A0A077ZHI4_TRITR Loading...

YtfJ HI0045 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZHI4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 135 aa.

						>A0A077ZHI4_TRITR|A0A077ZHI4
MTLRKILALTCLLLPMMASAHQFETGQRVPPIGITDRGELVLDKDQFSYKTWNSAQLVGKVRVLQHIAGRTSAKEKNATLIEAIKSAKLPHDRYQTTTIVNTDDAIPGSGMFVRSSLETMASHAVPGSWMKKVPL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	72.2	Confident	91.1	Very high	195 Å²	195	119.9 Å²	119.9	96%	0.961	62%	0.623	S	S	*	*				0	-29.2	0	-64.7	-165.5	93.1	0	0	113.6	K5	M1-K5 PolarHBondContact O-N 3.42Å
2	T	87.7	Confident	91.2	Very high	108 Å²	108	120.9 Å²	120.9	66%	0.663	63%	0.628	S	S	*	*	H	α-helix	trans	-60.3	-43.7	-179.9	-2.3	0	0	0	0	113.1	R4 K5 I6	T2-R4 PolarHBondContact O-N 3.08Å; T2-K5 PolarHBondContact O-N 3.31Å; T2-I6 WeakPolarHBondContact O-CG1 3.43Å; T2-I6 PolarHBondContact O-N 3.34Å
3	L	92.4	Very high	91.3	Very high	140 Å²	140	118.2 Å²	118.2	73%	0.733	61%	0.614	S	S	*	*	H	α-helix	trans	-61.6	-44.6	-179.5	-173.6	63.1	0	0	0	113.5	K5 I6 L7	L3-K5 VanDerWaalsContact C-N 3.29Å; L3-K5 PolarHBondContact O-N 3.05Å; L3-I6 PolarHBondContact O-N 3.23Å; L3-L7 WeakPolarHBondContact O-CB 3.42Å; L3-L7 PolarHBondContact O-N 3.48Å
4	R	93.2	Very high	91.1	Very high	214 Å²	214	116.3 Å²	116.3	81%	0.808	61%	0.605	S	S	*	*	H	α-helix	trans	-62	-37.2	177	-174	177.7	175.3	-175.6	-0.9	112	T2 A8	T2-R4 PolarHBondContact O-N 3.08Å; R4-A8 WeakPolarHBondContact O-CB 3.33Å; R4-A8 PolarHBondContact O-N 3.3Å
5	K	93.4	Very high	90.8	Very high	148 Å²	148	114.6 Å²	114.6	64%	0.643	60%	0.604	S	S	*	*	H	α-helix	trans	-68.8	-42.4	176.5	-68.8	-179.1	178.7	-174.8	0	111.7	M1 T2 L3 A8 L9	M1-K5 PolarHBondContact O-N 3.42Å; T2-K5 PolarHBondContact O-N 3.31Å; L3-K5 VanDerWaalsContact C-N 3.29Å; L3-K5 PolarHBondContact O-N 3.05Å; K5-A8 PolarHBondContact O-N 3.11Å; K5-L9 WeakPolarHBondContact O-CB 3.34Å; K5-L9 PolarHBondContact O-N 2.94Å
6	I	93.7	Very high	90.4	Very high	97 Å²	97	117.1 Å²	117.1	50%	0.497	61%	0.613	S	S	.	*	H	α-helix	trans	-62.3	-48.2	175.3	-66.6	163.5	0	0	0	110.1	T2 L3 A8 L9 T10	T2-I6 WeakPolarHBondContact O-CG1 3.43Å; T2-I6 PolarHBondContact O-N 3.34Å; L3-I6 PolarHBondContact O-N 3.23Å; I6-A8 PolarHBondContact O-N 3.01Å; I6-L9 WeakPolarHBondContact O-CB 3.48Å; I6-L9 PolarHBondContact O-N 3.11Å; I6-L9 VanDerWaalsContact O-N 3.15Å; I6-T10 PolarHBondContact O-N 3.02Å; I6-T10 PolarHBondContact O-OG1 2.96Å
7	L	94.9	Very high	89.9	Confident	111 Å²	111	118.6 Å²	118.6	58%	0.581	62%	0.619	S	S	*	*	H	α-helix	trans	-60.1	-43.9	178.9	-176.3	64.9	0	0	0	112.3	L3 L9 T10 C11	L3-L7 WeakPolarHBondContact O-CB 3.42Å; L3-L7 PolarHBondContact O-N 3.48Å; L7-L9 VanDerWaalsContact C-N 3.33Å; L7-L9 PolarHBondContact O-N 3.32Å; L7-T10 PolarHBondContact O-N 3.13Å; L7-C11 PolarHBondContact O-N 3.28Å; L7-C11 PolarHBondContact O-SG 2.86Å
8	A	94.2	Very high	89.3	Confident	61 Å²	61	116.6 Å²	116.6	50%	0.504	62%	0.622	S	S	.	*	H	α-helix	trans	-62.1	-41.3	176	0	0	0	0	0	112	R4 K5 I6 C11 L12	R4-A8 WeakPolarHBondContact O-CB 3.33Å; R4-A8 PolarHBondContact O-N 3.3Å; K5-A8 PolarHBondContact O-N 3.11Å; I6-A8 PolarHBondContact O-N 3.01Å; A8-C11 PolarHBondContact O-N 3.01Å; A8-L12 WeakPolarHBondContact O-CB 3.32Å; A8-L12 PolarHBondContact O-N 3.06Å
9	L	94.2	Very high	88.5	Confident	100 Å²	100	116.3 Å²	116.3	52%	0.524	63%	0.63	S	S	.	*	H	α-helix	trans	-65.1	-40.9	175.9	-174.4	64	0	0	0	111.6	K5 I6 L7 L12 L13	K5-L9 WeakPolarHBondContact O-CB 3.34Å; K5-L9 PolarHBondContact O-N 2.94Å; I6-L9 WeakPolarHBondContact O-CB 3.48Å; I6-L9 PolarHBondContact O-N 3.11Å; I6-L9 VanDerWaalsContact O-N 3.15Å; L7-L9 VanDerWaalsContact C-N 3.33Å; L7-L9 PolarHBondContact O-N 3.32Å; L9-L12 PolarHBondContact O-N 3.05Å; L9-L13 HydrophobicContact CD1-CD1 4.48Å; L9-L13 HydrophobicContact CG-CD1 4.15Å; L9-L13 WeakPolarHBondContact O-CG 3.17Å; L9-L13 PolarHBondContact O-N 3.29Å; L9-L13 VanDerWaalsContact O-N 3.13Å
10	T	93.3	Very high	87.9	Confident	72 Å²	72	114.8 Å²	114.8	44%	0.442	64%	0.635	S	S	.	*	H	α-helix	trans	-61.6	-48	175.1	-53.3	0	0	0	0	111.3	I6 L7 L12 L13 L14	I6-T10 PolarHBondContact O-N 3.02Å; I6-T10 PolarHBondContact O-OG1 2.96Å; L7-T10 PolarHBondContact O-N 3.13Å; T10-L12 VanDerWaalsContact C-N 3.26Å; T10-L12 PolarHBondContact O-N 3.46Å; T10-L13 PolarHBondContact O-N 3.21Å; T10-L14 PolarHBondContact O-N 3.3Å; T10-L14 VanDerWaalsContact O-N 3.11Å
11	C	92.8	Very high	87.1	Confident	73 Å²	73	117.8 Å²	117.8	49%	0.493	64%	0.644	S	S	.	*	H	α-helix	trans	-59.8	-36.4	176.9	-72.4	0	0	0	0	112.7	L7 A8 L13 L14	L7-C11 PolarHBondContact O-N 3.28Å; L7-C11 PolarHBondContact O-SG 2.86Å; A8-C11 PolarHBondContact O-N 3.01Å; C11-L13 VanDerWaalsContact C-N 3.29Å; C11-L13 PolarHBondContact O-N 3.48Å; C11-L14 PolarHBondContact O-N 3.13Å
12	L	92.1	Very high	87.1	Confident	132 Å²	132	115.6 Å²	115.6	69%	0.691	63%	0.631	S	S	*	*	H	α-helix	trans	-66.7	-30.1	176.1	-172.4	66.9	0	0	0	112.6	A8 L9 T10 P15	A8-L12 WeakPolarHBondContact O-CB 3.32Å; A8-L12 PolarHBondContact O-N 3.06Å; L9-L12 PolarHBondContact O-N 3.05Å; T10-L12 VanDerWaalsContact C-N 3.26Å; T10-L12 PolarHBondContact O-N 3.46Å; L12-P15 VanDerWaalsContact O-CD 3.3Å; L12-P15 WeakPolarHBondContact O-CD 3.38Å
13	L	92.5	Very high	86.9	Confident	85 Å²	85	116.4 Å²	116.4	45%	0.445	63%	0.626	S	S	.	*	H	α-helix	trans	-87.2	-16.9	-179.3	-67.9	167.2	0	0	0	113.4	L9 T10 C11 P15 M16	L9-L13 HydrophobicContact CD1-CD1 4.48Å; L9-L13 HydrophobicContact CG-CD1 4.15Å; L9-L13 WeakPolarHBondContact O-CG 3.17Å; L9-L13 PolarHBondContact O-N 3.29Å; L9-L13 VanDerWaalsContact O-N 3.13Å; T10-L13 PolarHBondContact O-N 3.21Å; C11-L13 VanDerWaalsContact C-N 3.29Å; C11-L13 PolarHBondContact O-N 3.48Å; L13-P15 VanDerWaalsContact C-CD 3.41Å; L13-M16 HydrophobicContact CD2-SD 3.64Å; L13-M16 WeakPolarHBondContact O-CB 3.36Å; L13-M16 PolarHBondContact O-N 3.3Å
14	L	88.9	Confident	86.6	Confident	92 Å²	92	116.2 Å²	116.2	48%	0.482	62%	0.621	S	S	.	*	G	3₁₀ helix	trans	-52.7	-42.7	178.4	-72	175.4	0	0	0	114.3	T10 C11 M16 M17	T10-L14 PolarHBondContact O-N 3.3Å; T10-L14 VanDerWaalsContact O-N 3.11Å; C11-L14 PolarHBondContact O-N 3.13Å; L14-M16 PolarHBondContact O-N 3.15Å; L14-M16 VanDerWaalsContact O-N 3.13Å; L14-M17 HydrophobicContact CD2-CE 3.96Å; L14-M17 PolarHBondContact O-N 3.41Å
15	P	87.1	Confident	86.3	Confident	91 Å²	91	113.3 Å²	113.3	59%	0.591	63%	0.627	S	S	*	*	G	3₁₀ helix	trans	-61.7	-22.3	179.5	-21.7	33.7	0	0	0	113.5	L12 L13 M17 A18	L12-P15 VanDerWaalsContact O-CD 3.3Å; L12-P15 WeakPolarHBondContact O-CD 3.38Å; L13-P15 VanDerWaalsContact C-CD 3.41Å; P15-M17 PolarHBondContact O-N 3.25Å; P15-A18 VanDerWaalsContact O-CB 3.3Å; P15-A18 WeakPolarHBondContact O-CB 3.33Å; P15-A18 PolarHBondContact O-N 2.92Å; P15-A18 VanDerWaalsContact O-N 3.11Å
16	M	84.4	Confident	86	Confident	154 Å²	154	110 Å²	110	76%	0.759	64%	0.636	S	S	*	*	G	3₁₀ helix	trans	-69.8	-15.5	176.9	-58.4	-174.5	70.5	0	0	112.8	L13 L14 A18	L13-M16 HydrophobicContact CD2-SD 3.64Å; L13-M16 WeakPolarHBondContact O-CB 3.36Å; L13-M16 PolarHBondContact O-N 3.3Å; L14-M16 PolarHBondContact O-N 3.15Å; L14-M16 VanDerWaalsContact O-N 3.13Å; M16-A18 VanDerWaalsContact C-N 3.33Å
17	M	81.2	Confident	85.7	Confident	144 Å²	144	111.6 Å²	111.6	71%	0.709	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-86	-3.5	173	-59.8	-163.5	-125.4	0	0	113.1	L14 P15 S19	L14-M17 HydrophobicContact CD2-CE 3.96Å; L14-M17 PolarHBondContact O-N 3.41Å; P15-M17 PolarHBondContact O-N 3.25Å; M17-S19 PolarHBondContact O-N 3.19Å
18	A	79.3	Confident	85.2	Confident	82 Å²	82	115.9 Å²	115.9	68%	0.678	65%	0.649	S	S	*	*			trans	-70.7	96.2	176.7	0	0	0	0	0	110.1	P15 M16 A20	P15-A18 VanDerWaalsContact O-CB 3.3Å; P15-A18 WeakPolarHBondContact O-CB 3.33Å; P15-A18 PolarHBondContact O-N 2.92Å; P15-A18 VanDerWaalsContact O-N 3.11Å; M16-A18 VanDerWaalsContact C-N 3.33Å; A18-A20 PolarHBondContact O-N 3.16Å
19	S	74.6	Confident	84.8	Confident	110 Å²	110	115.3 Å²	115.3	77%	0.769	64%	0.639	S	S	*	*			trans	-71.1	109.3	167.1	-57.9	0	0	0	0	108.9	M17 H21	M17-S19 PolarHBondContact O-N 3.19Å; S19-H21 PolarHBondContact O-N 3.31Å
20	A	75.2	Confident	84.6	Confident	87 Å²	87	113 Å²	113	72%	0.719	63%	0.63	S	S	*	*			trans	-66.6	121.3	166	0	0	0	0	0	108.1	A18 Q22	A18-A20 PolarHBondContact O-N 3.16Å; A20-Q22 PolarHBondContact O-N 3.05Å
21	H	70.9	Confident	84.4	Confident	178 Å²	178	115.7 Å²	115.7	82%	0.824	65%	0.649	S	S	*	*			trans	-61.5	112.6	168.8	-75.8	-75.7	0	0	0	108.2	S19	S19-H21 PolarHBondContact O-N 3.31Å
22	Q	74.1	Confident	84.3	Confident	148 Å²	148	116.2 Å²	116.2	69%	0.692	65%	0.646	S	S	*	*	P	Polyproline II helix	trans	-92	146.3	177.7	-167.7	57.8	-108.2	0	0	109.5	A20 E24	A20-Q22 PolarHBondContact O-N 3.05Å; Q22-E24 PolarHBondContact O-N 3.39Å
