A0A077ZHG2_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHG2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 80 aa.

						>A0A077ZHG2_TRITR|A0A077ZHG2
MLTNSDGDNVALARPDPIVGDAPTSPANRAAPTDFSSDLTKKQNILLFEVTDSRVLLGSLKADEQNKIKRDTDWTAFMNT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	52.9	Low	198 Å²	198	113.2 Å²	113.2	98%	0.975	68%	0.675	S	S	*	*				0	124.5	0	-85.2	166.4	152.4	0	0	106.8
2	L	44.6	Very low	52.4	Low	158 Å²	158	118.6 Å²	118.6	83%	0.827	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-95.4	119.3	171.4	-69	169.2	0	0	0	106.5
3	T	50	Low	52.5	Low	87 Å²	87	116.3 Å²	116.3	53%	0.534	70%	0.7	S	S	.	*	B	Isolated β-bridge	trans	-98.4	136.7	176.7	51.8	0	0	0	0	108.3
4	N	53.3	Low	52.1	Low	73 Å²	73	124.4 Å²	124.4	39%	0.39	71%	0.712	S	S	.	*	P	Polyproline II helix	trans	-72.8	172.6	167.8	66.5	-0.2	0	0	0	109.7	D6 G7 D8	N4-D6 PolarHBondContact O-N 2.84Å; N4-G7 PolarHBondContact O-N 3.21Å; N4-D8 PolarHBondContact OD1-N 3.43Å
5	S	56.2	Low	52	Low	132 Å²	132	123.9 Å²	123.9	92%	0.923	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	-7.4	-173.9	-54.2	0	0	0	0	115.1
6	D	68.3	Low	51.7	Low	141 Å²	141	124.9 Å²	124.9	75%	0.754	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.3	1.8	178.3	-57.2	-50.3	0	0	0	113.1	N4	N4-D6 PolarHBondContact O-N 2.84Å
7	G	49.2	Very low	51.2	Low	54 Å²	54	124.4 Å²	124.4	56%	0.557	72%	0.719	S	S	*	*			trans	82.1	7.2	172.9	0	0	0	0	0	115.5	N4	N4-G7 PolarHBondContact O-N 3.21Å
8	D	58.3	Low	51	Low	114 Å²	114	126.2 Å²	126.2	61%	0.61	72%	0.724	S	S	*	*			trans	-80.7	136.7	176.2	-80.6	-26	0	0	0	111.8	N4 V10	N4-D8 PolarHBondContact OD1-N 3.43Å; D8-V10 PolarHBondContact O-N 3.43Å; D8-V10 VanDerWaalsContact O-N 3.17Å
9	N	48.7	Very low	50.6	Low	107 Å²	107	127.2 Å²	127.2	57%	0.572	73%	0.732	S	S	*	*	B	Isolated β-bridge	trans	-72.8	105.6	175.5	-84.9	-43.2	0	0	0	109.9	A11	N9-A11 PolarHBondContact O-N 3.29Å
10	V	50.1	Low	50.1	Low	95 Å²	95	123.1 Å²	123.1	58%	0.576	72%	0.719	S	S	*	*			trans	-76.6	107.9	172.2	-150.6	0	0	0	0	108.2	D8 L12	D8-V10 PolarHBondContact O-N 3.43Å; D8-V10 VanDerWaalsContact O-N 3.17Å; V10-L12 PolarHBondContact O-N 3.24Å
11	A	54.9	Low	49.9	Very low	86 Å²	86	124.8 Å²	124.8	71%	0.711	73%	0.725	S	S	*	*			trans	-59.4	129.1	169.5	0	0	0	0	0	108.6	N9 A13	N9-A11 PolarHBondContact O-N 3.29Å; A11-A13 VanDerWaalsContact C-N 3.26Å; A11-A13 PolarHBondContact O-N 3Å
12	L	47.2	Very low	49.9	Very low	178 Å²	178	119.2 Å²	119.2	93%	0.932	71%	0.71	S	S	*	*			trans	-62.1	91.9	169.8	-88.2	144.5	0	0	0	107.8	V10 R14	V10-L12 PolarHBondContact O-N 3.24Å; L12-R14 PolarHBondContact O-N 3.42Å; L12-R14 VanDerWaalsContact O-N 3.08Å
13	A	53.8	Low	49.9	Very low	89 Å²	89	117.7 Å²	117.7	74%	0.736	71%	0.71	S	S	*	*			trans	-58.6	115.5	169.5	0	0	0	0	0	107.2	A11 P15	A11-A13 VanDerWaalsContact C-N 3.26Å; A11-A13 PolarHBondContact O-N 3Å; A13-P15 WeakPolarHBondContact O-CD 3.35Å
14	R	46.6	Very low	49.5	Very low	230 Å²	230	120 Å²	120	87%	0.868	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-57.6	120.3	170	-158.6	-179.2	-166.7	-169.9	2.8	105.6	L12 D16	L12-R14 PolarHBondContact O-N 3.42Å; L12-R14 VanDerWaalsContact O-N 3.08Å; R14-D16 PolarHBondContact O-N 3.38Å; R14-D16 VanDerWaalsContact O-N 3.12Å
15	P	50.1	Low	49.2	Very low	116 Å²	116	120.8 Å²	120.8	75%	0.753	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-61.8	124	179.9	21.8	-27.1	0	0	0	107.3	A13	A13-P15 WeakPolarHBondContact O-CD 3.35Å
16	D	48.1	Very low	48.7	Very low	140 Å²	140	119.5 Å²	119.5	75%	0.749	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-50.2	140.1	166.1	-70.9	-44.3	0	0	0	107.9	R14 I18	R14-D16 PolarHBondContact O-N 3.38Å; R14-D16 VanDerWaalsContact O-N 3.12Å; D16-I18 VanDerWaalsContact C-N 3.33Å; D16-I18 PolarHBondContact O-N 2.96Å
17	P	42.9	Very low	47.7	Very low	117 Å²	117	117.2 Å²	117.2	76%	0.76	73%	0.725	S	S	*	*			trans	-61.8	101.6	176.1	25	-30.8	0	0	0	107.9	V19	P17-V19 VanDerWaalsContact C-N 3.28Å; P17-V19 PolarHBondContact O-N 3.04Å
