A0A077ZHM3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHM3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 134 aa.

						>A0A077ZHM3_TRITR|A0A077ZHM3
TLCKSDADHAYYRARVLLLSTLGISVDLSGTDQCSTSDSTSKEVEPSVFRERKHIALQHGRVNNGRLDLSVSDIKYCFETEPCQFGQYKQSQNDLLVYMIIPSWCTCNSHQSCQVDRWDRVRKAEIYTCQSNLE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	32.6	Very low	43.6	Very low	193 Å²	193	107.5 Å²	107.5	100%	1.184	60%	0.602	S	S	*	*				0	118.8	0	-33.3	0	0	0	0	107.4
2	L	34.9	Very low	44.7	Very low	153 Å²	153	108.3 Å²	108.3	80%	0.801	59%	0.59	S	S	*	*			trans	19.8	101.9	-176.9	-104.1	82.3	0	0	0	116.6	K4	L2-K4 VanDerWaalsContact C-N 3.32Å; L2-K4 PolarHBondContact O-N 3.29Å
3	C	32	Very low	45.9	Very low	119 Å²	119	112 Å²	112	80%	0.804	59%	0.59	S	S	*	*			trans	-61.8	96.7	161.6	-62.7	0	0	0	0	108	S5	C3-S5 PolarHBondContact O-N 3.11Å; C3-S5 VanDerWaalsContact O-N 3.11Å
4	K	39.5	Very low	47.2	Very low	116 Å²	116	108.1 Å²	108.1	50%	0.504	58%	0.582	S	S	.	*			trans	-61.9	115.4	179.7	-112.2	175.1	174.7	167.3	0	108	L2 D8	L2-K4 VanDerWaalsContact C-N 3.32Å; L2-K4 PolarHBondContact O-N 3.29Å; K4-D8 HydrophobicContact CB-CB 4.2Å; K4-D8 HydrophobicContact CD-CB 4.19Å; K4-D8 HydrophobicContact CG-CB 3.8Å
5	S	44.1	Very low	48.4	Very low	63 Å²	63	109.9 Å²	109.9	44%	0.441	58%	0.577	S	S	.	*			trans	-51.1	144.6	178.3	-171.6	0	0	0	0	110.2	C3 A7 D8 H9	C3-S5 PolarHBondContact O-N 3.11Å; C3-S5 VanDerWaalsContact O-N 3.11Å; S5-A7 PolarHBondContact O-N 3.39Å; S5-D8 WeakPolarHBondContact O-CA 3.37Å; S5-D8 WeakPolarHBondContact O-CB 3.35Å; S5-D8 PolarHBondContact O-N 3.15Å; S5-H9 PolarHBondContact O-N 2.99Å
6	D	43.1	Very low	49.2	Very low	137 Å²	137	105.1 Å²	105.1	73%	0.733	55%	0.553	S	S	*	*	H	α-helix	trans	-49.4	-26.1	-179.3	-67.9	-50.8	0	0	0	114.2	H9 A10	D6-H9 WeakPolarHBondContact O-CB 3.18Å; D6-H9 PolarHBondContact O-N 2.84Å; D6-A10 PolarHBondContact O-N 3.35Å
7	A	45.9	Very low	50	Low	37 Å²	37	105.6 Å²	105.6	31%	0.306	56%	0.556	S	S	.	*	H	α-helix	trans	-72.7	-36.2	174.8	0	0	0	0	0	113.8	S5 H9 A10 Y11 K53	S5-A7 PolarHBondContact O-N 3.39Å; A7-H9 PolarHBondContact O-N 2.6Å; A7-A10 PolarHBondContact O-N 3.08Å; A7-Y11 PolarHBondContact O-N 3.29Å; A7-K53 HydrophobicContact CB-CD 4.25Å; A7-K53 VanDerWaalsContact CB-CE 3.47Å
8	D	47	Very low	50.8	Low	75 Å²	75	106.1 Å²	106.1	40%	0.401	56%	0.558	S	S	.	*	H	α-helix	trans	-65.6	-34.5	170.5	-73.4	-23.3	0	0	0	109.7	K4 S5 Y12	K4-D8 HydrophobicContact CB-CB 4.2Å; K4-D8 HydrophobicContact CD-CB 4.19Å; K4-D8 HydrophobicContact CG-CB 3.8Å; S5-D8 WeakPolarHBondContact O-CA 3.37Å; S5-D8 WeakPolarHBondContact O-CB 3.35Å; S5-D8 PolarHBondContact O-N 3.15Å; D8-Y12 VanDerWaalsContact O-CB 3.28Å; D8-Y12 WeakPolarHBondContact O-CB 3.13Å; D8-Y12 PolarHBondContact O-N 2.87Å