23	F	82.2	Confident	84.3	Confident	126 Å²	126	112.3 Å²	112.3	55%	0.553	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-72.5	117.9	164.5	-70.2	-77.7	0	0	0	108.5	V29	F23-V29 HydrophobicContact CD1-CG1 4.25Å; F23-V29 HydrophobicContact CE1-CB 4.15Å; F23-V29 HydrophobicContact CE1-CG1 3.93Å
24	E	85.8	Confident	84.3	Confident	135 Å²	135	108.7 Å²	108.7	63%	0.631	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-87.5	127	171.9	-67.2	-175.6	-172.4	0	0	109.9	Q22 G26 Q27	Q22-E24 PolarHBondContact O-N 3.39Å; E24-G26 PolarHBondContact O-N 3.44Å; E24-Q27 HydrophobicContact CB-CB 3.88Å; E24-Q27 HydrophobicContact CB-CG 3.59Å; E24-Q27 PolarHBondContact O-N 2.81Å; E24-Q27 VanDerWaalsContact O-N 3.08Å; E24-Q27 WeakPolarHBondContact OE2-CG 3.22Å
25	T	88.3	Confident	84.3	Confident	153 Å²	153	109.7 Å²	109.7	94%	0.939	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.4	129.3	175.1	-56.9	0	0	0	0	110.1	Q27	T25-Q27 VanDerWaalsContact C-N 3.26Å; T25-Q27 PolarHBondContact O-N 3.01Å
26	G	86.8	Confident	84.3	Confident	80 Å²	80	109.8 Å²	109.8	83%	0.825	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	84.1	-9.5	-179	0	0	0	0	0	114.7	E24	E24-G26 PolarHBondContact O-N 3.44Å
27	Q	86.9	Confident	84.3	Confident	129 Å²	129	108.3 Å²	108.3	60%	0.603	61%	0.61	S	S	*	*	S	Bend	trans	-88.4	160.7	170.4	-64.6	-58.5	-40.2	0	0	111.6	E24 T25	E24-Q27 HydrophobicContact CB-CB 3.88Å; E24-Q27 HydrophobicContact CB-CG 3.59Å; E24-Q27 PolarHBondContact O-N 2.81Å; E24-Q27 VanDerWaalsContact O-N 3.08Å; E24-Q27 WeakPolarHBondContact OE2-CG 3.22Å; T25-Q27 VanDerWaalsContact C-N 3.26Å; T25-Q27 PolarHBondContact O-N 3.01Å
28	R	84.2	Confident	84.8	Confident	202 Å²	202	101.5 Å²	101.5	76%	0.762	58%	0.577	S	S	*	*	P	Polyproline II helix	trans	-66.8	145.5	170.7	-169.6	-175.7	-72.8	178.8	-2.1	109.2
29	V	86.9	Confident	85.4	Confident	49 Å²	49	97.9 Å²	97.9	30%	0.297	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-55	145.9	166.5	-64.2	0	0	0	0	110.9	F23 L57	F23-V29 HydrophobicContact CD1-CG1 4.25Å; F23-V29 HydrophobicContact CE1-CB 4.15Å; F23-V29 HydrophobicContact CE1-CG1 3.93Å; V29-L57 HydrophobicContact CG2-CD1 4.34Å
30	P	88.5	Confident	86.3	Confident	50 Å²	50	93.2 Å²	93.2	33%	0.325	51%	0.512	S	S	.	.	P	Polyproline II helix	trans	-53.9	140.7	175.3	-27.5	35.8	0	0	0	111.8	I32 S54	P30-I32 PolarHBondContact O-N 2.96Å; P30-S54 PolarHBondContact O-OG 2.7Å
31	P	89.7	Confident	87	Confident	129 Å²	129	90.7 Å²	90.7	84%	0.838	49%	0.488	S	S	*	.			trans	-69.1	99.8	179.5	28.7	-33.7	0	0	0	110.1	S54	P31-S54 WeakPolarHBondContact CA-OG 3.45Å
32	I	89.9	Confident	87.8	Confident	84 Å²	84	84.2 Å²	84.2	43%	0.431	46%	0.459	S	S	.	.			trans	-108.7	136.6	172.4	-59.5	170.1	0	0	0	108.8	P30 I34 N53 S54	P30-I32 PolarHBondContact O-N 2.96Å; I32-I34 HydrophobicContact CG2-CG1 4.46Å; I32-N53 CarbonylContact O-C 3.59Å; I32-N53 VanDerWaalsContact O-CA 3.3Å; I32-N53 WeakPolarHBondContact O-CA 3.3Å; I32-S54 PolarHBondContact N-OG 3.27Å; I32-S54 PolarHBondContact O-N 2.82Å; I32-S54 PolarHBondContact O-OG 3.17Å
33	G	92.8	Very high	88.4	Confident	51 Å²	51	81.7 Å²	81.7	53%	0.526	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	135.4	170.6	0	0	0	0	0	110.5	W52	G33-W52 CarbonylContact C-O 3.6Å; G33-W52 WeakPolarHBondContact CA-O 3.49Å
34	I	92.2	Very high	88.5	Confident	9 Å²	9	84 Å²	84	5%	0.046	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	104.9	176	-60.7	171	0	0	0	106.9	I32 D36 W52 I99 V133 L135	I32-I34 HydrophobicContact CG2-CG1 4.46Å; I34-D36 WeakPolarHBondContact CG2-O 3.43Å; I34-W52 HydrophobicContact CB-CE3 4.42Å; I34-W52 HydrophobicContact CD1-CE3 3.79Å; I34-W52 HydrophobicContact CD1-CZ3 4.02Å; I34-W52 HydrophobicContact CG1-CE3 4.09Å; I34-W52 HydrophobicContact CG1-CZ3 4.49Å; I34-W52 PolarHBondContact N-O 3.18Å; I34-W52 PolarHBondContact O-N 2.82Å; I34-I99 HydrophobicContact CD1-CD1 3.94Å; I34-I99 HydrophobicContact CD1-CG1 4.1Å; I34-I99 HydrophobicContact CD1-CG2 3.73Å; I34-V133 HydrophobicContact CB-CG1 4.08Å; I34-V133 HydrophobicContact CD1-CB 4.47Å; I34-V133 HydrophobicContact CD1-CG1 3.5Å; I34-V133 HydrophobicContact CG1-CG1 4.37Å; I34-V133 HydrophobicContact CG2-CG1 4Å; I34-L135 HydrophobicContact CB-CD2 4.12Å; I34-L135 HydrophobicContact CD1-CD2 3.39Å; I34-L135 HydrophobicContact CD1-CG 4.18Å; I34-L135 HydrophobicContact CG1-CD2 3.46Å; I34-L135 VanDerWaalsContact CG1-CD2 3.46Å; I34-L135 HydrophobicContact CG2-CD2 3.59Å
35	T	89.5	Confident	88.3	Confident	113 Å²	113	84.8 Å²	84.8	69%	0.693	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.3	-29.4	-178	52.1	0	0	0	0	112.5	R37 T51	T35-R37 PolarHBondContact O-N 3.5Å; T35-T51 HydrophobicContact CG2-CG2 3.84Å
36	D	86.9	Confident	88.3	Confident	92 Å²	92	84.4 Å²	84.4	49%	0.492	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	113.7	169.6	-167.6	3.2	0	0	0	108.5	I34 G38	I34-D36 WeakPolarHBondContact CG2-O 3.43Å; D36-G38 PolarHBondContact O-N 3.45Å
37	R	85.5	Confident	88.5	Confident	124 Å²	124	83.8 Å²	83.8	47%	0.468	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	55.5	-55	-171	-52.8	-59.5	173.5	164.4	-3.4	114.8	T35 Y49 K50 P134	T35-R37 PolarHBondContact O-N 3.5Å; R37-Y49 HydrophobicContact CB-CD1 3.83Å; R37-Y49 HydrophobicContact CB-CE1 4.36Å; R37-Y49 HydrophobicContact CB-CG 4.4Å; R37-Y49 WeakPolarHBondContact O-CB 3.25Å; R37-K50 CarbonylContact O-C 3.55Å; R37-K50 PolarHBondContact O-N 3.27Å; R37-P134 HydrophobicContact CB-CG 4.09Å
38	G	91.3	Very high	88.7	Confident	0 Å²	0	80.2 Å²	80.2	0%	0	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	74.6	-137.8	-179.6	0	0	0	0	0	111.3	D36 K50 V133 P134	D36-G38 PolarHBondContact O-N 3.45Å; G38-K50 CarbonylContact C-O 3.56Å; G38-K50 VanDerWaalsContact CA-O 3.23Å; G38-K50 WeakPolarHBondContact CA-O 3.38Å; G38-V133 CarbonylContact O-C 3.56Å; G38-V133 VanDerWaalsContact O-CA 3.28Å; G38-V133 WeakPolarHBondContact O-CA 3.3Å; G38-V133 VanDerWaalsContact O-CG1 3.3Å; G38-V133 WeakPolarHBondContact O-CG1 3.23Å; G38-P134 WeakPolarHBondContact O-CD 3.12Å
39	E	92.2	Very high	89.1	Confident	6 Å²	6	74 Å²	74	3%	0.028	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	130.4	-177.7	-172.7	-179.3	157.4	0	0	111.4	V41 Y49 K50 W52 K131 V133	E39-V41 HydrophobicContact CG-CG2 4.32Å; E39-V41 PolarHBondContact O-N 2.96Å; E39-Y49 WeakPolarHBondContact O-CA 3.45Å; E39-K50 HydrophobicContact CB-CG 4.02Å; E39-K50 VanDerWaalsContact CD-CE 3.43Å; E39-K50 PolarHBondContact N-O 2.86Å; E39-K50 PolarHBondContact O-N 2.94Å; E39-K50 VanDerWaalsContact O-N 3.09Å; E39-K50 IonicContact OE1-NZ 3.96Å; E39-K50 WeakPolarHBondContact OE2-CE 3.5Å; E39-K50 IonicContact OE2-NZ 3.48Å; E39-K50 PolarHBondContact OE2-NZ 2.89Å; E39-W52 HydrophobicContact CB-CB 4.05Å; E39-W52 HydrophobicContact CB-CG 4.37Å; E39-K131 WeakPolarHBondContact OE1-CD 3.37Å; E39-K131 WeakPolarHBondContact OE1-CE 3.5Å; E39-K131 IonicContact OE1-NZ 2.7Å; E39-K131 PolarHBondContact OE1-NZ 3.46Å; E39-V133 HydrophobicContact CB-CG2 4.39Å
40	L	92.3	Very high	89.3	Confident	12 Å²	12	75.9 Å²	75.9	6%	0.063	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	119.2	166.1	178.1	65.3	0	0	0	109.6	F47 Y49 L117 E118 A121 K132	L40-F47 HydrophobicContact CD1-CB 4.19Å; L40-F47 HydrophobicContact CD1-CD1 3.66Å; L40-F47 HydrophobicContact CD1-CE1 4.45Å; L40-F47 HydrophobicContact CD1-CG 4.26Å; L40-F47 HydrophobicContact CD2-CD1 4.43Å; L40-F47 HydrophobicContact CD2-CE1 4.45Å; L40-F47 HydrophobicContact CG-CD1 4.19Å; L40-Y49 HydrophobicContact CB-CE1 4.27Å; L40-Y49 HydrophobicContact CD1-CD1 4.34Å; L40-Y49 HydrophobicContact CD1-CE1 3.71Å; L40-Y49 HydrophobicContact CD1-CE2 4.29Å; L40-L117 HydrophobicContact CD2-CB 4.29Å; L40-E118 HydrophobicContact CD1-CG 3.93Å; L40-E118 HydrophobicContact CD2-CG 4.07Å; L40-A121 HydrophobicContact CD2-CB 3.73Å; L40-A121 HydrophobicContact CG-CB 4.49Å; L40-K132 HydrophobicContact CB-CB 4.44Å; L40-K132 PolarHBondContact N-O 2.88Å
41	V	90.2	Very high	89.6	Confident	35 Å²	35	77.6 Å²	77.6	21%	0.212	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	129.6	179	178.9	0	0	0	0	109.1	E39 F47 S48 K50	E39-V41 HydrophobicContact CG-CG2 4.32Å; E39-V41 PolarHBondContact O-N 2.96Å; V41-F47 WeakPolarHBondContact O-CA 3.33Å; V41-S48 PolarHBondContact N-O 3.04Å; V41-S48 PolarHBondContact O-N 3.23Å; V41-K50 HydrophobicContact CG2-CD 3.69Å; V41-K50 HydrophobicContact CG2-CG 3.8Å
42	L	88.1	Confident	89.8	Confident	41 Å²	41	71.5 Å²	71.5	22%	0.215	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	112.5	168.9	-179.5	63.6	0	0	0	108.2	F47	L42-F47 HydrophobicContact CB-CD1 4.4Å; L42-F47 HydrophobicContact CB-CE1 4.23Å; L42-F47 HydrophobicContact CD1-CD1 3.98Å; L42-F47 HydrophobicContact CD1-CE1 3.75Å; L42-F47 HydrophobicContact CD1-CG 4.5Å; L42-F47 HydrophobicContact CD1-CZ 4.05Å; L42-F47 HydrophobicContact CG-CE1 4.42Å