18	I	48.1	Very low	47.5	Very low	156 Å²	156	122.3 Å²	122.3	80%	0.8	74%	0.739	S	S	*	*			trans	-62.3	100.1	164.8	-64.1	169.3	0	0	0	104.5	D16 G20	D16-I18 VanDerWaalsContact C-N 3.33Å; D16-I18 PolarHBondContact O-N 2.96Å; I18-G20 PolarHBondContact O-N 3.44Å
19	V	42.4	Very low	46.8	Very low	146 Å²	146	127.5 Å²	127.5	89%	0.885	75%	0.75	S	S	*	*			trans	-68.8	69.7	155.3	-175.3	0	0	0	0	105.3	P17	P17-V19 VanDerWaalsContact C-N 3.28Å; P17-V19 PolarHBondContact O-N 3.04Å
20	G	41.2	Very low	47	Very low	45 Å²	45	126.5 Å²	126.5	46%	0.464	76%	0.757	S	S	.	*			trans	-86.5	132.5	168.8	0	0	0	0	0	105.9	I18 A22	I18-G20 PolarHBondContact O-N 3.44Å; G20-A22 PolarHBondContact O-N 2.89Å
21	D	45.6	Very low	47.4	Very low	159 Å²	159	125.9 Å²	125.9	85%	0.85	76%	0.762	S	S	*	*			trans	-36.3	127.5	177.7	-70.3	-52.9	0	0	0	111.4
22	A	47.5	Very low	47.6	Very low	80 Å²	80	127.8 Å²	127.8	66%	0.661	77%	0.767	S	S	*	*			trans	-46.1	138.1	173.4	0	0	0	0	0	108.7	G20 T24	G20-A22 PolarHBondContact O-N 2.89Å; A22-T24 PolarHBondContact O-N 3.25Å
23	P	45.1	Very low	48.2	Very low	127 Å²	127	123.9 Å²	123.9	83%	0.825	75%	0.75	S	S	*	*			trans	-53.8	111.4	-176.7	21.8	-31.8	0	0	0	108.1	S25	P23-S25 PolarHBondContact O-N 3.47Å
24	T	42.6	Very low	48.8	Very low	134 Å²	134	124.2 Å²	124.2	82%	0.822	74%	0.74	S	S	*	*			trans	-54.7	118.4	174.2	46	0	0	0	0	106.4	A22	A22-T24 PolarHBondContact O-N 3.25Å
25	S	46	Very low	49.8	Very low	90 Å²	90	120.6 Å²	120.6	63%	0.629	73%	0.73	S	S	*	*			trans	-16.9	141.7	174.6	-170.9	0	0	0	0	114.5	P23 A27	P23-S25 PolarHBondContact O-N 3.47Å; S25-A27 PolarHBondContact O-N 2.93Å
26	P	46.3	Very low	50.8	Low	106 Å²	106	118.7 Å²	118.7	69%	0.688	72%	0.72	S	S	*	*			trans	-68.8	68	170.7	32.4	-34.3	0	0	0	110.1	N28 R29	P26-N28 PolarHBondContact O-N 3.48Å; P26-N28 VanDerWaalsContact O-N 3.15Å; P26-R29 PolarHBondContact O-N 3.07Å
27	A	47.3	Very low	52	Low	93 Å²	93	114.1 Å²	114.1	77%	0.769	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	7.3	177.6	0	0	0	0	0	112.1	S25	S25-A27 PolarHBondContact O-N 2.93Å
28	N	44.5	Very low	53.8	Low	161 Å²	161	112 Å²	112	86%	0.861	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.9	26.1	176.9	-134.7	10.2	0	0	0	112.4	P26 A30	P26-N28 PolarHBondContact O-N 3.48Å; P26-N28 VanDerWaalsContact O-N 3.15Å; N28-A30 PolarHBondContact O-N 3.27Å; N28-A30 VanDerWaalsContact O-N 3.09Å
29	R	42.8	Very low	55.4	Low	222 Å²	222	109.2 Å²	109.2	84%	0.838	67%	0.667	S	S	*	*			trans	-68.5	104.5	157.8	-102.8	-177.1	175.6	175.7	-0.7	106.4	P26 A31	P26-R29 PolarHBondContact O-N 3.07Å; R29-A31 PolarHBondContact O-N 3.4Å
30	A	53.6	Low	57.4	Low	87 Å²	87	105.6 Å²	105.6	72%	0.719	65%	0.646	S	S	*	*			trans	-39.1	132.5	166.3	0	0	0	0	0	108.9	N28	N28-A30 PolarHBondContact O-N 3.27Å; N28-A30 VanDerWaalsContact O-N 3.09Å
31	A	58.9	Low	59.4	Low	82 Å²	82	109.7 Å²	109.7	68%	0.678	65%	0.651	S	S	*	*			trans	-46.8	134.4	177.4	0	0	0	0	0	108.3	R29 T33	R29-A31 PolarHBondContact O-N 3.4Å; A31-T33 PolarHBondContact O-N 3.48Å
32	P	59.1	Low	61.4	Low	126 Å²	126	107.6 Å²	107.6	82%	0.818	63%	0.634	S	S	*	*			trans	-54.6	110.6	-179.8	21.1	-30.3	0	0	0	107.6	D34	P32-D34 PolarHBondContact O-N 2.87Å; P32-D34 VanDerWaalsContact O-N 3.11Å
33	T	60.6	Low	63.3	Low	95 Å²	95	109 Å²	109	58%	0.583	63%	0.627	S	S	*	*			trans	-53.8	123.2	175.8	-55.8	0	0	0	0	106.3	A31 F35	A31-T33 PolarHBondContact O-N 3.48Å; T33-F35 HydrophobicContact CG2-CD1 4.35Å; T33-F35 HydrophobicContact CG2-CD2 4.17Å; T33-F35 HydrophobicContact CG2-CE1 4.11Å; T33-F35 HydrophobicContact CG2-CE2 3.94Å; T33-F35 HydrophobicContact CG2-CG 4.37Å; T33-F35 HydrophobicContact CG2-CZ 3.9Å; T33-F35 WeakPolarHBondContact O-CD2 3.48Å; T33-F35 PolarHBondContact O-N 3.38Å
