident	120 Å²	120	117.6 Å²	117.6	56%	0.561	59%	0.588	S	S	*	*	H	α-helix	trans	-65	-42.4	176.7	-174.1	172.2	-15	0	0	112.2	K56 L57 L63 L64	K56-Q60 WeakPolarHBondContact O-CB 3.31Å; K56-Q60 PolarHBondContact O-N 3.25Å; L57-Q60 PolarHBondContact O-N 3.43Å; Q60-L63 PolarHBondContact O-N 2.85Å; Q60-L64 WeakPolarHBondContact O-CB 3.37Å; Q60-L64 PolarHBondContact O-N 3.19Å
61	V	89	Confident	86.7	Confident	74 Å²	74	123.5 Å²	123.5	45%	0.448	61%	0.611	S	S	.	*	H	α-helix	trans	-69.9	-32.1	177.3	-60.3	0	0	0	0	112.7	L57 L58 L65	L57-V61 HydrophobicContact CD1-CG1 4.44Å; L57-V61 HydrophobicContact CG-CG1 4.5Å; L57-V61 WeakPolarHBondContact O-CG1 3.37Å; L57-V61 WeakPolarHBondContact O-CG2 3.25Å; L57-V61 PolarHBondContact O-N 2.86Å; L58-V61 VanDerWaalsContact O-CG2 3.29Å; L58-V61 WeakPolarHBondContact O-CG2 3.45Å; V61-L65 WeakPolarHBondContact O-CB 3.48Å; V61-L65 PolarHBondContact O-N 2.76Å
62	R	85.6	Confident	86.6	Confident	181 Å²	181	127.4 Å²	127.4	68%	0.683	62%	0.623	S	S	*	*	H	α-helix	trans	-74.5	-26.5	176.6	-76.3	175.1	-173.6	-175.4	1.9	114	L58 L59	L58-R62 WeakPolarHBondContact O-CB 3.43Å; L58-R62 WeakPolarHBondContact O-CD 3.34Å; L58-R62 WeakPolarHBondContact O-CG 3.23Å; L58-R62 PolarHBondContact O-N 3.41Å; L59-R62 PolarHBondContact O-N 3.16Å
63	L	83	Confident	86.2	Confident	142 Å²	142	128.6 Å²	128.6	74%	0.743	63%	0.627	S	S	*	*	H	α-helix	trans	-85.6	-24.1	177.2	-71.3	172.2	0	0	0	112.1	L59 Q60	L59-L63 HydrophobicContact CG-CD1 4.12Å; L59-L63 WeakPolarHBondContact O-CB 3.24Å; L59-L63 VanDerWaalsContact O-CG 3.3Å; L59-L63 WeakPolarHBondContact O-CG 3.31Å; L59-L63 PolarHBondContact O-N 2.95Å; Q60-L63 PolarHBondContact O-N 2.85Å
64	L	79.5	Confident	85.6	Confident	160 Å²	160	130.6 Å²	130.6	84%	0.838	64%	0.638	S	S	*	*	H	α-helix	trans	-85.6	-22.4	-179.9	-165.6	86.9	0	0	0	113.2	Q60	Q60-L64 WeakPolarHBondContact O-CB 3.37Å; Q60-L64 PolarHBondContact O-N 3.19Å
65	L	73.6	Confident	85.1	Confident	206 Å²	206	127.2 Å²	127.2	100%	1.079	64%	0.638	S	S	*	*			trans	-117.2	0	-173.6	-159.9	147.3	0	0	0	110.7	V61	V61-L65 WeakPolarHBondContact O-CB 3.48Å; V61-L65 PolarHBondContact O-N 2.76Å

Retrieved 65 of 65 residues in 40.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).