43	D	85.4	Confident	90	Very high	96 Å²	96	70.6 Å²	70.6	51%	0.513	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	124.6	173.5	-177.6	41.4	0	0	0	109.4	D45 Q46	D43-D45 VanDerWaalsContact C-N 3.29Å; D43-D45 PolarHBondContact O-N 3.39Å; D43-Q46 PolarHBondContact N-O 3.4Å; D43-Q46 WeakPolarHBondContact O-CA 3.14Å; D43-Q46 WeakPolarHBondContact O-CB 3.27Å; D43-Q46 PolarHBondContact O-N 3.48Å
44	K	84.9	Confident	90	Very high	174 Å²	174	68.7 Å²	68.7	76%	0.757	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	45.4	50.5	179.2	-59	173.3	-174	172.5	0	113.4	Q46	K44-Q46 PolarHBondContact O-N 3.05Å; K44-Q46 VanDerWaalsContact O-N 3.1Å
45	D	82.7	Confident	89.9	Confident	151 Å²	151	70.8 Å²	70.8	81%	0.807	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.6	10.1	-177.9	-55.6	-48.8	0	0	0	115.7	D43	D43-D45 VanDerWaalsContact C-N 3.29Å; D43-D45 PolarHBondContact O-N 3.39Å
46	Q	87.7	Confident	89.8	Confident	145 Å²	145	68.3 Å²	68.3	68%	0.678	35%	0.345	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.8	131.8	174.6	-62.5	-176.6	31.6	0	0	111	D43 K44	D43-Q46 PolarHBondContact N-O 3.4Å; D43-Q46 WeakPolarHBondContact O-CA 3.14Å; D43-Q46 WeakPolarHBondContact O-CB 3.27Å; D43-Q46 PolarHBondContact O-N 3.48Å; K44-Q46 PolarHBondContact O-N 3.05Å; K44-Q46 VanDerWaalsContact O-N 3.1Å
47	F	90.3	Very high	90	Very high	67 Å²	67	65 Å²	65	29%	0.294	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.3	132.4	172	-68.7	-67.2	0	0	0	111	L40 V41 L42 E118 A121 S122	L40-F47 HydrophobicContact CD1-CB 4.19Å; L40-F47 HydrophobicContact CD1-CD1 3.66Å; L40-F47 HydrophobicContact CD1-CE1 4.45Å; L40-F47 HydrophobicContact CD1-CG 4.26Å; L40-F47 HydrophobicContact CD2-CD1 4.43Å; L40-F47 HydrophobicContact CD2-CE1 4.45Å; L40-F47 HydrophobicContact CG-CD1 4.19Å; V41-F47 WeakPolarHBondContact O-CA 3.33Å; L42-F47 HydrophobicContact CB-CD1 4.4Å; L42-F47 HydrophobicContact CB-CE1 4.23Å; L42-F47 HydrophobicContact CD1-CD1 3.98Å; L42-F47 HydrophobicContact CD1-CE1 3.75Å; L42-F47 HydrophobicContact CD1-CG 4.5Å; L42-F47 HydrophobicContact CD1-CZ 4.05Å; L42-F47 HydrophobicContact CG-CE1 4.42Å; F47-E118 HydrophobicContact CB-CG 4.39Å; F47-E118 HydrophobicContact CD1-CB 4.27Å; F47-E118 HydrophobicContact CD1-CG 3.94Å; F47-E118 HydrophobicContact CD2-CB 3.98Å; F47-E118 HydrophobicContact CD2-CG 3.94Å; F47-E118 HydrophobicContact CE1-CB 3.96Å; F47-E118 HydrophobicContact CE1-CG 4.12Å; F47-E118 WeakPolarHBondContact CE1-O 3.45Å; F47-E118 HydrophobicContact CE2-CB 3.67Å; F47-E118 HydrophobicContact CE2-CG 4.15Å; F47-E118 HydrophobicContact CG-CB 4.25Å; F47-E118 HydrophobicContact CG-CG 3.81Å; F47-E118 VanDerWaalsContact CZ-C 3.47Å; F47-E118 HydrophobicContact CZ-CB 3.63Å; F47-E118 HydrophobicContact CZ-CG 4.21Å; F47-E118 WeakPolarHBondContact CZ-O 3.3Å; F47-A121 HydrophobicContact CE1-CB 3.95Å; F47-S122 WeakPolarHBondContact CZ-OG 3.3Å
48	S	91.5	Very high	90.1	Very high	54 Å²	54	64 Å²	64	38%	0.378	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	165	171.7	60.7	0	0	0	0	110.4	V41	V41-S48 PolarHBondContact N-O 3.04Å; V41-S48 PolarHBondContact O-N 3.23Å
49	Y	91.9	Very high	90.1	Very high	71 Å²	71	67.9 Å²	67.9	28%	0.278	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	133	-176.1	-71	-82	0	0	0	108.2	R37 E39 L40 E118 P134	R37-Y49 HydrophobicContact CB-CD1 3.83Å; R37-Y49 HydrophobicContact CB-CE1 4.36Å; R37-Y49 HydrophobicContact CB-CG 4.4Å; R37-Y49 WeakPolarHBondContact O-CB 3.25Å; E39-Y49 WeakPolarHBondContact O-CA 3.45Å; L40-Y49 HydrophobicContact CB-CE1 4.27Å; L40-Y49 HydrophobicContact CD1-CD1 4.34Å; L40-Y49 HydrophobicContact CD1-CE1 3.71Å; L40-Y49 HydrophobicContact CD1-CE2 4.29Å; Y49-E118 PolarHBondContact OH-OE1 3.38Å; Y49-P134 HydrophobicContact CD1-CG 4.22Å; Y49-P134 HydrophobicContact CE1-CG 3.76Å
50	K	92.6	Very high	90.1	Very high	90 Å²	90	71.2 Å²	71.2	39%	0.391	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	148.9	177.9	67.4	175.9	-178.3	177.4	0	110.6	R37 G38 E39 V41 W52	R37-K50 CarbonylContact O-C 3.55Å; R37-K50 PolarHBondContact O-N 3.27Å; G38-K50 CarbonylContact C-O 3.56Å; G38-K50 VanDerWaalsContact CA-O 3.23Å; G38-K50 WeakPolarHBondContact CA-O 3.38Å; E39-K50 HydrophobicContact CB-CG 4.02Å; E39-K50 VanDerWaalsContact CD-CE 3.43Å; E39-K50 PolarHBondContact N-O 2.86Å; E39-K50 PolarHBondContact O-N 2.94Å; E39-K50 VanDerWaalsContact O-N 3.09Å; E39-K50 IonicContact OE1-NZ 3.96Å; E39-K50 WeakPolarHBondContact OE2-CE 3.5Å; E39-K50 IonicContact OE2-NZ 3.48Å; E39-K50 PolarHBondContact OE2-NZ 2.89Å; V41-K50 HydrophobicContact CG2-CD 3.69Å; V41-K50 HydrophobicContact CG2-CG 3.8Å; K50-W52 PolarHBondContact O-N 2.94Å
51	T	93.9	Very high	90.1	Very high	86 Å²	86	75.6 Å²	75.6	53%	0.528	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-51.9	132.7	171.7	-54.1	0	0	0	0	110.8	T35	T35-T51 HydrophobicContact CG2-CG2 3.84Å
52	W	94.5	Very high	90.2	Very high	1 Å²	1	76.6 Å²	76.6	0%	0.004	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	139	177.3	-179.3	97.7	0	0	0	109.4	G33 I34 E39 K50 Q56 L57 L64 T97 I99 V133	G33-W52 CarbonylContact C-O 3.6Å; G33-W52 WeakPolarHBondContact CA-O 3.49Å; I34-W52 HydrophobicContact CB-CE3 4.42Å; I34-W52 HydrophobicContact CD1-CE3 3.79Å; I34-W52 HydrophobicContact CD1-CZ3 4.02Å; I34-W52 HydrophobicContact CG1-CE3 4.09Å; I34-W52 HydrophobicContact CG1-CZ3 4.49Å; I34-W52 PolarHBondContact N-O 3.18Å; I34-W52 PolarHBondContact O-N 2.82Å; E39-W52 HydrophobicContact CB-CB 4.05Å; E39-W52 HydrophobicContact CB-CG 4.37Å; K50-W52 PolarHBondContact O-N 2.94Å; W52-Q56 VanDerWaalsContact NE1-NE2 3.17Å; W52-L57 HydrophobicContact CH2-CD1 4.1Å; W52-L57 HydrophobicContact CZ2-CD1 4.01Å; W52-L57 HydrophobicContact CZ2-CD2 3.88Å; W52-L57 HydrophobicContact CZ2-CG 4.13Å; W52-L64 HydrophobicContact CH2-CD1 4.22Å; W52-L64 HydrophobicContact CZ2-CD1 4.24Å; W52-T97 HydrophobicContact CZ2-CG2 3.91Å; W52-I99 HydrophobicContact CH2-CD1 4.03Å; W52-I99 HydrophobicContact CZ3-CD1 4.12Å; W52-V133 HydrophobicContact CB-CG1 3.89Å; W52-V133 HydrophobicContact CB-CG2 4.4Å; W52-V133 HydrophobicContact CD2-CG1 4.24Å; W52-V133 HydrophobicContact CD2-CG2 4.08Å; W52-V133 HydrophobicContact CE3-CG1 4.47Å; W52-V133 HydrophobicContact CG-CG1 4Å; W52-V133 HydrophobicContact CG-CG2 3.81Å
53	N	93.9	Very high	90.4	Very high	65 Å²	65	76.8 Å²	76.8	35%	0.348	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	154.7	171.4	68.6	72.4	0	0	0	111.5	I32 A55 Q56	I32-N53 CarbonylContact O-C 3.59Å; I32-N53 VanDerWaalsContact O-CA 3.3Å; I32-N53 WeakPolarHBondContact O-CA 3.3Å; N53-A55 PolarHBondContact O-N 2.86Å; N53-A55 WeakPolarHBondContact OD1-CA 3.32Å; N53-A55 WeakPolarHBondContact OD1-CB 3.38Å; N53-A55 PolarHBondContact OD1-N 2.8Å; N53-Q56 WeakPolarHBondContact O-CG 3.29Å; N53-Q56 PolarHBondContact O-N 3.31Å; N53-Q56 PolarHBondContact O-NE2 3.2Å; N53-Q56 PolarHBondContact OD1-N 3.11Å
54	S	92	Very high	90.7	Very high	10 Å²	10	75.4 Å²	75.4	7%	0.07	41%	0.411	C	S	.	.	G	3₁₀ helix	trans	-64.7	-21.1	177.7	56.3	0	0	0	0	114.2	P30 P31 I32 Q56 L57	P30-S54 PolarHBondContact O-OG 2.7Å; P31-S54 WeakPolarHBondContact CA-OG 3.45Å; I32-S54 PolarHBondContact N-OG 3.27Å; I32-S54 PolarHBondContact O-N 2.82Å; I32-S54 PolarHBondContact O-OG 3.17Å; S54-Q56 PolarHBondContact O-N 3.27Å; S54-L57 WeakPolarHBondContact O-CB 3.44Å; S54-L57 WeakPolarHBondContact O-CG 3.2Å; S54-L57 PolarHBondContact O-N 2.82Å
55	A	90.1	Very high	91	Very high	54 Å²	54	67.9 Å²	67.9	45%	0.446	38%	0.379	S	S	.	.	G	3₁₀ helix	trans	-66.2	-25	179	0	0	0	0	0	112.3	N53 L57	N53-A55 PolarHBondContact O-N 2.86Å; N53-A55 WeakPolarHBondContact OD1-CA 3.32Å; N53-A55 WeakPolarHBondContact OD1-CB 3.38Å; N53-A55 PolarHBondContact OD1-N 2.8Å; A55-L57 PolarHBondContact O-N 2.88Å
56	Q	88.6	Confident	91.5	Very high	61 Å²	61	66.4 Å²	66.4	29%	0.285	37%	0.367	S	S	.	.	G	3₁₀ helix	trans	-74.4	-2.4	174.3	87.3	-163.6	-64.3	0	0	114	W52 N53 S54 V58 R62	W52-Q56 VanDerWaalsContact NE1-NE2 3.17Å; N53-Q56 WeakPolarHBondContact O-CG 3.29Å; N53-Q56 PolarHBondContact O-N 3.31Å; N53-Q56 PolarHBondContact O-NE2 3.2Å; N53-Q56 PolarHBondContact OD1-N 3.11Å; S54-Q56 PolarHBondContact O-N 3.27Å; Q56-V58 VanDerWaalsContact C-N 3.27Å; Q56-V58 PolarHBondContact O-N 3.39Å; Q56-R62 PolarHBondContact O-NH2 3.48Å
57	L	89.8	Confident	91.8	Very high	22 Å²	22	60.9 Å²	60.9	12%	0.115	34%	0.342	C	S	.	.	G	3₁₀ helix	trans	-78.5	-8.4	-178.4	-63.8	176.8	0	0	0	114	V29 W52 S54 A55 R62 L64	V29-L57 HydrophobicContact CG2-CD1 4.34Å; W52-L57 HydrophobicContact CH2-CD1 4.1Å; W52-L57 HydrophobicContact CZ2-CD1 4.01Å; W52-L57 HydrophobicContact CZ2-CD2 3.88Å; W52-L57 HydrophobicContact CZ2-CG 4.13Å; S54-L57 WeakPolarHBondContact O-CB 3.44Å; S54-L57 WeakPolarHBondContact O-CG 3.2Å; S54-L57 PolarHBondContact O-N 2.82Å; A55-L57 PolarHBondContact O-N 2.88Å; L57-R62 PolarHBondContact O-NE 3.23Å; L57-L64 HydrophobicContact CD1-CD2 4.41Å