34	D	65.8	Low	65.2	Low	96 Å²	96	106.9 Å²	106.9	51%	0.513	61%	0.609	S	S	.	*			trans	-73.3	66.3	-177.2	-170.8	1.7	0	0	0	110.5	P32 S36 S37	P32-D34 PolarHBondContact O-N 2.87Å; P32-D34 VanDerWaalsContact O-N 3.11Å; D34-S36 PolarHBondContact O-N 3.23Å; D34-S36 PolarHBondContact OD1-OG 2.95Å; D34-S37 PolarHBondContact O-N 2.75Å; D34-S37 PolarHBondContact O-OG 3.47Å; D34-S37 PolarHBondContact OD1-N 2.96Å; D34-S37 WeakPolarHBondContact OD2-CB 3.43Å; D34-S37 PolarHBondContact OD2-OG 3.43Å
35	F	66.4	Low	67.5	Low	154 Å²	154	105 Å²	105	68%	0.675	59%	0.593	S	S	*	*	H	α-helix	trans	-59.2	-24.1	175.1	-72.2	-71.6	0	0	0	111.6	T33 L39	T33-F35 HydrophobicContact CG2-CD1 4.35Å; T33-F35 HydrophobicContact CG2-CD2 4.17Å; T33-F35 HydrophobicContact CG2-CE1 4.11Å; T33-F35 HydrophobicContact CG2-CE2 3.94Å; T33-F35 HydrophobicContact CG2-CG 4.37Å; T33-F35 HydrophobicContact CG2-CZ 3.9Å; T33-F35 WeakPolarHBondContact O-CD2 3.48Å; T33-F35 PolarHBondContact O-N 3.38Å; F35-L39 VanDerWaalsContact O-CB 3.24Å; F35-L39 WeakPolarHBondContact O-CB 3.39Å; F35-L39 PolarHBondContact O-N 2.97Å
36	S	71.6	Confident	69.5	Low	77 Å²	77	105.5 Å²	105.5	54%	0.538	59%	0.588	S	S	.	*	H	α-helix	trans	-65.5	-46.6	-179.9	80.1	0	0	0	0	111	D34 D38 L39 T40	D34-S36 PolarHBondContact O-N 3.23Å; D34-S36 PolarHBondContact OD1-OG 2.95Å; S36-D38 PolarHBondContact O-N 3.09Å; S36-L39 PolarHBondContact O-N 3.13Å; S36-T40 WeakPolarHBondContact O-CB 3.32Å; S36-T40 PolarHBondContact O-N 2.78Å; S36-T40 PolarHBondContact O-OG1 3.49Å
37	S	74.7	Confident	71.7	Confident	43 Å²	43	105.7 Å²	105.7	30%	0.301	58%	0.583	S	S	.	*	H	α-helix	trans	-64.5	-40.3	-179.7	73.6	0	0	0	0	112.8	D34 K41	D34-S37 PolarHBondContact O-N 2.75Å; D34-S37 PolarHBondContact O-OG 3.47Å; D34-S37 PolarHBondContact OD1-N 2.96Å; D34-S37 WeakPolarHBondContact OD2-CB 3.43Å; D34-S37 PolarHBondContact OD2-OG 3.43Å; S37-K41 VanDerWaalsContact O-CG 3.27Å; S37-K41 WeakPolarHBondContact O-CG 3.47Å; S37-K41 PolarHBondContact O-N 3.43Å
38	D	78.9	Confident	73.6	Confident	72 Å²	72	108 Å²	108	39%	0.385	58%	0.576	S	S	.	*	H	α-helix	trans	-69.8	-41.3	178.2	-172.3	57.8	0	0	0	111.5	S36 K41 K42	S36-D38 PolarHBondContact O-N 3.09Å; D38-K41 PolarHBondContact O-N 3.18Å; D38-K42 WeakPolarHBondContact O-CG 3.49Å; D38-K42 PolarHBondContact O-N 2.98Å; D38-K42 IonicContact OD1-NZ 3.98Å; D38-K42 VanDerWaalsContact OD2-CE 3.23Å; D38-K42 WeakPolarHBondContact OD2-CE 3.42Å; D38-K42 IonicContact OD2-NZ 2.68Å; D38-K42 PolarHBondContact OD2-NZ 2.97Å
39	L	82.9	Confident	75.7	Confident	98 Å²	98	105.6 Å²	105.6	51%	0.513	56%	0.559	S	S	.	*	H	α-helix	trans	-63	-45.8	175.8	-177.9	61.1	0	0	0	111.4	F35 S36 K41 K42 Q43	F35-L39 VanDerWaalsContact O-CB 3.24Å; F35-L39 WeakPolarHBondContact O-CB 3.39Å; F35-L39 PolarHBondContact O-N 2.97Å; S36-L39 PolarHBondContact O-N 3.13Å; L39-K41 VanDerWaalsContact C-N 3.34Å; L39-K41 PolarHBondContact O-N 2.94Å; L39-K42 PolarHBondContact O-N 2.7Å; L39-Q43 HydrophobicContact CD1-CG 4.38Å; L39-Q43 WeakPolarHBondContact O-CB 3.41Å; L39-Q43 VanDerWaalsContact O-CG 3.31Å; L39-Q43 WeakPolarHBondContact O-CG 3.49Å; L39-Q43 PolarHBondContact O-N 3.42Å
40	T	83.4	Confident	78	Confident	70 Å²	70	98.5 Å²	98.5	43%	0.429	54%	0.54	S	S	.	.	H	α-helix	trans	-62.3	-41	177.7	-59.2	0	0	0	0	111.7	S36 Q43 N44	S36-T40 WeakPolarHBondContact O-CB 3.32Å; S36-T40 PolarHBondContact O-N 2.78Å; S36-T40 PolarHBondContact O-OG1 3.49Å; T40-Q43 PolarHBondContact O-N 3.39Å; T40-N44 WeakPolarHBondContact O-CB 3.38Å; T40-N44 PolarHBondContact O-N 2.99Å
41	K	84.6	Confident	79.7	Confident	132 Å²	132	97.5 Å²	97.5	57%	0.574	53%	0.525	S	S	*	.	H	α-helix	trans	-60.9	-47.3	175	-75.5	171	-174.7	173.6	0	111.7	S37 D38 L39 Q43 N44 I45	S37-K41 VanDerWaalsContact O-CG 3.27Å; S37-K41 WeakPolarHBondContact O-CG 3.47Å; S37-K41 PolarHBondContact O-N 3.43Å; D38-K41 PolarHBondContact O-N 3.18Å; L39-K41 VanDerWaalsContact C-N 3.34Å; L39-K41 PolarHBondContact O-N 2.94Å; K41-Q43 PolarHBondContact O-N 3.4Å; K41-N44 PolarHBondContact O-N 3.27Å; K41-I45 WeakPolarHBondContact O-CG1 3.43Å; K41-I45 PolarHBondContact O-N 2.92Å