9	H	50.1	Low	51.3	Low	88 Å²	88	102.9 Å²	102.9	41%	0.407	54%	0.541	S	S	.	.	H	α-helix	trans	-67.4	-38.8	175.2	-169.9	-145.9	0	0	0	112	S5 D6 A7 Y12 R13	S5-H9 PolarHBondContact O-N 2.99Å; D6-H9 WeakPolarHBondContact O-CB 3.18Å; D6-H9 PolarHBondContact O-N 2.84Å; A7-H9 PolarHBondContact O-N 2.6Å; H9-Y12 PolarHBondContact O-N 2.96Å; H9-R13 VanDerWaalsContact CE1-CZ 3.45Å; H9-R13 PolarHBondContact CE1-NE 2.04Å; H9-R13 PolarHBondContact CE1-NH2 2.92Å; H9-R13 PolarHBondContact NE2-NE 2.02Å; H9-R13 WeakPolarHBondContact O-CB 3.01Å; H9-R13 VanDerWaalsContact O-CG 3.28Å; H9-R13 WeakPolarHBondContact O-CG 3.02Å; H9-R13 PolarHBondContact O-N 3.32Å
10	A	53.3	Low	51.4	Low	58 Å²	58	101 Å²	101	48%	0.479	54%	0.537	S	S	.	.	H	α-helix	trans	-65.7	-44.9	173.7	0	0	0	0	0	112.5	D6 A7 Y12 R13 A14	D6-A10 PolarHBondContact O-N 3.35Å; A7-A10 PolarHBondContact O-N 3.08Å; A10-Y12 VanDerWaalsContact C-N 3.34Å; A10-R13 PolarHBondContact O-N 3.04Å; A10-A14 WeakPolarHBondContact O-CB 3.39Å; A10-A14 PolarHBondContact O-N 3.28Å
11	Y	57.6	Low	51.8	Low	143 Å²	143	101.7 Å²	101.7	56%	0.561	55%	0.545	S	S	*	.	H	α-helix	trans	-61.9	-42.2	172.9	176	-94.9	0	0	0	111.3	A7 A14 R15	A7-Y11 PolarHBondContact O-N 3.29Å; Y11-A14 PolarHBondContact O-N 3.49Å; Y11-R15 VanDerWaalsContact O-CB 3.25Å; Y11-R15 WeakPolarHBondContact O-CB 3.09Å; Y11-R15 PolarHBondContact O-N 3.04Å; Y11-R15 PolarHBondContact OH-NH1 3.41Å
12	Y	56.4	Low	53.2	Low	118 Å²	118	98.2 Å²	98.2	46%	0.463	52%	0.519	S	S	.	.	H	α-helix	trans	-62.2	-43.4	175.5	-120.6	-99.5	0	0	0	111.5	D8 H9 A10 R15 V16	D8-Y12 VanDerWaalsContact O-CB 3.28Å; D8-Y12 WeakPolarHBondContact O-CB 3.13Å; D8-Y12 PolarHBondContact O-N 2.87Å; H9-Y12 PolarHBondContact O-N 2.96Å; A10-Y12 VanDerWaalsContact C-N 3.34Å; Y12-R15 PolarHBondContact O-N 2.86Å; Y12-V16 HydrophobicContact CD1-CG2 4.4Å; Y12-V16 WeakPolarHBondContact O-CB 3.47Å; Y12-V16 WeakPolarHBondContact O-CG2 2.87Å; Y12-V16 PolarHBondContact O-N 3.42Å