58	V	88.8	Confident	92	Very high	104 Å²	104	58.7 Å²	58.7	63%	0.63	34%	0.336	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	156	177.6	-62.7	0	0	0	0	112.8	Q56 K60	Q56-V58 VanDerWaalsContact C-N 3.27Å; Q56-V58 PolarHBondContact O-N 3.39Å; V58-K60 PolarHBondContact O-N 2.97Å
59	G	90.8	Very high	92	Very high	81 Å²	81	56.3 Å²	56.3	84%	0.835	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.4	-7.9	169.3	0	0	0	0	0	117
60	K	92.2	Very high	92.1	Very high	75 Å²	75	57.6 Å²	57.6	33%	0.326	32%	0.324	S	S	.	.	S	Bend	trans	-133.8	153.5	176.5	-62.1	-169.5	-178.7	-166.5	0	111.4	V58 R62 H91 D92 R93 Q95	V58-K60 PolarHBondContact O-N 2.97Å; K60-R62 HydrophobicContact CB-CG 4.19Å; K60-H91 PolarHBondContact NZ-O 3.45Å; K60-D92 VanDerWaalsContact CE-O 3.25Å; K60-D92 WeakPolarHBondContact CE-O 3.28Å; K60-R93 CarbonylContact C-O 3.58Å; K60-R93 WeakPolarHBondContact CA-O 3.19Å; K60-R93 WeakPolarHBondContact CB-O 3.4Å; K60-Q95 HydrophobicContact CD-CB 4.08Å
61	V	92.8	Very high	91.9	Very high	104 Å²	104	58 Å²	58	63%	0.63	33%	0.334	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.4	132.4	162.2	178.9	0	0	0	0	108	R93 Y94 Q95	V61-R93 PolarHBondContact N-O 3.35Å; V61-Y94 HydrophobicContact CB-CD2 4.23Å; V61-Y94 HydrophobicContact CG1-CD2 4.1Å; V61-Y94 HydrophobicContact CG1-CE2 4.45Å; V61-Y94 CarbonylContact O-C 3.57Å; V61-Y94 VanDerWaalsContact O-CA 3.27Å; V61-Y94 WeakPolarHBondContact O-CA 3.32Å; V61-Y94 WeakPolarHBondContact O-CD2 3.34Å; V61-Q95 PolarHBondContact O-N 2.93Å
62	R	91.7	Very high	91.9	Very high	57 Å²	57	57.3 Å²	57.3	22%	0.215	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	147.6	-173.4	-57.6	-173.2	-176.6	-114.3	1.4	112.5	Q56 L57 K60 Q95	Q56-R62 PolarHBondContact O-NH2 3.48Å; L57-R62 PolarHBondContact O-NE 3.23Å; K60-R62 HydrophobicContact CB-CG 4.19Å; R62-Q95 WeakPolarHBondContact CA-O 3.38Å; R62-Q95 WeakPolarHBondContact CB-O 3.28Å; R62-Q95 HydrophobicContact CG-CB 4.5Å; R62-Q95 VanDerWaalsContact CG-O 3.23Å; R62-Q95 WeakPolarHBondContact CG-O 3.1Å
63	V	92	Very high	91.8	Very high	45 Å²	45	58 Å²	58	27%	0.273	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	119.3	161.5	171.6	0	0	0	0	107	Q65 I84 Y94 T96 T97	V63-Q65 HydrophobicContact CG1-CG 3.83Å; V63-I84 HydrophobicContact CB-CD1 4.42Å; V63-I84 HydrophobicContact CG1-CD1 4.32Å; V63-I84 HydrophobicContact CG2-CD1 4.31Å; V63-Y94 HydrophobicContact CG2-CE2 4.2Å; V63-Y94 WeakPolarHBondContact CG2-OH 3.27Å; V63-T96 HydrophobicContact CB-CG2 4.2Å; V63-T96 HydrophobicContact CG1-CG2 4.3Å; V63-T96 CarbonylContact O-C 3.37Å; V63-T96 WeakPolarHBondContact O-CA 3.36Å; V63-T97 PolarHBondContact O-N 2.88Å
64	L	91.5	Very high	91.7	Very high	67 Å²	67	60.3 Å²	60.3	35%	0.351	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	116.8	173.6	-174.9	64.5	0	0	0	108.8	W52 L57 T97 I99	W52-L64 HydrophobicContact CH2-CD1 4.22Å; W52-L64 HydrophobicContact CZ2-CD1 4.24Å; L57-L64 HydrophobicContact CD1-CD2 4.41Å; L64-T97 CarbonylContact C-O 3.49Å; L64-T97 WeakPolarHBondContact CA-O 3.4Å; L64-T97 HydrophobicContact CD1-CG2 3.81Å; L64-I99 HydrophobicContact CD1-CD1 3.8Å; L64-I99 HydrophobicContact CD1-CG1 4.04Å; L64-I99 HydrophobicContact CD2-CD1 4.44Å; L64-I99 HydrophobicContact CG-CD1 4.34Å
65	Q	92.3	Very high	91.7	Very high	15 Å²	15	65.9 Å²	65.9	7%	0.07	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	126.3	177.9	-62.8	179.2	50.2	0	0	109.1	V63 I67 L80 T97 T98 I99	V63-Q65 HydrophobicContact CG1-CG 3.83Å; Q65-I67 HydrophobicContact CB-CG2 4.28Å; Q65-L80 HydrophobicContact CG-CD2 4.5Å; Q65-T97 PolarHBondContact N-O 2.78Å; Q65-T98 HydrophobicContact CB-CG2 4.34Å; Q65-T98 CarbonylContact O-C 3.59Å; Q65-T98 WeakPolarHBondContact O-CA 3.34Å; Q65-I99 PolarHBondContact O-N 2.92Å
66	H	91.9	Very high	91.9	Very high	121 Å²	121	71.7 Å²	71.7	56%	0.56	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.5	113.9	167.2	178.5	-141.5	0	0	0	108.1	I99 L135	H66-I99 WeakPolarHBondContact CA-O 3.36Å; H66-I99 HydrophobicContact CB-CB 4.47Å; H66-L135 VanDerWaalsContact NE2-CD1 3.32Å; H66-L135 WeakPolarHBondContact NE2-CD1 3.49Å
67	I	94.2	Very high	92.1	Very high	29 Å²	29	70.8 Å²	70.8	15%	0.149	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	150.8	-174.9	66.3	173.3	0	0	0	110.8	Q65 T98 I99 V100 N101	Q65-I67 HydrophobicContact CB-CG2 4.28Å; I67-T98 HydrophobicContact CD1-CG2 3.59Å; I67-T98 HydrophobicContact CG1-CG2 3.8Å; I67-I99 PolarHBondContact N-O 3.08Å; I67-V100 HydrophobicContact CD1-CG2 4.23Å; I67-V100 HydrophobicContact CG1-CG2 4.02Å; I67-V100 CarbonylContact O-C 3.57Å; I67-V100 WeakPolarHBondContact O-CA 3.29Å; I67-N101 PolarHBondContact O-N 3.18Å
68	A	94.4	Very high	92.2	Very high	21 Å²	21	71.9 Å²	71.9	17%	0.174	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.9	149.1	171	0	0	0	0	0	111.5	R70 A73 D104	A68-R70 HydrophobicContact CB-CG 4.08Å; A68-R70 PolarHBondContact O-N 3.03Å; A68-A73 HydrophobicContact CB-CB 4.04Å; A68-A73 WeakPolarHBondContact O-CB 3.39Å; A68-D104 HydrophobicContact CB-CB 4.11Å; A68-D104 WeakPolarHBondContact CB-OD2 3.44Å
69	G	92.8	Very high	92.5	Very high	3 Å²	3	72.5 Å²	72.5	3%	0.031	40%	0.399	C	S	.	.	S	Bend	trans	-72.2	45.1	172.6	0	0	0	0	0	113.5	N101 A105 V113	G69-N101 VanDerWaalsContact CA-O 3.29Å; G69-N101 WeakPolarHBondContact CA-O 3.38Å; G69-N101 PolarHBondContact N-O 3.11Å; G69-A105 WeakPolarHBondContact O-CA 3.27Å; G69-A105 WeakPolarHBondContact O-CB 3.42Å; G69-V113 WeakPolarHBondContact O-CG2 3.41Å
70	R	92.6	Very high	92.6	Very high	98 Å²	98	72.2 Å²	72.2	37%	0.37	38%	0.378	S	S	.	.	S	Bend	trans	-121.5	144.4	-176.6	-55.3	179.7	178.9	-97.1	-3.9	110.6	A68 S72 A73 K74 D104	A68-R70 HydrophobicContact CB-CG 4.08Å; A68-R70 PolarHBondContact O-N 3.03Å; R70-S72 PolarHBondContact O-N 2.64Å; R70-A73 HydrophobicContact CB-CB 4.32Å; R70-A73 WeakPolarHBondContact O-CB 3.4Å; R70-A73 PolarHBondContact O-N 3.16Å; R70-K74 PolarHBondContact O-N 2.8Å; R70-K74 VanDerWaalsContact O-N 3.09Å; R70-D104 WeakPolarHBondContact CG-O 3.39Å; R70-D104 IonicContact CZ-OD1 2.89Å; R70-D104 VanDerWaalsContact CZ-OD1 3.22Å; R70-D104 PolarHBondContact NE-O 2.85Å; R70-D104 IonicContact NE-OD1 3.9Å; R70-D104 PolarHBondContact NE-OD1 3.04Å; R70-D104 IonicContact NH2-OD1 3.22Å; R70-D104 PolarHBondContact NH2-OD1 3.32Å
71	T	89.6	Confident	92.4	Very high	99 Å²	99	69.9 Å²	69.9	61%	0.607	37%	0.369	S	S	*	.	H	α-helix	trans	-56.7	-40.8	174.7	-49.3	0	0	0	0	111.6	A73 K74 E75	T71-A73 VanDerWaalsContact C-N 3.29Å; T71-A73 PolarHBondContact O-N 2.86Å; T71-K74 WeakPolarHBondContact O-CB 3.35Å; T71-K74 PolarHBondContact O-N 2.88Å; T71-K74 VanDerWaalsContact O-N 3.13Å; T71-E75 HydrophobicContact CG2-CG 4.44Å; T71-E75 WeakPolarHBondContact CG2-OE1 3.32Å; T71-E75 WeakPolarHBondContact O-CG 3.41Å; T71-E75 PolarHBondContact O-N 2.96Å
72	S	93.4	Very high	92.4	Very high	72 Å²	72	69.4 Å²	69.4	50%	0.503	36%	0.36	S	S	.	.	H	α-helix	trans	-62	-33.6	176.5	57.7	0	0	0	0	113.5	R70 K76	R70-S72 PolarHBondContact O-N 2.64Å; S72-K76 WeakPolarHBondContact O-CB 3.37Å; S72-K76 PolarHBondContact O-N 3.15Å
73	A	93.1	Very high	92.5	Very high	15 Å²	15	69.4 Å²	69.4	12%	0.124	37%	0.372	C	S	.	.	H	α-helix	trans	-71.3	-40.3	174.7	0	0	0	0	0	111.2	A68 R70 T71 N77	A68-A73 HydrophobicContact CB-CB 4.04Å; A68-A73 WeakPolarHBondContact O-CB 3.39Å; R70-A73 HydrophobicContact CB-CB 4.32Å; R70-A73 WeakPolarHBondContact O-CB 3.4Å; R70-A73 PolarHBondContact O-N 3.16Å; T71-A73 VanDerWaalsContact C-N 3.29Å; T71-A73 PolarHBondContact O-N 2.86Å; A73-N77 PolarHBondContact O-N 2.91Å; A73-N77 PolarHBondContact O-ND2 3.22Å
74	K	90.2	Very high	92.5	Very high	113 Å²	113	68 Å²	68	49%	0.491	36%	0.363	S	S	.	.	H	α-helix	trans	-59.8	-48.1	172.5	175.1	-176.4	171.9	-174.3	0	111.4	R70 T71 N77 A78	R70-K74 PolarHBondContact O-N 2.8Å; R70-K74 VanDerWaalsContact O-N 3.09Å; T71-K74 WeakPolarHBondContact O-CB 3.35Å; T71-K74 PolarHBondContact O-N 2.88Å; T71-K74 VanDerWaalsContact O-N 3.13Å; K74-N77 PolarHBondContact O-N 2.73Å; K74-A78 PolarHBondContact O-N 3.07Å; K74-A78 VanDerWaalsContact O-N 3.08Å
75	E	92.8	Very high	92.4	Very high	127 Å²	127	70 Å²	70	59%	0.593	37%	0.369	S	S	*	.	H	α-helix	trans	-61.2	-44.9	-179.9	-73.3	167.9	-178.5	0	0	112	T71 N77 A78	T71-E75 HydrophobicContact CG2-CG 4.44Å; T71-E75 WeakPolarHBondContact CG2-OE1 3.32Å; T71-E75 WeakPolarHBondContact O-CG 3.41Å; T71-E75 PolarHBondContact O-N 2.96Å; E75-N77 PolarHBondContact O-N 3.44Å; E75-A78 VanDerWaalsContact O-CB 3.27Å; E75-A78 WeakPolarHBondContact O-CB 3.27Å; E75-A78 PolarHBondContact O-N 3.36Å; E75-A78 VanDerWaalsContact O-N 3.09Å