42	K	85.9	Confident	81.3	Confident	114 Å²	114	98.2 Å²	98.2	50%	0.496	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-41.8	178.2	-74.4	171.1	176.1	165.2	0	112.3	D38 L39 I45 L46	D38-K42 WeakPolarHBondContact O-CG 3.49Å; D38-K42 PolarHBondContact O-N 2.98Å; D38-K42 IonicContact OD1-NZ 3.98Å; D38-K42 VanDerWaalsContact OD2-CE 3.23Å; D38-K42 WeakPolarHBondContact OD2-CE 3.42Å; D38-K42 IonicContact OD2-NZ 2.68Å; D38-K42 PolarHBondContact OD2-NZ 2.97Å; L39-K42 PolarHBondContact O-N 2.7Å; K42-I45 PolarHBondContact O-N 3.48Å; K42-L46 WeakPolarHBondContact O-CG 3.46Å; K42-L46 PolarHBondContact O-N 2.92Å
43	Q	87.4	Confident	82.9	Confident	109 Å²	109	95.7 Å²	95.7	51%	0.509	50%	0.503	S	S	.	.	H	α-helix	trans	-62.6	-41.6	175.7	-74.1	174.1	-25.7	0	0	111.9	L39 T40 K41 L46 L47	L39-Q43 HydrophobicContact CD1-CG 4.38Å; L39-Q43 WeakPolarHBondContact O-CB 3.41Å; L39-Q43 VanDerWaalsContact O-CG 3.31Å; L39-Q43 WeakPolarHBondContact O-CG 3.49Å; L39-Q43 PolarHBondContact O-N 3.42Å; T40-Q43 PolarHBondContact O-N 3.39Å; K41-Q43 PolarHBondContact O-N 3.4Å; Q43-L46 PolarHBondContact O-N 3.05Å; Q43-L47 WeakPolarHBondContact O-CB 3.24Å; Q43-L47 PolarHBondContact O-N 3.29Å
44	N	86.1	Confident	84.4	Confident	83 Å²	83	100.1 Å²	100.1	44%	0.444	51%	0.509	S	S	.	.	H	α-helix	trans	-64.4	-43.6	176.6	-75.9	-12.9	0	0	0	112	T40 K41 L46 L47 F48	T40-N44 WeakPolarHBondContact O-CB 3.38Å; T40-N44 PolarHBondContact O-N 2.99Å; K41-N44 PolarHBondContact O-N 3.27Å; N44-L46 PolarHBondContact O-N 3.39Å; N44-L47 PolarHBondContact O-N 3Å; N44-F48 WeakPolarHBondContact O-CD2 3.41Å; N44-F48 PolarHBondContact O-N 3.42Å
45	I	89.9	Confident	85.7	Confident	96 Å²	96	99.8 Å²	99.8	49%	0.492	51%	0.51	S	S	.	.	H	α-helix	trans	-58.4	-49.8	176.4	-67.1	166	0	0	0	110.4	K41 K42 L47 F48 E49	K41-I45 WeakPolarHBondContact O-CG1 3.43Å; K41-I45 PolarHBondContact O-N 2.92Å; K42-I45 PolarHBondContact O-N 3.48Å; I45-L47 VanDerWaalsContact C-N 3.28Å; I45-L47 PolarHBondContact O-N 3.26Å; I45-F48 PolarHBondContact O-N 3.32Å; I45-E49 PolarHBondContact O-N 3Å
46	L	89.7	Confident	86.9	Confident	100 Å²	100	98.2 Å²	98.2	52%	0.524	51%	0.508	S	S	.	.	H	α-helix	trans	-59.1	-39.3	177.7	-74.9	165.5	0	0	0	112.2	K42 Q43 N44 E49 V50	K42-L46 WeakPolarHBondContact O-CG 3.46Å; K42-L46 PolarHBondContact O-N 2.92Å; Q43-L46 PolarHBondContact O-N 3.05Å; N44-L46 PolarHBondContact O-N 3.39Å; L46-E49 PolarHBondContact O-N 3.45Å; L46-V50 WeakPolarHBondContact O-CB 3.45Å; L46-V50 VanDerWaalsContact O-CG2 3.24Å; L46-V50 WeakPolarHBondContact O-CG2 3.48Å; L46-V50 PolarHBondContact O-N 3.24Å
47	L	91.3	Very high	88	Confident	110 Å²	110	99 Å²	99	58%	0.576	51%	0.506	S	S	*	.	H	α-helix	trans	-64.9	-41	178.4	-174	63.8	0	0	0	111.9	Q43 N44 I45 T51	Q43-L47 WeakPolarHBondContact O-CB 3.24Å; Q43-L47 PolarHBondContact O-N 3.29Å; N44-L47 PolarHBondContact O-N 3Å; I45-L47 VanDerWaalsContact C-N 3.28Å; I45-L47 PolarHBondContact O-N 3.26Å; L47-T51 WeakPolarHBondContact O-CB 3.35Å; L47-T51 PolarHBondContact O-N 3.38Å; L47-T51 PolarHBondContact O-OG1 3.4Å
48	F	88.3	Confident	89	Confident	142 Å²	142	98.9 Å²	98.9	62%	0.623	51%	0.511	S	S	*	.	H	α-helix	trans	-62.8	-48.5	173.9	-79.7	-67.9	0	0	0	111.5	N44 I45 V50 T51 D52	N44-F48 WeakPolarHBondContact O-CD2 3.41Å; N44-F48 PolarHBondContact O-N 3.42Å; I45-F48 PolarHBondContact O-N 3.32Å; F48-V50 VanDerWaalsContact C-N 3.34Å; F48-V50 PolarHBondContact O-N 3.29Å; F48-T51 WeakPolarHBondContact O-CB 3.36Å; F48-T51 PolarHBondContact O-N 3.04Å; F48-D52 PolarHBondContact O-N 2.96Å
49	E	88.2	Confident	89.7	Confident	109 Å²	109	99 Å²	99	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-42	178.9	-71.2	177.1	177.5	0	0	112.6	I45 L46 T51 S53	I45-E49 PolarHBondContact O-N 3Å; L46-E49 PolarHBondContact O-N 3.45Å; E49-T51 VanDerWaalsContact C-N 3.32Å; E49-T51 PolarHBondContact O-N 2.89Å; E49-S53 VanDerWaalsContact O-CB 3.3Å; E49-S53 WeakPolarHBondContact O-CB 3.31Å; E49-S53 PolarHBondContact O-N 3.15Å; E49-S53 PolarHBondContact O-OG 2.91Å
50	V	90.3	Very high	90.4	Very high	73 Å²	73	99.4 Å²	99.4	44%	0.442	52%	0.52	S	S	.	.	H	α-helix	trans	-65.2	-38.2	175.3	171.5	0	0	0	0	111.2	L46 F48 R54	L46-V50 WeakPolarHBondContact O-CB 3.45Å; L46-V50 VanDerWaalsContact O-CG2 3.24Å; L46-V50 WeakPolarHBondContact O-CG2 3.48Å; L46-V50 PolarHBondContact O-N 3.24Å; F48-V50 VanDerWaalsContact C-N 3.34Å; F48-V50 PolarHBondContact O-N 3.29Å; V50-R54 WeakPolarHBondContact O-CG 3.14Å; V50-R54 PolarHBondContact O-N 3.11Å
51	T	90.6	Very high	91	Very high	67 Å²	67	101.8 Å²	101.8	41%	0.411	52%	0.524	S	S	.	.	H	α-helix	trans	-67.5	-48.1	179.6	-58.9	0	0	0	0	110.5	L47 F48 E49 S53 R54 V55	L47-T51 WeakPolarHBondContact O-CB 3.35Å; L47-T51 PolarHBondContact O-N 3.38Å; L47-T51 PolarHBondContact O-OG1 3.4Å; F48-T51 WeakPolarHBondContact O-CB 3.36Å; F48-T51 PolarHBondContact O-N 3.04Å; E49-T51 VanDerWaalsContact C-N 3.32Å; E49-T51 PolarHBondContact O-N 2.89Å; T51-S53 VanDerWaalsContact C-N 3.32Å; T51-S53 PolarHBondContact O-N 2.95Å; T51-R54 WeakPolarHBondContact O-CB 3.35Å; T51-R54 PolarHBondContact O-N 3.02Å; T51-R54 VanDerWaalsContact O-N 3.11Å; T51-V55 WeakPolarHBondContact O-CG2 3.47Å; T51-V55 PolarHBondContact O-N 3Å
52	D	90.9	Very high	91.6	Very high	96 Å²	96	97.9 Å²	97.9	51%	0.513	52%	0.516	S	S	.	.	H	α-helix	trans	-60.7	-42.5	177	-72.2	-11.6	0	0	0	111.3	F48 R54 V55 L56	F48-D52 PolarHBondContact O-N 2.96Å; D52-R54 VanDerWaalsContact C-N 3.31Å; D52-R54 PolarHBondContact O-N 3.45Å; D52-V55 PolarHBondContact O-N 3.46Å; D52-L56 WeakPolarHBondContact O-CB 3.33Å; D52-L56 VanDerWaalsContact O-CG 3.31Å; D52-L56 WeakPolarHBondContact O-CG 3.49Å; D52-L56 PolarHBondContact O-N 3.06Å
53	S	92.7	Very high	92.1	Very high	73 Å²	73	95.5 Å²	95.5	51%	0.51	51%	0.509	S	S	.	.	H	α-helix	trans	-60.8	-39.3	175.3	-61.6	0	0	0	0	112.3	E49 T51 L57	E49-S53 VanDerWaalsContact O-CB 3.3Å; E49-S53 WeakPolarHBondContact O-CB 3.31Å; E49-S53 PolarHBondContact O-N 3.15Å; E49-S53 PolarHBondContact O-OG 2.91Å; T51-S53 VanDerWaalsContact C-N 3.32Å; T51-S53 PolarHBondContact O-N 2.95Å; S53-L57 WeakPolarHBondContact O-CB 3.43Å; S53-L57 PolarHBondContact O-N 2.76Å
54	R	92.1	Very high	92.6	Very high	188 Å²	188	95.9 Å²	95.9	71%	0.709	51%	0.511	S	S	*	.	H	α-helix	trans	-68.6	-40.6	176.5	-76.7	178.6	-179.4	-145.2	1.3	112.1	V50 T51 D52 L57 G58	V50-R54 WeakPolarHBondContact O-CG 3.14Å; V50-R54 PolarHBondContact O-N 3.11Å; T51-R54 WeakPolarHBondContact O-CB 3.35Å; T51-R54 PolarHBondContact O-N 3.02Å; T51-R54 VanDerWaalsContact O-N 3.11Å; D52-R54 VanDerWaalsContact C-N 3.31Å; D52-R54 PolarHBondContact O-N 3.45Å; R54-L57 PolarHBondContact O-N 2.96Å; R54-G58 PolarHBondContact O-N 2.86Å
55	V	93.4	Very high	93.1	Very high	89 Å²	89	98.6 Å²	98.6	54%	0.539	52%	0.521	S	S	.	.	H	α-helix	trans	-61.6	-49.8	175.7	172.7	0	0	0	0	109.8	T51 D52 L57 G58 S59	T51-V55 WeakPolarHBondContact O-CG2 3.47Å; T51-V55 PolarHBondContact O-N 3Å; D52-V55 PolarHBondContact O-N 3.46Å; V55-L57 PolarHBondContact O-N 3.41Å; V55-G58 PolarHBondContact O-N 3.41Å; V55-G58 VanDerWaalsContact O-N 3.15Å; V55-S59 PolarHBondContact O-N 2.72Å; V55-S59 PolarHBondContact O-OG 2.96Å
56	L	92.8	Very high	93.4	Very high	122 Å²	122	98.6 Å²	98.6	64%	0.639	52%	0.522	S	S	*	.	H	α-helix	trans	-57.5	-46	177	-72.8	171.1	0	0	0	112.2	D52 G58 S59 L60	D52-L56 WeakPolarHBondContact O-CB 3.33Å; D52-L56 VanDerWaalsContact O-CG 3.31Å; D52-L56 WeakPolarHBondContact O-CG 3.49Å; D52-L56 PolarHBondContact O-N 3.06Å; L56-G58 VanDerWaalsContact C-N 3.32Å; L56-G58 PolarHBondContact O-N 3.36Å; L56-S59 PolarHBondContact O-N 3.01Å; L56-L60 WeakPolarHBondContact O-CB 3.3Å; L56-L60 PolarHBondContact O-N 3Å