76	K	94.8	Very high	92.4	Very high	177 Å²	177	73.4 Å²	73.4	77%	0.77	39%	0.394	S	S	*	.	H	α-helix	trans	-60.7	-29.3	178.2	-171.5	176	-65.4	-177.7	0	113.3	S72	S72-K76 WeakPolarHBondContact O-CB 3.37Å; S72-K76 PolarHBondContact O-N 3.15Å
77	N	92.3	Very high	92.5	Very high	42 Å²	42	70.4 Å²	70.4	23%	0.225	39%	0.39	C	S	.	.	H	α-helix	trans	-96.9	-2.8	179.6	-69.1	-81.5	0	0	0	113.2	A73 K74 E75 T79 L80 I81	A73-N77 PolarHBondContact O-N 2.91Å; A73-N77 PolarHBondContact O-ND2 3.22Å; K74-N77 PolarHBondContact O-N 2.73Å; E75-N77 PolarHBondContact O-N 3.44Å; N77-T79 VanDerWaalsContact C-N 3.33Å; N77-T79 PolarHBondContact O-N 3.44Å; N77-L80 PolarHBondContact O-N 2.96Å; N77-L80 VanDerWaalsContact O-N 3.15Å; N77-I81 WeakPolarHBondContact O-CG1 3.37Å; N77-I81 PolarHBondContact O-N 2.84Å
78	A	91.8	Very high	92.3	Very high	44 Å²	44	77.8 Å²	77.8	36%	0.364	42%	0.421	S	S	.	.	H	α-helix	trans	-58.4	-43.2	-174.6	0	0	0	0	0	112.3	K74 E75 L80 I81 E82	K74-A78 PolarHBondContact O-N 3.07Å; K74-A78 VanDerWaalsContact O-N 3.08Å; E75-A78 VanDerWaalsContact O-CB 3.27Å; E75-A78 WeakPolarHBondContact O-CB 3.27Å; E75-A78 PolarHBondContact O-N 3.36Å; E75-A78 VanDerWaalsContact O-N 3.09Å; A78-L80 VanDerWaalsContact C-N 3.33Å; A78-L80 PolarHBondContact O-N 2.94Å; A78-I81 PolarHBondContact O-N 2.89Å; A78-E82 WeakPolarHBondContact O-CG 3.2Å; A78-E82 PolarHBondContact O-N 2.79Å
79	T	95	Very high	92.3	Very high	118 Å²	118	79.7 Å²	79.7	72%	0.724	43%	0.428	S	S	*	.	H	α-helix	trans	-60.2	-40.8	178.3	-51.9	0	0	0	0	112.4	N77 A83	N77-T79 VanDerWaalsContact C-N 3.33Å; N77-T79 PolarHBondContact O-N 3.44Å; T79-A83 VanDerWaalsContact O-CB 3.28Å; T79-A83 WeakPolarHBondContact O-CB 3.23Å; T79-A83 PolarHBondContact O-N 3.32Å
80	L	92.5	Very high	92.2	Very high	75 Å²	75	82 Å²	82	39%	0.393	44%	0.443	S	S	.	.	H	α-helix	trans	-66.3	-44.4	176.7	174.8	62	0	0	0	111.3	Q65 N77 A78 A83 I84	Q65-L80 HydrophobicContact CG-CD2 4.5Å; N77-L80 PolarHBondContact O-N 2.96Å; N77-L80 VanDerWaalsContact O-N 3.15Å; A78-L80 VanDerWaalsContact C-N 3.33Å; A78-L80 PolarHBondContact O-N 2.94Å; L80-A83 PolarHBondContact O-N 2.72Å; L80-I84 HydrophobicContact CD1-CD1 3.86Å; L80-I84 HydrophobicContact CD1-CG1 4.23Å; L80-I84 HydrophobicContact CG-CD1 3.94Å; L80-I84 VanDerWaalsContact O-CG1 3.32Å; L80-I84 WeakPolarHBondContact O-CG1 3.42Å; L80-I84 PolarHBondContact O-N 3.31Å
81	I	89.7	Confident	92.1	Very high	25 Å²	25	81.6 Å²	81.6	13%	0.128	45%	0.445	C	S	.	.	H	α-helix	trans	-62.1	-45.7	178.9	-65.7	-56.6	0	0	0	111	N77 A78 I84 K85 W129 M130	N77-I81 WeakPolarHBondContact O-CG1 3.37Å; N77-I81 PolarHBondContact O-N 2.84Å; A78-I81 PolarHBondContact O-N 2.89Å; I81-I84 PolarHBondContact O-N 3.09Å; I81-K85 WeakPolarHBondContact O-CB 3.16Å; I81-K85 PolarHBondContact O-N 2.73Å; I81-W129 HydrophobicContact CG2-CH2 4.02Å; I81-M130 HydrophobicContact CD1-CE 3.74Å; I81-M130 HydrophobicContact CG1-CE 4.47Å
82	E	91.8	Very high	92.1	Very high	94 Å²	94	82.2 Å²	82.2	44%	0.439	44%	0.444	S	S	.	.	H	α-helix	trans	-68.5	-35.4	177.6	-69.6	-53.3	130.1	0	0	112.5	A78 K85 S86	A78-E82 WeakPolarHBondContact O-CG 3.2Å; A78-E82 PolarHBondContact O-N 2.79Å; E82-K85 PolarHBondContact O-N 3.29Å; E82-K85 IonicContact OE2-NZ 2.64Å; E82-S86 WeakPolarHBondContact O-CB 3.49Å; E82-S86 PolarHBondContact O-N 3.2Å; E82-S86 PolarHBondContact O-OG 3.24Å
83	A	94.4	Very high	92.1	Very high	57 Å²	57	86.8 Å²	86.8	47%	0.471	45%	0.451	S	S	.	.	H	α-helix	trans	-62.4	-46	173.1	0	0	0	0	0	111.8	T79 L80 S86 A87	T79-A83 VanDerWaalsContact O-CB 3.28Å; T79-A83 WeakPolarHBondContact O-CB 3.23Å; T79-A83 PolarHBondContact O-N 3.32Å; L80-A83 PolarHBondContact O-N 2.72Å; A83-S86 PolarHBondContact O-N 3.38Å; A83-A87 WeakPolarHBondContact O-CB 3.35Å; A83-A87 PolarHBondContact O-N 3.15Å
84	I	92	Very high	92.1	Very high	16 Å²	16	87 Å²	87	8%	0.082	45%	0.448	C	S	.	.	H	α-helix	trans	-62.7	-44.7	177.1	-69.8	165.6	0	0	0	110.9	V63 L80 I81 S86 A87 L89 Y94 W129	V63-I84 HydrophobicContact CB-CD1 4.42Å; V63-I84 HydrophobicContact CG1-CD1 4.32Å; V63-I84 HydrophobicContact CG2-CD1 4.31Å; L80-I84 HydrophobicContact CD1-CD1 3.86Å; L80-I84 HydrophobicContact CD1-CG1 4.23Å; L80-I84 HydrophobicContact CG-CD1 3.94Å; L80-I84 VanDerWaalsContact O-CG1 3.32Å; L80-I84 WeakPolarHBondContact O-CG1 3.42Å; L80-I84 PolarHBondContact O-N 3.31Å; I81-I84 PolarHBondContact O-N 3.09Å; I84-S86 VanDerWaalsContact C-N 3.35Å; I84-A87 PolarHBondContact O-N 3.08Å; I84-L89 HydrophobicContact CG2-CD1 4.47Å; I84-Y94 HydrophobicContact CG2-CE1 3.62Å; I84-Y94 WeakPolarHBondContact CG2-OH 3.49Å; I84-W129 HydrophobicContact CB-CZ3 4.34Å; I84-W129 HydrophobicContact CG2-CE3 3.75Å; I84-W129 HydrophobicContact CG2-CZ3 3.69Å
85	K	89.1	Confident	92.2	Very high	110 Å²	110	82.2 Å²	82.2	48%	0.478	43%	0.428	S	S	.	.	H	α-helix	trans	-61.1	-44.7	177.1	-174.9	-176.1	176.1	-170.8	0	111.4	I81 E82 A87 K88 W129	I81-K85 WeakPolarHBondContact O-CB 3.16Å; I81-K85 PolarHBondContact O-N 2.73Å; E82-K85 PolarHBondContact O-N 3.29Å; E82-K85 IonicContact OE2-NZ 2.64Å; K85-A87 VanDerWaalsContact C-N 3.29Å; K85-A87 PolarHBondContact O-N 3.09Å; K85-K88 PolarHBondContact O-N 3.36Å; K85-W129 HydrophobicContact CB-CH2 3.95Å; K85-W129 HydrophobicContact CB-CZ2 3.63Å; K85-W129 HydrophobicContact CD-CZ2 4.28Å; K85-W129 HydrophobicContact CG-CZ2 3.81Å
86	S	92.5	Very high	92.2	Very high	86 Å²	86	76.2 Å²	76.2	60%	0.601	40%	0.399	S	S	*	.	H	α-helix	trans	-68.3	-28.8	-179.9	-60	0	0	0	0	112.6	E82 A83 I84 K88	E82-S86 WeakPolarHBondContact O-CB 3.49Å; E82-S86 PolarHBondContact O-N 3.2Å; E82-S86 PolarHBondContact O-OG 3.24Å; A83-S86 PolarHBondContact O-N 3.38Å; I84-S86 VanDerWaalsContact C-N 3.35Å; S86-K88 PolarHBondContact O-N 2.65Å
87	A	93.2	Very high	92.1	Very high	57 Å²	57	67.8 Å²	67.8	47%	0.471	36%	0.363	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.9	-12.8	176.8	0	0	0	0	0	113.7	A83 I84 K85 L89	A83-A87 WeakPolarHBondContact O-CB 3.35Å; A83-A87 PolarHBondContact O-N 3.15Å; I84-A87 PolarHBondContact O-N 3.08Å; K85-A87 VanDerWaalsContact C-N 3.29Å; K85-A87 PolarHBondContact O-N 3.09Å; A87-L89 HydrophobicContact CB-CD1 4.46Å; A87-L89 HydrophobicContact CB-CD2 4.04Å; A87-L89 HydrophobicContact CB-CG 3.88Å; A87-L89 PolarHBondContact O-N 3.21Å; A87-L89 VanDerWaalsContact O-N 3.11Å
88	K	91.2	Very high	92.2	Very high	185 Å²	185	65.9 Å²	65.9	80%	0.804	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.4	45	177.5	-63	178.2	-176.7	178.9	0	112.3	K85 S86	K85-K88 PolarHBondContact O-N 3.36Å; S86-K88 PolarHBondContact O-N 2.65Å
89	L	93	Very high	92.3	Very high	60 Å²	60	64.3 Å²	64.3	31%	0.314	34%	0.338	S	S	.	.			trans	-61.9	143.6	-175.3	-63	174.1	0	0	0	110.7	I84 A87 H91 Y94	I84-L89 HydrophobicContact CG2-CD1 4.47Å; A87-L89 HydrophobicContact CB-CD1 4.46Å; A87-L89 HydrophobicContact CB-CD2 4.04Å; A87-L89 HydrophobicContact CB-CG 3.88Å; A87-L89 PolarHBondContact O-N 3.21Å; A87-L89 VanDerWaalsContact O-N 3.11Å; L89-H91 PolarHBondContact O-CD2 2.82Å; L89-H91 VanDerWaalsContact O-CD2 3.27Å; L89-H91 PolarHBondContact O-N 2.92Å; L89-Y94 HydrophobicContact CB-CD1 3.73Å; L89-Y94 HydrophobicContact CB-CD2 4.49Å; L89-Y94 HydrophobicContact CB-CE1 4.41Å; L89-Y94 HydrophobicContact CB-CG 3.76Å; L89-Y94 HydrophobicContact CD1-CD1 3.61Å; L89-Y94 HydrophobicContact CD1-CD2 3.63Å; L89-Y94 HydrophobicContact CD1-CE1 3.54Å; L89-Y94 HydrophobicContact CD1-CE2 3.54Å; L89-Y94 HydrophobicContact CD1-CG 3.64Å; L89-Y94 VanDerWaalsContact CD1-CZ 3.47Å; L89-Y94 HydrophobicContact CG-CD1 4.31Å; L89-Y94 HydrophobicContact CG-CG 4.33Å
90	P	92.2	Very high	92.2	Very high	53 Å²	53	58.9 Å²	58.9	34%	0.344	31%	0.305	S	S	.	.			trans	-60.6	117.4	-177	22.2	-32.9	0	0	0	111.6	D92 R93 Y94	P90-D92 VanDerWaalsContact CB-OD1 3.3Å; P90-D92 WeakPolarHBondContact CB-OD1 3.3Å; P90-D92 PolarHBondContact O-N 3.29Å; P90-R93 HydrophobicContact CG-CB 4.16Å; P90-R93 CarbonylContact O-C 3.54Å; P90-R93 PolarHBondContact O-N 2.58Å; P90-Y94 WeakPolarHBondContact O-CB 3.19Å; P90-Y94 PolarHBondContact O-N 2.89Å
91	H	88.8	Confident	92.2	Very high	88 Å²	88	57.2 Å²	57.2	41%	0.407	30%	0.296	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.7	-21.9	-173.2	-67.5	-176	0	0	0	113.9	K60 L89 W129	K60-H91 PolarHBondContact NZ-O 3.45Å; L89-H91 PolarHBondContact O-CD2 2.82Å; L89-H91 VanDerWaalsContact O-CD2 3.27Å; L89-H91 PolarHBondContact O-N 2.92Å; H91-W129 AromaticContact NE2-CD1 3.64Å