57	L	93.5	Very high	93.7	Very high	94 Å²	94	98.7 Å²	98.7	49%	0.492	52%	0.518	S	S	.	.	H	α-helix	trans	-65.1	-37.4	178.2	-169.1	74.3	0	0	0	111.9	S53 R54 V55 L60 K61	S53-L57 WeakPolarHBondContact O-CB 3.43Å; S53-L57 PolarHBondContact O-N 2.76Å; R54-L57 PolarHBondContact O-N 2.96Å; V55-L57 PolarHBondContact O-N 3.41Å; L57-L60 PolarHBondContact O-N 3.38Å; L57-K61 WeakPolarHBondContact O-CG 3.49Å; L57-K61 PolarHBondContact O-N 3.18Å
58	G	95	Very high	94	Very high	39 Å²	39	98 Å²	98	40%	0.402	51%	0.514	S	S	.	.	H	α-helix	trans	-62	-46.7	174	0	0	0	0	0	112.1	R54 V55 L56 K61 A62	R54-G58 PolarHBondContact O-N 2.86Å; V55-G58 PolarHBondContact O-N 3.41Å; V55-G58 VanDerWaalsContact O-N 3.15Å; L56-G58 VanDerWaalsContact C-N 3.32Å; L56-G58 PolarHBondContact O-N 3.36Å; G58-K61 PolarHBondContact O-N 3.5Å; G58-A62 PolarHBondContact O-N 3.03Å
59	S	95.5	Very high	94.4	Very high	75 Å²	75	97.3 Å²	97.3	52%	0.524	51%	0.511	S	S	.	.	H	α-helix	trans	-62.4	-41.8	176.1	-62.2	0	0	0	0	112.4	V55 L56 A62 D63	V55-S59 PolarHBondContact O-N 2.72Å; V55-S59 PolarHBondContact O-OG 2.96Å; L56-S59 PolarHBondContact O-N 3.01Å; S59-A62 PolarHBondContact O-N 3.41Å; S59-D63 PolarHBondContact O-N 3.49Å
60	L	96.1	Very high	94.8	Very high	107 Å²	107	99 Å²	99	56%	0.56	51%	0.512	S	S	*	.	H	α-helix	trans	-62.1	-45.4	177.2	-176	66.6	0	0	0	111.7	L56 L57 A62 D63 E64	L56-L60 WeakPolarHBondContact O-CB 3.3Å; L56-L60 PolarHBondContact O-N 3Å; L57-L60 PolarHBondContact O-N 3.38Å; L60-A62 VanDerWaalsContact C-N 3.31Å; L60-A62 PolarHBondContact O-N 2.97Å; L60-D63 PolarHBondContact O-N 3.45Å; L60-E64 PolarHBondContact O-N 3.32Å
61	K	96.7	Very high	95.1	Very high	120 Å²	120	100.5 Å²	100.5	52%	0.522	52%	0.518	S	S	.	.	H	α-helix	trans	-61.3	-39.3	176.2	-75.5	178	179	-178	0	112.2	L57 G58 E64 Q65	L57-K61 WeakPolarHBondContact O-CG 3.49Å; L57-K61 PolarHBondContact O-N 3.18Å; G58-K61 PolarHBondContact O-N 3.5Å; K61-E64 PolarHBondContact O-N 3.04Å; K61-Q65 WeakPolarHBondContact O-CG 3.5Å; K61-Q65 PolarHBondContact O-N 3.47Å
62	A	96.5	Very high	95.4	Very high	49 Å²	49	101.2 Å²	101.2	41%	0.405	52%	0.523	S	S	.	.	H	α-helix	trans	-66.5	-41	177.3	0	0	0	0	0	112.1	G58 S59 L60 Q65 N66	G58-A62 PolarHBondContact O-N 3.03Å; S59-A62 PolarHBondContact O-N 3.41Å; L60-A62 VanDerWaalsContact C-N 3.31Å; L60-A62 PolarHBondContact O-N 2.97Å; A62-Q65 PolarHBondContact O-N 3.21Å; A62-N66 WeakPolarHBondContact O-CB 3.24Å; A62-N66 PolarHBondContact O-N 2.96Å; A62-N66 PolarHBondContact O-ND2 3.05Å
63	D	97.1	Very high	95.6	Very high	65 Å²	65	101 Å²	101	35%	0.348	52%	0.521	S	S	.	.	H	α-helix	trans	-62.6	-42.6	174.6	-177.1	59.2	0	0	0	111.8	S59 L60 N66 K67	S59-D63 PolarHBondContact O-N 3.49Å; L60-D63 PolarHBondContact O-N 3.45Å; D63-N66 PolarHBondContact O-N 3.26Å; D63-K67 WeakPolarHBondContact O-CG 3.5Å; D63-K67 PolarHBondContact O-N 3.33Å; D63-K67 VanDerWaalsContact OD2-CE 3.24Å; D63-K67 WeakPolarHBondContact OD2-CE 3.47Å; D63-K67 IonicContact OD2-NZ 2.7Å; D63-K67 PolarHBondContact OD2-NZ 3.36Å
64	E	97.7	Very high	95.7	Very high	117 Å²	117	105.1 Å²	105.1	55%	0.547	53%	0.526	S	S	.	.	H	α-helix	trans	-62.1	-45.7	176.2	-171.1	171.9	-156.6	0	0	111.9	L60 K61 N66 K67 I68	L60-E64 PolarHBondContact O-N 3.32Å; K61-E64 PolarHBondContact O-N 3.04Å; E64-N66 VanDerWaalsContact C-N 3.32Å; E64-N66 PolarHBondContact O-N 3Å; E64-K67 WeakPolarHBondContact O-CB 3.27Å; E64-K67 PolarHBondContact O-N 3.22Å; E64-I68 HydrophobicContact CG-CD1 4.24Å; E64-I68 WeakPolarHBondContact O-CG1 3.36Å; E64-I68 PolarHBondContact O-N 2.92Å
65	Q	96.4	Very high	95.9	Very high	140 Å²	140	100 Å²	100	65%	0.654	52%	0.516	S	S	*	.	H	α-helix	trans	-61.6	-39.2	174.8	-74.1	-168.1	0.6	0	0	112.5	K61 A62 K67 I68 K69	K61-Q65 WeakPolarHBondContact O-CG 3.5Å; K61-Q65 PolarHBondContact O-N 3.47Å; A62-Q65 PolarHBondContact O-N 3.21Å; Q65-K67 VanDerWaalsContact C-N 3.34Å; Q65-K67 PolarHBondContact O-N 3.44Å; Q65-I68 PolarHBondContact O-N 3.28Å; Q65-K69 WeakPolarHBondContact O-CB 3.48Å; Q65-K69 PolarHBondContact O-N 3.45Å