92	D	91.3	Very high	92.2	Very high	113 Å²	113	56.8 Å²	56.8	60%	0.604	30%	0.295	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74	-32.1	173.8	62.7	-50.2	0	0	0	112	K60 P90	K60-D92 VanDerWaalsContact CE-O 3.25Å; K60-D92 WeakPolarHBondContact CE-O 3.28Å; P90-D92 VanDerWaalsContact CB-OD1 3.3Å; P90-D92 WeakPolarHBondContact CB-OD1 3.3Å; P90-D92 PolarHBondContact O-N 3.29Å
93	R	92.4	Very high	91.9	Very high	168 Å²	168	58.8 Å²	58.8	63%	0.634	31%	0.309	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.2	-15.2	-178	-60.2	-167.7	-70.2	167.2	-2.6	115	K60 V61 P90	K60-R93 CarbonylContact C-O 3.58Å; K60-R93 WeakPolarHBondContact CA-O 3.19Å; K60-R93 WeakPolarHBondContact CB-O 3.4Å; V61-R93 PolarHBondContact N-O 3.35Å; P90-R93 HydrophobicContact CG-CB 4.16Å; P90-R93 CarbonylContact O-C 3.54Å; P90-R93 PolarHBondContact O-N 2.58Å
94	Y	94	Very high	91.8	Very high	19 Å²	19	59 Å²	59	8%	0.075	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	142.2	-175.2	-178	-94.2	0	0	0	113.4	V61 V63 I84 L89 P90 T96	V61-Y94 HydrophobicContact CB-CD2 4.23Å; V61-Y94 HydrophobicContact CG1-CD2 4.1Å; V61-Y94 HydrophobicContact CG1-CE2 4.45Å; V61-Y94 CarbonylContact O-C 3.57Å; V61-Y94 VanDerWaalsContact O-CA 3.27Å; V61-Y94 WeakPolarHBondContact O-CA 3.32Å; V61-Y94 WeakPolarHBondContact O-CD2 3.34Å; V63-Y94 HydrophobicContact CG2-CE2 4.2Å; V63-Y94 WeakPolarHBondContact CG2-OH 3.27Å; I84-Y94 HydrophobicContact CG2-CE1 3.62Å; I84-Y94 WeakPolarHBondContact CG2-OH 3.49Å; L89-Y94 HydrophobicContact CB-CD1 3.73Å; L89-Y94 HydrophobicContact CB-CD2 4.49Å; L89-Y94 HydrophobicContact CB-CE1 4.41Å; L89-Y94 HydrophobicContact CB-CG 3.76Å; L89-Y94 HydrophobicContact CD1-CD1 3.61Å; L89-Y94 HydrophobicContact CD1-CD2 3.63Å; L89-Y94 HydrophobicContact CD1-CE1 3.54Å; L89-Y94 HydrophobicContact CD1-CE2 3.54Å; L89-Y94 HydrophobicContact CD1-CG 3.64Å; L89-Y94 VanDerWaalsContact CD1-CZ 3.47Å; L89-Y94 HydrophobicContact CG-CD1 4.31Å; L89-Y94 HydrophobicContact CG-CG 4.33Å; P90-Y94 WeakPolarHBondContact O-CB 3.19Å; P90-Y94 PolarHBondContact O-N 2.89Å; Y94-T96 VanDerWaalsContact CE1-OG1 3.29Å; Y94-T96 WeakPolarHBondContact CE1-OG1 3.35Å; Y94-T96 PolarHBondContact OH-OG1 3.35Å
95	Q	92.4	Very high	91.6	Very high	13 Å²	13	58.6 Å²	58.6	6%	0.061	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.4	125.7	169.1	-175.5	160.4	64.2	0	0	113.3	K60 V61 R62 S128 W129 K131	K60-Q95 HydrophobicContact CD-CB 4.08Å; V61-Q95 PolarHBondContact O-N 2.93Å; R62-Q95 WeakPolarHBondContact CA-O 3.38Å; R62-Q95 WeakPolarHBondContact CB-O 3.28Å; R62-Q95 HydrophobicContact CG-CB 4.5Å; R62-Q95 VanDerWaalsContact CG-O 3.23Å; R62-Q95 WeakPolarHBondContact CG-O 3.1Å; Q95-S128 PolarHBondContact NE2-O 3.39Å; Q95-S128 VanDerWaalsContact NE2-O 3.15Å; Q95-W129 CarbonylContact C-O 3.58Å; Q95-K131 VanDerWaalsContact CD-CE 3.46Å; Q95-K131 HydrophobicContact CG-CG 4.36Å; Q95-K131 VanDerWaalsContact NE2-CE 3.32Å
96	T	92.7	Very high	91.6	Very high	0 Å²	0	58.4 Å²	58.4	0%	0	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	135.6	167.6	-58.9	0	0	0	0	110.9	V63 Y94 W129 M130 K131	V63-T96 HydrophobicContact CB-CG2 4.2Å; V63-T96 HydrophobicContact CG1-CG2 4.3Å; V63-T96 CarbonylContact O-C 3.37Å; V63-T96 WeakPolarHBondContact O-CA 3.36Å; Y94-T96 VanDerWaalsContact CE1-OG1 3.29Å; Y94-T96 WeakPolarHBondContact CE1-OG1 3.35Å; Y94-T96 PolarHBondContact OH-OG1 3.35Å; T96-W129 WeakPolarHBondContact CA-O 3.3Å; T96-W129 PolarHBondContact N-O 2.87Å; T96-M130 CarbonylContact O-C 3.59Å; T96-M130 WeakPolarHBondContact O-CA 3.07Å; T96-K131 PolarHBondContact O-N 3.11Å
97	T	92.3	Very high	91.2	Very high	1 Å²	1	60.3 Å²	60.3	1%	0.006	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	124.5	171.4	-57.1	0	0	0	0	109	W52 V63 L64 Q65 K131 V133	W52-T97 HydrophobicContact CZ2-CG2 3.91Å; V63-T97 PolarHBondContact O-N 2.88Å; L64-T97 CarbonylContact C-O 3.49Å; L64-T97 WeakPolarHBondContact CA-O 3.4Å; L64-T97 HydrophobicContact CD1-CG2 3.81Å; Q65-T97 PolarHBondContact N-O 2.78Å; T97-K131 HydrophobicContact CG2-CB 4.21Å; T97-V133 HydrophobicContact CG2-CG2 3.87Å
98	T	93.8	Very high	91	Very high	2 Å²	2	61.2 Å²	61.2	1%	0.012	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	107.2	177.1	-54.5	0	0	0	0	108.9	Q65 I67 V100 M130 K131 K132 V133	Q65-T98 HydrophobicContact CB-CG2 4.34Å; Q65-T98 CarbonylContact O-C 3.59Å; Q65-T98 WeakPolarHBondContact O-CA 3.34Å; I67-T98 HydrophobicContact CD1-CG2 3.59Å; I67-T98 HydrophobicContact CG1-CG2 3.8Å; T98-V100 HydrophobicContact CG2-CG2 3.87Å; T98-M130 VanDerWaalsContact OG1-CE 3.27Å; T98-M130 WeakPolarHBondContact OG1-CE 3.39Å; T98-K131 PolarHBondContact N-O 2.77Å; T98-K132 WeakPolarHBondContact O-CA 3.37Å; T98-V133 PolarHBondContact O-N 2.98Å
99	I	93.6	Very high	90.8	Very high	11 Å²	11	53.6 Å²	53.6	6%	0.056	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.8	125	167.8	-56.3	170.4	0	0	0	107.5	I34 W52 L64 Q65 H66 I67 V133 L135	I34-I99 HydrophobicContact CD1-CD1 3.94Å; I34-I99 HydrophobicContact CD1-CG1 4.1Å; I34-I99 HydrophobicContact CD1-CG2 3.73Å; W52-I99 HydrophobicContact CH2-CD1 4.03Å; W52-I99 HydrophobicContact CZ3-CD1 4.12Å; L64-I99 HydrophobicContact CD1-CD1 3.8Å; L64-I99 HydrophobicContact CD1-CG1 4.04Å; L64-I99 HydrophobicContact CD2-CD1 4.44Å; L64-I99 HydrophobicContact CG-CD1 4.34Å; Q65-I99 PolarHBondContact O-N 2.92Å; H66-I99 WeakPolarHBondContact CA-O 3.36Å; H66-I99 HydrophobicContact CB-CB 4.47Å; I67-I99 PolarHBondContact N-O 3.08Å; I99-V133 CarbonylContact C-O 3.58Å; I99-V133 VanDerWaalsContact CA-O 3.3Å; I99-V133 WeakPolarHBondContact CA-O 3.45Å; I99-V133 HydrophobicContact CG1-CB 4.14Å; I99-L135 HydrophobicContact CG2-CD1 3.45Å; I99-L135 VanDerWaalsContact CG2-CD1 3.45Å; I99-L135 HydrophobicContact CG2-CD2 4.11Å; I99-L135 HydrophobicContact CG2-CG 3.52Å
100	V	93.8	Very high	90.5	Very high	4 Å²	4	51.5 Å²	51.5	2%	0.024	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	112.8	-177.2	-177	0	0	0	0	108.5	I67 T98 T102 V113 L117 V133 P134 L135	I67-V100 HydrophobicContact CD1-CG2 4.23Å; I67-V100 HydrophobicContact CG1-CG2 4.02Å; I67-V100 CarbonylContact O-C 3.57Å; I67-V100 WeakPolarHBondContact O-CA 3.29Å; T98-V100 HydrophobicContact CG2-CG2 3.87Å; V100-T102 PolarHBondContact O-N 3.4Å; V100-T102 VanDerWaalsContact O-N 3.11Å; V100-V113 HydrophobicContact CG1-CG1 4.17Å; V100-L117 HydrophobicContact CB-CD1 4.07Å; V100-L117 HydrophobicContact CG1-CD1 4.21Å; V100-L117 HydrophobicContact CG1-CD2 4.5Å; V100-L117 HydrophobicContact CG2-CD1 4.23Å; V100-L117 HydrophobicContact CG2-CD2 3.89Å; V100-V133 PolarHBondContact N-O 3.03Å; V100-P134 WeakPolarHBondContact O-CA 3.33Å; V100-L135 PolarHBondContact O-N 3.23Å
101	N	91.9	Very high	90.2	Very high	39 Å²	39	55.1 Å²	55.1	21%	0.209	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.5	100	176.1	-175.6	-5.3	0	0	0	110.6	I67 G69 D103 D104 L135	I67-N101 PolarHBondContact O-N 3.18Å; G69-N101 VanDerWaalsContact CA-O 3.29Å; G69-N101 WeakPolarHBondContact CA-O 3.38Å; G69-N101 PolarHBondContact N-O 3.11Å; N101-D103 VanDerWaalsContact C-N 3.32Å; N101-D103 WeakPolarHBondContact OD1-CB 3.15Å; N101-D103 PolarHBondContact OD1-N 3.34Å; N101-D103 VanDerWaalsContact OD1-N 3.08Å; N101-D104 HydrophobicContact CB-CB 4.17Å; N101-D104 PolarHBondContact O-N 2.77Å; N101-D104 PolarHBondContact OD1-N 2.84Å; N101-L135 HydrophobicContact CB-CD1 4.13Å
102	T	88.9	Confident	90.2	Very high	17 Å²	17	57.9 Å²	57.9	10%	0.104	32%	0.318	C	S	.	.	S	Bend	trans	-78.9	-17.1	-178.6	71.3	0	0	0	0	113.1	V100 D104 A105 V113 R114 P134 L135	V100-T102 PolarHBondContact O-N 3.4Å; V100-T102 VanDerWaalsContact O-N 3.11Å; T102-D104 VanDerWaalsContact C-N 3.31Å; T102-A105 WeakPolarHBondContact O-CB 3.4Å; T102-A105 PolarHBondContact O-N 2.7Å; T102-V113 HydrophobicContact CG2-CG1 4.28Å; T102-R114 HydrophobicContact CG2-CG 4.41Å; T102-P134 HydrophobicContact CG2-CB 3.78Å; T102-L135 WeakPolarHBondContact CA-O 3.49Å; T102-L135 VanDerWaalsContact CB-O 3.27Å; T102-L135 WeakPolarHBondContact CB-O 3.33Å; T102-L135 PolarHBondContact N-O 2.94Å; T102-L135 PolarHBondContact OG1-O 2.82Å
103	D	87.4	Confident	90.1	Very high	136 Å²	136	53.7 Å²	53.7	73%	0.727	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-30.1	168.8	-67.4	-31.4	0	0	0	112	N101 A105	N101-D103 VanDerWaalsContact C-N 3.32Å; N101-D103 WeakPolarHBondContact OD1-CB 3.15Å; N101-D103 PolarHBondContact OD1-N 3.34Å; N101-D103 VanDerWaalsContact OD1-N 3.08Å; D103-A105 PolarHBondContact O-N 2.89Å
104	D	90.4	Very high	89.8	Confident	62 Å²	62	49.3 Å²	49.3	33%	0.332	28%	0.279	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.6	33.5	172	-166.3	11	0	0	0	112	A68 R70 N101 T102	A68-D104 HydrophobicContact CB-CB 4.11Å; A68-D104 WeakPolarHBondContact CB-OD2 3.44Å; R70-D104 WeakPolarHBondContact CG-O 3.39Å; R70-D104 IonicContact CZ-OD1 2.89Å; R70-D104 VanDerWaalsContact CZ-OD1 3.22Å; R70-D104 PolarHBondContact NE-O 2.85Å; R70-D104 IonicContact NE-OD1 3.9Å; R70-D104 PolarHBondContact NE-OD1 3.04Å; R70-D104 IonicContact NH2-OD1 3.22Å; R70-D104 PolarHBondContact NH2-OD1 3.32Å; N101-D104 HydrophobicContact CB-CB 4.17Å; N101-D104 PolarHBondContact O-N 2.77Å; N101-D104 PolarHBondContact OD1-N 2.84Å; T102-D104 VanDerWaalsContact C-N 3.31Å
105	A	89.3	Confident	89.6	Confident	7 Å²	7	51.3 Å²	51.3	6%	0.058	30%	0.296	C	S	.	.	S	Bend	trans	-87.8	174.7	167	0	0	0	0	0	111	G69 T102 D103 V113	G69-A105 WeakPolarHBondContact O-CA 3.27Å; G69-A105 WeakPolarHBondContact O-CB 3.42Å; T102-A105 WeakPolarHBondContact O-CB 3.4Å; T102-A105 PolarHBondContact O-N 2.7Å; D103-A105 PolarHBondContact O-N 2.89Å; A105-V113 HydrophobicContact CB-CG2 3.94Å
106	I	87.6	Confident	89.4	Confident	105 Å²	105	53.5 Å²	53.5	54%	0.538	31%	0.313	S	S	.	.			trans	-64.5	138.3	165.9	-63.9	173.2	0	0	0	107.1	G108 S109	I106-G108 PolarHBondContact O-N 3.13Å; I106-S109 WeakPolarHBondContact CB-OG 3.44Å; I106-S109 PolarHBondContact N-OG 3.06Å; I106-S109 VanDerWaalsContact N-OG 3.15Å; I106-S109 WeakPolarHBondContact O-CA 3.43Å; I106-S109 WeakPolarHBondContact O-CB 3.45Å; I106-S109 PolarHBondContact O-N 3.09Å; I106-S109 PolarHBondContact O-OG 2.84Å
107	P	86	Confident	89.2	Confident	126 Å²	126	54.1 Å²	54.1	82%	0.818	32%	0.316	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.1	129.6	176.3	-29.4	35.8	0	0	0	111.8	S109	P107-S109 VanDerWaalsContact C-N 3.25Å; P107-S109 PolarHBondContact O-N 2.88Å
108	G	87	Confident	89.1	Confident	76 Å²	76	56.5 Å²	56.5	78%	0.784	33%	0.327	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.4	-7.3	-175.4	0	0	0	0	0	115.5	I106	I106-G108 PolarHBondContact O-N 3.13Å
109	S	88.1	Confident	88.8	Confident	25 Å²	25	60 Å²	60	18%	0.175	35%	0.348	C	S	.	.			trans	-93.2	-4.3	-178.4	87.8	0	0	0	0	115	I106 P107 M111 F112 V113	I106-S109 WeakPolarHBondContact CB-OG 3.44Å; I106-S109 PolarHBondContact N-OG 3.06Å; I106-S109 VanDerWaalsContact N-OG 3.15Å; I106-S109 WeakPolarHBondContact O-CA 3.43Å; I106-S109 WeakPolarHBondContact O-CB 3.45Å; I106-S109 PolarHBondContact O-N 3.09Å; I106-S109 PolarHBondContact O-OG 2.84Å; P107-S109 VanDerWaalsContact C-N 3.25Å; P107-S109 PolarHBondContact O-N 2.88Å; S109-M111 PolarHBondContact O-N 3.2Å; S109-M111 VanDerWaalsContact O-N 3.17Å; S109-F112 PolarHBondContact O-N 2.64Å; S109-V113 PolarHBondContact O-N 3.49Å; S109-V113 VanDerWaalsContact O-N 3.11Å
110	G	85.7	Confident	88.3	Confident	17 Å²	17	62.4 Å²	62.4	18%	0.175	36%	0.36	C	S	.	.	H	α-helix	trans	-55.3	-35.4	-176.4	0	0	0	0	0	113.7	V113 R114	G110-V113 PolarHBondContact O-N 2.98Å; G110-R114 WeakPolarHBondContact O-CG 3.34Å; G110-R114 PolarHBondContact O-N 2.84Å
111	M	86.1	Confident	87.8	Confident	129 Å²	129	63.1 Å²	63.1	64%	0.635	37%	0.367	S	S	*	.	H	α-helix	trans	-62.1	-42.8	174.4	177.7	177.5	-79.9	0	0	112.7	S109 R114 S115	S109-M111 PolarHBondContact O-N 3.2Å; S109-M111 VanDerWaalsContact O-N 3.17Å; M111-R114 PolarHBondContact O-N 3.36Å; M111-S115 PolarHBondContact O-N 2.9Å
112	F	89.1	Confident	87.3	Confident	146 Å²	146	64.3 Å²	64.3	64%	0.64	38%	0.378	S	S	*	.	H	α-helix	trans	-69.9	-35.4	179.3	-61.8	-78.2	0	0	0	111.9	S109 S116	S109-F112 PolarHBondContact O-N 2.64Å; F112-S116 WeakPolarHBondContact O-CB 3.5Å; F112-S116 PolarHBondContact O-N 2.95Å; F112-S116 PolarHBondContact O-OG 3.32Å
113	V	89.4	Confident	86.8	Confident	25 Å²	25	71.3 Å²	71.3	15%	0.152	41%	0.409	C	S	.	.	H	α-helix	trans	-60.3	-49.3	172.6	179.3	0	0	0	0	109.5	G69 V100 T102 A105 S109 G110 S116 L117	G69-V113 WeakPolarHBondContact O-CG2 3.41Å; V100-V113 HydrophobicContact CG1-CG1 4.17Å; T102-V113 HydrophobicContact CG2-CG1 4.28Å; A105-V113 HydrophobicContact CB-CG2 3.94Å; S109-V113 PolarHBondContact O-N 3.49Å; S109-V113 VanDerWaalsContact O-N 3.11Å; G110-V113 PolarHBondContact O-N 2.98Å; V113-S116 WeakPolarHBondContact O-CB 3.39Å; V113-S116 PolarHBondContact O-N 2.96Å; V113-L117 HydrophobicContact CG1-CD1 4.49Å; V113-L117 WeakPolarHBondContact O-CG 3.44Å; V113-L117 PolarHBondContact O-N 2.9Å
114	R	87.2	Confident	86	Confident	76 Å²	76	66 Å²	66	29%	0.287	39%	0.385	S	S	.	.	H	α-helix	trans	-60.2	-49.9	178.2	-70.3	-175.3	-58.9	-139.3	3.5	112.7	T102 G110 M111 S116 L117 E118	T102-R114 HydrophobicContact CG2-CG 4.41Å; G110-R114 WeakPolarHBondContact O-CG 3.34Å; G110-R114 PolarHBondContact O-N 2.84Å; M111-R114 PolarHBondContact O-N 3.36Å; R114-S116 PolarHBondContact O-N 3.08Å; R114-L117 WeakPolarHBondContact O-CA 3.16Å; R114-L117 WeakPolarHBondContact O-CB 3.37Å; R114-L117 PolarHBondContact O-N 3.4Å; R114-E118 PolarHBondContact O-N 3.3Å
115	S	88.7	Confident	84.7	Confident	60 Å²	60	67.6 Å²	67.6	42%	0.42	40%	0.396	S	S	.	.	H	α-helix	trans	-57.4	-39.2	176.7	178.3	0	0	0	0	111.5	M111 L117 E118 T119	M111-S115 PolarHBondContact O-N 2.9Å; S115-L117 PolarHBondContact O-N 3.46Å; S115-E118 WeakPolarHBondContact O-CB 3.41Å; S115-E118 PolarHBondContact O-N 3.3Å; S115-T119 PolarHBondContact O-N 2.93Å; S115-T119 PolarHBondContact O-OG1 3.46Å
116	S	88.7	Confident	83.1	Confident	60 Å²	60	72.8 Å²	72.8	42%	0.42	43%	0.429	S	S	.	.	H	α-helix	trans	-65.1	-37.2	174.2	-59.5	0	0	0	0	112.8	F112 V113 R114 M120	F112-S116 WeakPolarHBondContact O-CB 3.5Å; F112-S116 PolarHBondContact O-N 2.95Å; F112-S116 PolarHBondContact O-OG 3.32Å; V113-S116 WeakPolarHBondContact O-CB 3.39Å; V113-S116 PolarHBondContact O-N 2.96Å; R114-S116 PolarHBondContact O-N 3.08Å; S116-M120 WeakPolarHBondContact O-CB 3.16Å; S116-M120 WeakPolarHBondContact O-CG 3.38Å; S116-M120 PolarHBondContact O-N 3.34Å
117	L	88.6	Confident	81.8	Confident	12 Å²	12	71 Å²	71	6%	0.063	44%	0.437	C	S	.	.	H	α-helix	trans	-65.6	-41	175.5	-65.6	178.9	0	0	0	111.6	L40 V100 V113 R114 S115 M120 A121 K132 P134	L40-L117 HydrophobicContact CD2-CB 4.29Å; V100-L117 HydrophobicContact CB-CD1 4.07Å; V100-L117 HydrophobicContact CG1-CD1 4.21Å; V100-L117 HydrophobicContact CG1-CD2 4.5Å; V100-L117 HydrophobicContact CG2-CD1 4.23Å; V100-L117 HydrophobicContact CG2-CD2 3.89Å; V113-L117 HydrophobicContact CG1-CD1 4.49Å; V113-L117 WeakPolarHBondContact O-CG 3.44Å; V113-L117 PolarHBondContact O-N 2.9Å; R114-L117 WeakPolarHBondContact O-CA 3.16Å; R114-L117 WeakPolarHBondContact O-CB 3.37Å; R114-L117 PolarHBondContact O-N 3.4Å; S115-L117 PolarHBondContact O-N 3.46Å; L117-M120 PolarHBondContact O-N 3.2Å; L117-A121 WeakPolarHBondContact O-CB 3.38Å; L117-A121 PolarHBondContact O-N 3.46Å; L117-K132 HydrophobicContact CB-CD 4.03Å; L117-K132 HydrophobicContact CD2-CD 3.8Å; L117-K132 HydrophobicContact CD2-CG 4.44Å; L117-K132 HydrophobicContact CG-CD 4.46Å; L117-P134 HydrophobicContact CD1-CB 4.22Å
118	E	88.7	Confident	81	Confident	51 Å²	51	65.6 Å²	65.6	24%	0.238	40%	0.402	C	S	.	.	H	α-helix	trans	-61.4	-54.6	173.8	-74.7	174.5	-176.3	0	0	111.1	L40 F47 Y49 R114 S115 M120 A121 S122	L40-E118 HydrophobicContact CD1-CG 3.93Å; L40-E118 HydrophobicContact CD2-CG 4.07Å; F47-E118 HydrophobicContact CB-CG 4.39Å; F47-E118 HydrophobicContact CD1-CB 4.27Å; F47-E118 HydrophobicContact CD1-CG 3.94Å; F47-E118 HydrophobicContact CD2-CB 3.98Å; F47-E118 HydrophobicContact CD2-CG 3.94Å; F47-E118 HydrophobicContact CE1-CB 3.96Å; F47-E118 HydrophobicContact CE1-CG 4.12Å; F47-E118 WeakPolarHBondContact CE1-O 3.45Å; F47-E118 HydrophobicContact CE2-CB 3.67Å; F47-E118 HydrophobicContact CE2-CG 4.15Å; F47-E118 HydrophobicContact CG-CB 4.25Å; F47-E118 HydrophobicContact CG-CG 3.81Å; F47-E118 VanDerWaalsContact CZ-C 3.47Å; F47-E118 HydrophobicContact CZ-CB 3.63Å; F47-E118 HydrophobicContact CZ-CG 4.21Å; F47-E118 WeakPolarHBondContact CZ-O 3.3Å; Y49-E118 PolarHBondContact OH-OE1 3.38Å; R114-E118 PolarHBondContact O-N 3.3Å; S115-E118 WeakPolarHBondContact O-CB 3.41Å; S115-E118 PolarHBondContact O-N 3.3Å; E118-M120 VanDerWaalsContact C-N 3.26Å; E118-M120 PolarHBondContact O-N 3.21Å; E118-A121 CarbonylContact O-C 3.55Å; E118-A121 WeakPolarHBondContact O-CA 3.08Å; E118-A121 WeakPolarHBondContact O-CB 3.14Å; E118-A121 PolarHBondContact O-N 3.15Å; E118-S122 PolarHBondContact O-N 3.26Å
119	T	87.4	Confident	80	Confident	75 Å²	75	64.1 Å²	64.1	46%	0.46	37%	0.373	S	S	.	.	H	α-helix	trans	-54.9	-42.5	177	-53.9	0	0	0	0	112.3	S115 A121 S122 H123	S115-T119 PolarHBondContact O-N 2.93Å; S115-T119 PolarHBondContact O-OG1 3.46Å; T119-A121 VanDerWaalsContact C-N 3.32Å; T119-A121 PolarHBondContact O-N 3.02Å; T119-S122 PolarHBondContact O-N 2.95Å; T119-H123 PolarHBondContact O-CD2 3.47Å; T119-H123 PolarHBondContact O-N 3.4Å