66	N	96.3	Very high	96	Very high	96 Å²	96	98.6 Å²	98.6	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-66.2	-34.4	176	-78.5	-22.8	0	0	0	112.6	A62 D63 E64 R70	A62-N66 WeakPolarHBondContact O-CB 3.24Å; A62-N66 PolarHBondContact O-N 2.96Å; A62-N66 PolarHBondContact O-ND2 3.05Å; D63-N66 PolarHBondContact O-N 3.26Å; E64-N66 VanDerWaalsContact C-N 3.32Å; E64-N66 PolarHBondContact O-N 3Å; N66-R70 WeakPolarHBondContact O-CG 3.42Å; N66-R70 PolarHBondContact O-N 2.91Å; N66-R70 VanDerWaalsContact O-N 3.13Å; N66-R70 PolarHBondContact O-NE 2.64Å
67	K	96.9	Very high	96.1	Very high	101 Å²	101	98.9 Å²	98.9	44%	0.439	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-51.9	171.7	-76	167.5	175.3	157.6	0	111.1	D63 E64 Q65 K69 R70 D71	D63-K67 WeakPolarHBondContact O-CG 3.5Å; D63-K67 PolarHBondContact O-N 3.33Å; D63-K67 VanDerWaalsContact OD2-CE 3.24Å; D63-K67 WeakPolarHBondContact OD2-CE 3.47Å; D63-K67 IonicContact OD2-NZ 2.7Å; D63-K67 PolarHBondContact OD2-NZ 3.36Å; E64-K67 WeakPolarHBondContact O-CB 3.27Å; E64-K67 PolarHBondContact O-N 3.22Å; Q65-K67 VanDerWaalsContact C-N 3.34Å; Q65-K67 PolarHBondContact O-N 3.44Å; K67-K69 VanDerWaalsContact C-N 3.27Å; K67-K69 PolarHBondContact O-N 3.38Å; K67-R70 PolarHBondContact O-N 3.49Å; K67-R70 VanDerWaalsContact O-N 3.09Å; K67-D71 PolarHBondContact O-N 2.96Å
68	I	96.6	Very high	96.2	Very high	96 Å²	96	99.9 Å²	99.9	49%	0.492	51%	0.513	S	S	.	.	H	α-helix	trans	-56.3	-43.5	178.7	-66.2	165	0	0	0	111.2	E64 Q65 D71 T72	E64-I68 HydrophobicContact CG-CD1 4.24Å; E64-I68 WeakPolarHBondContact O-CG1 3.36Å; E64-I68 PolarHBondContact O-N 2.92Å; Q65-I68 PolarHBondContact O-N 3.28Å; I68-D71 PolarHBondContact O-N 3Å; I68-T72 WeakPolarHBondContact O-CB 3.31Å; I68-T72 PolarHBondContact O-N 3.21Å; I68-T72 PolarHBondContact O-OG1 3Å
69	K	96.7	Very high	96.2	Very high	128 Å²	128	104.3 Å²	104.3	56%	0.557	53%	0.528	S	S	*	.	H	α-helix	trans	-61	-47.6	177.6	-171	-174.2	174.9	-163	0	111.5	Q65 K67 D71 T72 D73	Q65-K69 WeakPolarHBondContact O-CB 3.48Å; Q65-K69 PolarHBondContact O-N 3.45Å; K67-K69 VanDerWaalsContact C-N 3.27Å; K67-K69 PolarHBondContact O-N 3.38Å; K69-D71 VanDerWaalsContact C-N 3.33Å; K69-D71 PolarHBondContact O-N 2.72Å; K69-T72 WeakPolarHBondContact O-CB 3.4Å; K69-T72 PolarHBondContact O-N 2.68Å; K69-D73 WeakPolarHBondContact O-CB 3.24Å; K69-D73 VanDerWaalsContact O-CG 3.26Å; K69-D73 PolarHBondContact O-N 3.3Å
70	R	96.6	Very high	95.6	Very high	143 Å²	143	108.8 Å²	108.8	54%	0.54	55%	0.552	S	S	.	*	H	α-helix	trans	-59.9	-42.8	177.6	-76.8	-176.4	-66.5	-170.3	-2.8	112.3	N66 K67 T72 D73 W74	N66-R70 WeakPolarHBondContact O-CG 3.42Å; N66-R70 PolarHBondContact O-N 2.91Å; N66-R70 VanDerWaalsContact O-N 3.13Å; N66-R70 PolarHBondContact O-NE 2.64Å; K67-R70 PolarHBondContact O-N 3.49Å; K67-R70 VanDerWaalsContact O-N 3.09Å; R70-T72 VanDerWaalsContact C-N 3.31Å; R70-T72 PolarHBondContact O-N 2.83Å; R70-D73 PolarHBondContact O-N 3.09Å; R70-W74 WeakPolarHBondContact O-CB 3.23Å; R70-W74 PolarHBondContact O-N 2.65Å
71	D	96.3	Very high	95.6	Very high	106 Å²	106	108.9 Å²	108.9	57%	0.567	55%	0.552	S	S	*	*	H	α-helix	trans	-66.2	-37.4	179.3	-66.1	-14.2	0	0	0	111.2	K67 I68 K69 T75	K67-D71 PolarHBondContact O-N 2.96Å; I68-D71 PolarHBondContact O-N 3Å; K69-D71 VanDerWaalsContact C-N 3.33Å; K69-D71 PolarHBondContact O-N 2.72Å; D71-T75 WeakPolarHBondContact O-CB 3.14Å; D71-T75 PolarHBondContact O-N 3Å; D71-T75 PolarHBondContact O-OG1 3.26Å
72	T	96.4	Very high	95.5	Very high	82 Å²	82	108.3 Å²	108.3	50%	0.503	55%	0.553	S	S	.	*	H	α-helix	trans	-65.9	-48.3	175.4	-55.4	0	0	0	0	111.2	I68 K69 R70 W74 T75 A76	I68-T72 WeakPolarHBondContact O-CB 3.31Å; I68-T72 PolarHBondContact O-N 3.21Å; I68-T72 PolarHBondContact O-OG1 3Å; K69-T72 WeakPolarHBondContact O-CB 3.4Å; K69-T72 PolarHBondContact O-N 2.68Å; R70-T72 VanDerWaalsContact C-N 3.31Å; R70-T72 PolarHBondContact O-N 2.83Å; T72-W74 VanDerWaalsContact C-N 3.32Å; T72-W74 PolarHBondContact O-N 3.46Å; T72-T75 PolarHBondContact O-N 3.11Å; T72-A76 PolarHBondContact O-N 2.82Å