120	M	83.6	Confident	79.6	Confident	62 Å²	62	64.4 Å²	64.4	31%	0.305	37%	0.372	S	S	.	.	H	α-helix	trans	-65.1	-35.6	175.9	-73.5	179	79.1	0	0	112.7	S116 L117 E118 H123 A124 K132	S116-M120 WeakPolarHBondContact O-CB 3.16Å; S116-M120 WeakPolarHBondContact O-CG 3.38Å; S116-M120 PolarHBondContact O-N 3.34Å; L117-M120 PolarHBondContact O-N 3.2Å; E118-M120 VanDerWaalsContact C-N 3.26Å; E118-M120 PolarHBondContact O-N 3.21Å; M120-H123 PolarHBondContact O-N 3.04Å; M120-A124 PolarHBondContact O-N 3.21Å; M120-K132 PolarHBondContact SD-NZ 2.93Å; M120-K132 VanDerWaalsContact SD-NZ 3.4Å
121	A	84.6	Confident	79.5	Confident	19 Å²	19	66 Å²	66	16%	0.157	37%	0.374	C	S	.	.	H	α-helix	trans	-72.1	-33.8	176.7	0	0	0	0	0	112.1	L40 F47 L117 E118 T119 H123 A124	L40-A121 HydrophobicContact CD2-CB 3.73Å; L40-A121 HydrophobicContact CG-CB 4.49Å; F47-A121 HydrophobicContact CE1-CB 3.95Å; L117-A121 WeakPolarHBondContact O-CB 3.38Å; L117-A121 PolarHBondContact O-N 3.46Å; E118-A121 CarbonylContact O-C 3.55Å; E118-A121 WeakPolarHBondContact O-CA 3.08Å; E118-A121 WeakPolarHBondContact O-CB 3.14Å; E118-A121 PolarHBondContact O-N 3.15Å; T119-A121 VanDerWaalsContact C-N 3.32Å; T119-A121 PolarHBondContact O-N 3.02Å; A121-H123 VanDerWaalsContact C-N 3.27Å; A121-H123 PolarHBondContact O-N 3.3Å; A121-A124 WeakPolarHBondContact O-CB 3.37Å; A121-A124 PolarHBondContact O-N 3.1Å; A121-A124 VanDerWaalsContact O-N 3.08Å
122	S	81.6	Confident	79.6	Confident	64 Å²	64	60.6 Å²	60.6	45%	0.448	35%	0.347	S	S	.	.	H	α-helix	trans	-60.6	-35.8	170.6	-68.3	0	0	0	0	113	F47 E118 T119 A124	F47-S122 WeakPolarHBondContact CZ-OG 3.3Å; E118-S122 PolarHBondContact O-N 3.26Å; T119-S122 PolarHBondContact O-N 2.95Å; S122-A124 PolarHBondContact O-N 2.91Å
123	H	77	Confident	79.4	Confident	164 Å²	164	53.7 Å²	53.7	76%	0.759	32%	0.317	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78	-12.4	177.7	-70.2	-159	0	0	0	112.5	T119 M120 A121	T119-H123 PolarHBondContact O-CD2 3.47Å; T119-H123 PolarHBondContact O-N 3.4Å; M120-H123 PolarHBondContact O-N 3.04Å; A121-H123 VanDerWaalsContact C-N 3.27Å; A121-H123 PolarHBondContact O-N 3.3Å
124	A	72.1	Confident	79.2	Confident	26 Å²	26	52.5 Å²	52.5	22%	0.215	31%	0.31	C	S	.	.	S	Bend	trans	-89	126.3	174.1	0	0	0	0	0	108.8	M120 A121 S122	M120-A124 PolarHBondContact O-N 3.21Å; A121-A124 WeakPolarHBondContact O-CB 3.37Å; A121-A124 PolarHBondContact O-N 3.1Å; A121-A124 VanDerWaalsContact O-N 3.08Å; S122-A124 PolarHBondContact O-N 2.91Å
125	V	62.8	Low	79	Confident	94 Å²	94	51.2 Å²	51.2	57%	0.57	31%	0.308	S	S	*	.	P	Polyproline II helix	trans	-55.1	144.2	176.7	-72.4	0	0	0	0	111.6	G127 S128	V125-G127 PolarHBondContact O-N 3.17Å; V125-S128 WeakPolarHBondContact O-CA 3.43Å; V125-S128 WeakPolarHBondContact O-CB 3.17Å; V125-S128 PolarHBondContact O-N 3.03Å
126	P	55.6	Low	78.5	Confident	116 Å²	116	50.8 Å²	50.8	75%	0.753	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.9	130.3	171.8	-26.6	34.6	0	0	0	111
127	G	60.4	Low	78	Confident	68 Å²	68	50.3 Å²	50.3	70%	0.701	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.1	18.2	-170	0	0	0	0	0	114.8	V125	V125-G127 PolarHBondContact O-N 3.17Å
128	S	68.3	Low	77.4	Confident	13 Å²	13	52.4 Å²	52.4	9%	0.091	31%	0.309	C	S	.	.			trans	-47.1	148.3	179.9	-179.3	0	0	0	0	114.7	Q95 V125 M130	Q95-S128 PolarHBondContact NE2-O 3.39Å; Q95-S128 VanDerWaalsContact NE2-O 3.15Å; V125-S128 WeakPolarHBondContact O-CA 3.43Å; V125-S128 WeakPolarHBondContact O-CB 3.17Å; V125-S128 PolarHBondContact O-N 3.03Å; S128-M130 PolarHBondContact O-N 2.95Å; S128-M130 VanDerWaalsContact O-N 3.16Å; S128-M130 PolarHBondContact OG-N 3.34Å
129	W	67	Low	76.7	Confident	44 Å²	44	52.5 Å²	52.5	17%	0.167	31%	0.313	C	S	.	.	S	Bend	trans	-60.9	-12.3	165.8	60.7	-94	0	0	0	112.7	I81 I84 K85 H91 Q95 T96	I81-W129 HydrophobicContact CG2-CH2 4.02Å; I84-W129 HydrophobicContact CB-CZ3 4.34Å; I84-W129 HydrophobicContact CG2-CE3 3.75Å; I84-W129 HydrophobicContact CG2-CZ3 3.69Å; K85-W129 HydrophobicContact CB-CH2 3.95Å; K85-W129 HydrophobicContact CB-CZ2 3.63Å; K85-W129 HydrophobicContact CD-CZ2 4.28Å; K85-W129 HydrophobicContact CG-CZ2 3.81Å; H91-W129 AromaticContact NE2-CD1 3.64Å; Q95-W129 CarbonylContact C-O 3.58Å; T96-W129 WeakPolarHBondContact CA-O 3.3Å; T96-W129 PolarHBondContact N-O 2.87Å
130	M	78.4	Confident	76	Confident	32 Å²	32	51.1 Å²	51.1	16%	0.158	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	122.3	179.3	-164.6	177	-161.4	0	0	112	I81 T96 T98 S128	I81-M130 HydrophobicContact CD1-CE 3.74Å; I81-M130 HydrophobicContact CG1-CE 4.47Å; T96-M130 CarbonylContact O-C 3.59Å; T96-M130 WeakPolarHBondContact O-CA 3.07Å; T98-M130 VanDerWaalsContact OG1-CE 3.27Å; T98-M130 WeakPolarHBondContact OG1-CE 3.39Å; S128-M130 PolarHBondContact O-N 2.95Å; S128-M130 VanDerWaalsContact O-N 3.16Å; S128-M130 PolarHBondContact OG-N 3.34Å
131	K	84.4	Confident	75.5	Confident	49 Å²	49	50.3 Å²	50.3	21%	0.213	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	143.1	167.4	-70.9	-173.8	173.5	-59.1	0	110.6	E39 Q95 T96 T97 T98	E39-K131 WeakPolarHBondContact OE1-CD 3.37Å; E39-K131 WeakPolarHBondContact OE1-CE 3.5Å; E39-K131 IonicContact OE1-NZ 2.7Å; E39-K131 PolarHBondContact OE1-NZ 3.46Å; Q95-K131 VanDerWaalsContact CD-CE 3.46Å; Q95-K131 HydrophobicContact CG-CG 4.36Å; Q95-K131 VanDerWaalsContact NE2-CE 3.32Å; T96-K131 PolarHBondContact O-N 3.11Å; T97-K131 HydrophobicContact CG2-CB 4.21Å; T98-K131 PolarHBondContact N-O 2.77Å
132	K	87.9	Confident	74.9	Confident	17 Å²	17	52.6 Å²	52.6	7%	0.074	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	132.9	176.3	-72.6	172.3	176.5	-74.6	0	110	L40 T98 L117 M120	L40-K132 HydrophobicContact CB-CB 4.44Å; L40-K132 PolarHBondContact N-O 2.88Å; T98-K132 WeakPolarHBondContact O-CA 3.37Å; L117-K132 HydrophobicContact CB-CD 4.03Å; L117-K132 HydrophobicContact CD2-CD 3.8Å; L117-K132 HydrophobicContact CD2-CG 4.44Å; L117-K132 HydrophobicContact CG-CD 4.46Å; M120-K132 PolarHBondContact SD-NZ 2.93Å; M120-K132 VanDerWaalsContact SD-NZ 3.4Å
133	V	85.7	Confident	74.4	Confident	0 Å²	0	51.7 Å²	51.7	0%	0	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	88.4	-178.7	-171.7	0	0	0	0	108.1	I34 G38 E39 W52 T97 T98 I99 V100 L135	I34-V133 HydrophobicContact CB-CG1 4.08Å; I34-V133 HydrophobicContact CD1-CB 4.47Å; I34-V133 HydrophobicContact CD1-CG1 3.5Å; I34-V133 HydrophobicContact CG1-CG1 4.37Å; I34-V133 HydrophobicContact CG2-CG1 4Å; G38-V133 CarbonylContact O-C 3.56Å; G38-V133 VanDerWaalsContact O-CA 3.28Å; G38-V133 WeakPolarHBondContact O-CA 3.3Å; G38-V133 VanDerWaalsContact O-CG1 3.3Å; G38-V133 WeakPolarHBondContact O-CG1 3.23Å; E39-V133 HydrophobicContact CB-CG2 4.39Å; W52-V133 HydrophobicContact CB-CG1 3.89Å; W52-V133 HydrophobicContact CB-CG2 4.4Å; W52-V133 HydrophobicContact CD2-CG1 4.24Å; W52-V133 HydrophobicContact CD2-CG2 4.08Å; W52-V133 HydrophobicContact CE3-CG1 4.47Å; W52-V133 HydrophobicContact CG-CG1 4Å; W52-V133 HydrophobicContact CG-CG2 3.81Å; T97-V133 HydrophobicContact CG2-CG2 3.87Å; T98-V133 PolarHBondContact O-N 2.98Å; I99-V133 CarbonylContact C-O 3.58Å; I99-V133 VanDerWaalsContact CA-O 3.3Å; I99-V133 WeakPolarHBondContact CA-O 3.45Å; I99-V133 HydrophobicContact CG1-CB 4.14Å; V100-V133 PolarHBondContact N-O 3.03Å; V133-L135 PolarHBondContact O-N 3.36Å
134	P	85.2	Confident	74.2	Confident	1 Å²	1	42.3 Å²	42.3	1%	0.006	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.7	128.2	169.5	22.1	-31.3	0	0	0	110.1	R37 G38 Y49 V100 T102 L117	R37-P134 HydrophobicContact CB-CG 4.09Å; G38-P134 WeakPolarHBondContact O-CD 3.12Å; Y49-P134 HydrophobicContact CD1-CG 4.22Å; Y49-P134 HydrophobicContact CE1-CG 3.76Å; V100-P134 WeakPolarHBondContact O-CA 3.33Å; T102-P134 HydrophobicContact CG2-CB 3.78Å; L117-P134 HydrophobicContact CD1-CB 4.22Å
135	L	82.3	Confident	74.4	Confident	48 Å²	48	43.8 Å²	43.8	25%	0.251	27%	0.271	S	S	.	.			trans	-86.4	0	158.9	-59.2	160.6	0	0	0	107.4	I34 H66 I99 V100 N101 T102 V133	I34-L135 HydrophobicContact CB-CD2 4.12Å; I34-L135 HydrophobicContact CD1-CD2 3.39Å; I34-L135 HydrophobicContact CD1-CG 4.18Å; I34-L135 HydrophobicContact CG1-CD2 3.46Å; I34-L135 VanDerWaalsContact CG1-CD2 3.46Å; I34-L135 HydrophobicContact CG2-CD2 3.59Å; H66-L135 VanDerWaalsContact NE2-CD1 3.32Å; H66-L135 WeakPolarHBondContact NE2-CD1 3.49Å; I99-L135 HydrophobicContact CG2-CD1 3.45Å; I99-L135 VanDerWaalsContact CG2-CD1 3.45Å; I99-L135 HydrophobicContact CG2-CD2 4.11Å; I99-L135 HydrophobicContact CG2-CG 3.52Å; V100-L135 PolarHBondContact O-N 3.23Å; N101-L135 HydrophobicContact CB-CD1 4.13Å; T102-L135 WeakPolarHBondContact CA-O 3.49Å; T102-L135 VanDerWaalsContact CB-O 3.27Å; T102-L135 WeakPolarHBondContact CB-O 3.33Å; T102-L135 PolarHBondContact N-O 2.94Å; T102-L135 PolarHBondContact OG1-O 2.82Å; V133-L135 PolarHBondContact O-N 3.36Å

Retrieved 135 of 135 residues in 110 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).