73	D	96.6	Very high	95.5	Very high	90 Å²	90	111.6 Å²	111.6	48%	0.481	56%	0.561	S	S	.	*	H	α-helix	trans	-61.7	-41.1	178.5	-69	-17	0	0	0	110.8	K69 R70 A76 F77	K69-D73 WeakPolarHBondContact O-CB 3.24Å; K69-D73 VanDerWaalsContact O-CG 3.26Å; K69-D73 PolarHBondContact O-N 3.3Å; R70-D73 PolarHBondContact O-N 3.09Å; D73-A76 PolarHBondContact O-N 2.88Å; D73-F77 PolarHBondContact O-N 2.8Å
74	W	95.2	Very high	95.4	Very high	160 Å²	160	114.4 Å²	114.4	61%	0.606	57%	0.574	S	S	*	*	H	α-helix	trans	-63.3	-44.6	175.2	-178	-104.1	0	0	0	112.3	R70 T72 A76 F77 M78	R70-W74 WeakPolarHBondContact O-CB 3.23Å; R70-W74 PolarHBondContact O-N 2.65Å; T72-W74 VanDerWaalsContact C-N 3.32Å; T72-W74 PolarHBondContact O-N 3.46Å; W74-A76 VanDerWaalsContact C-N 3.3Å; W74-A76 PolarHBondContact O-N 2.77Å; W74-F77 HydrophobicContact CE3-CD1 4.36Å; W74-F77 HydrophobicContact CZ3-CD1 4.15Å; W74-F77 HydrophobicContact CZ3-CE1 4.41Å; W74-F77 PolarHBondContact O-N 3.22Å; W74-M78 HydrophobicContact CD2-CG 4.42Å; W74-M78 HydrophobicContact CH2-SD 4.29Å; W74-M78 HydrophobicContact CZ2-CG 4.24Å; W74-M78 HydrophobicContact CZ2-SD 3.74Å; W74-M78 WeakPolarHBondContact O-CG 3.47Å; W74-M78 PolarHBondContact O-N 3.15Å
75	T	96	Very high	95.2	Very high	81 Å²	81	114.2 Å²	114.2	50%	0.497	58%	0.576	S	S	.	*	H	α-helix	trans	-62.6	-39.6	177.8	-56.7	0	0	0	0	111.2	D71 T72 M78 N79	D71-T75 WeakPolarHBondContact O-CB 3.14Å; D71-T75 PolarHBondContact O-N 3Å; D71-T75 PolarHBondContact O-OG1 3.26Å; T72-T75 PolarHBondContact O-N 3.11Å; T75-M78 PolarHBondContact O-N 3.17Å; T75-N79 PolarHBondContact O-N 3.36Å; T75-N79 PolarHBondContact O-ND2 2.83Å; T75-N79 VanDerWaalsContact O-ND2 3.07Å
76	A	95.8	Very high	95.2	Very high	59 Å²	59	112.5 Å²	112.5	49%	0.488	57%	0.571	S	S	.	*	H	α-helix	trans	-63.6	-44.3	175.3	0	0	0	0	0	111.8	T72 D73 W74 M78 N79	T72-A76 PolarHBondContact O-N 2.82Å; D73-A76 PolarHBondContact O-N 2.88Å; W74-A76 VanDerWaalsContact C-N 3.3Å; W74-A76 PolarHBondContact O-N 2.77Å; A76-M78 VanDerWaalsContact C-N 3.34Å; A76-M78 PolarHBondContact O-N 3.12Å; A76-N79 PolarHBondContact O-N 3.08Å
77	F	95.2	Very high	95.1	Very high	129 Å²	129	113.6 Å²	113.6	57%	0.566	58%	0.575	S	S	*	*	H	α-helix	trans	-60.3	-40.4	177.5	174.5	-100	0	0	0	113	D73 W74 N79 T80	D73-F77 PolarHBondContact O-N 2.8Å; W74-F77 HydrophobicContact CE3-CD1 4.36Å; W74-F77 HydrophobicContact CZ3-CD1 4.15Å; W74-F77 HydrophobicContact CZ3-CE1 4.41Å; W74-F77 PolarHBondContact O-N 3.22Å; F77-N79 PolarHBondContact O-N 3.34Å; F77-T80 PolarHBondContact O-N 2.97Å; F77-T80 PolarHBondContact O-OG1 3.03Å
78	M	94.7	Very high	94.9	Very high	114 Å²	114	114.6 Å²	114.6	56%	0.562	59%	0.585	S	S	*	*	H	α-helix	trans	-71.8	-14.1	-179.6	-66	-64	-70.5	0	0	113.8	W74 T75 A76	W74-M78 HydrophobicContact CD2-CG 4.42Å; W74-M78 HydrophobicContact CH2-SD 4.29Å; W74-M78 HydrophobicContact CZ2-CG 4.24Å; W74-M78 HydrophobicContact CZ2-SD 3.74Å; W74-M78 WeakPolarHBondContact O-CG 3.47Å; W74-M78 PolarHBondContact O-N 3.15Å; T75-M78 PolarHBondContact O-N 3.17Å; A76-M78 VanDerWaalsContact C-N 3.34Å; A76-M78 PolarHBondContact O-N 3.12Å
79	N	93.9	Very high	94.8	Very high	133 Å²	133	116.2 Å²	116.2	71%	0.711	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	0.8	-179.6	-70.2	-32.2	0	0	0	113.7	T75 A76 F77	T75-N79 PolarHBondContact O-N 3.36Å; T75-N79 PolarHBondContact O-ND2 2.83Å; T75-N79 VanDerWaalsContact O-ND2 3.07Å; A76-N79 PolarHBondContact O-N 3.08Å; F77-N79 PolarHBondContact O-N 3.34Å
80	T	84.2	Confident	94.6	Very high	169 Å²	169	115.1 Å²	115.1	100%	1.037	60%	0.596	S	S	*	*			trans	-99.7	0	172.4	35	0	0	0	0	111.7	F77	F77-T80 PolarHBondContact O-N 2.97Å; F77-T80 PolarHBondContact O-OG1 3.03Å

Retrieved 80 of 80 residues in 41.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).