13	R	59.8	Low	53.9	Low	156 Å²	156	94 Å²	94	59%	0.589	51%	0.512	S	S	*	.	H	α-helix	trans	-63.1	-46.8	176.1	-77.7	177.8	175.2	-160.1	-5	111.8	H9 A10 R15 V16 L17	H9-R13 VanDerWaalsContact CE1-CZ 3.45Å; H9-R13 PolarHBondContact CE1-NE 2.04Å; H9-R13 PolarHBondContact CE1-NH2 2.92Å; H9-R13 PolarHBondContact NE2-NE 2.02Å; H9-R13 WeakPolarHBondContact O-CB 3.01Å; H9-R13 VanDerWaalsContact O-CG 3.28Å; H9-R13 WeakPolarHBondContact O-CG 3.02Å; H9-R13 PolarHBondContact O-N 3.32Å; A10-R13 PolarHBondContact O-N 3.04Å; R13-R15 VanDerWaalsContact C-N 3.28Å; R13-R15 PolarHBondContact O-N 3.49Å; R13-V16 PolarHBondContact O-N 3.25Å; R13-L17 WeakPolarHBondContact O-CB 3.47Å; R13-L17 WeakPolarHBondContact O-CG 3.02Å; R13-L17 PolarHBondContact O-N 3.45Å
14	A	64.2	Low	54.6	Low	57 Å²	57	92.5 Å²	92.5	47%	0.471	50%	0.496	S	S	.	.	H	α-helix	trans	-60.4	-40.1	176.6	0	0	0	0	0	111.5	A10 Y11 L17 L18	A10-A14 WeakPolarHBondContact O-CB 3.39Å; A10-A14 PolarHBondContact O-N 3.28Å; Y11-A14 PolarHBondContact O-N 3.49Å; A14-L17 PolarHBondContact O-N 2.86Å; A14-L18 WeakPolarHBondContact O-CB 3.43Å; A14-L18 PolarHBondContact O-N 3.48Å
15	R	64.9	Low	55	Low	136 Å²	136	92.7 Å²	92.7	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-69.6	-40.8	176.6	-172.9	171.8	173.8	156.9	-4.2	112.6	Y11 Y12 R13 L18 L19	Y11-R15 VanDerWaalsContact O-CB 3.25Å; Y11-R15 WeakPolarHBondContact O-CB 3.09Å; Y11-R15 PolarHBondContact O-N 3.04Å; Y11-R15 PolarHBondContact OH-NH1 3.41Å; Y12-R15 PolarHBondContact O-N 2.86Å; R13-R15 VanDerWaalsContact C-N 3.28Å; R13-R15 PolarHBondContact O-N 3.49Å; R15-L18 PolarHBondContact O-N 3.36Å; R15-L19 HydrophobicContact CG-CD1 4.08Å; R15-L19 WeakPolarHBondContact O-CB 3.03Å; R15-L19 VanDerWaalsContact O-CG 3.24Å; R15-L19 WeakPolarHBondContact O-CG 3.22Å; R15-L19 PolarHBondContact O-N 3.1Å
16	V	61.2	Low	55.4	Low	32 Å²	32	92.8 Å²	92.8	19%	0.194	51%	0.509	C	S	.	.	H	α-helix	trans	-63.6	-42.4	174.5	169.5	0	0	0	0	110.3	Y12 R13 L19 S20	Y12-V16 HydrophobicContact CD1-CG2 4.4Å; Y12-V16 WeakPolarHBondContact O-CB 3.47Å; Y12-V16 WeakPolarHBondContact O-CG2 2.87Å; Y12-V16 PolarHBondContact O-N 3.42Å; R13-V16 PolarHBondContact O-N 3.25Å; V16-L19 PolarHBondContact O-N 2.96Å; V16-S20 WeakPolarHBondContact O-CB 3.21Å; V16-S20 PolarHBondContact O-N 2.87Å; V16-S20 PolarHBondContact O-OG 2.83Å
17	L	63.3	Low	55.3	Low	115 Å²	115	92.8 Å²	92.8	60%	0.602	51%	0.509	S	S	*	.	H	α-helix	trans	-61.1	-46.2	174.2	-73.5	169.9	0	0	0	111.4	R13 A14 L19 S20 T21	R13-L17 WeakPolarHBondContact O-CB 3.47Å; R13-L17 WeakPolarHBondContact O-CG 3.02Å; R13-L17 PolarHBondContact O-N 3.45Å; A14-L17 PolarHBondContact O-N 2.86Å; L17-L19 VanDerWaalsContact C-N 3.32Å; L17-L19 PolarHBondContact O-N 2.03Å; L17-S20 WeakPolarHBondContact CA-OG 3.08Å; L17-S20 PolarHBondContact O-N 2.92Å; L17-S20 PolarHBondContact O-OG 3.08Å; L17-T21 PolarHBondContact O-N 3.18Å; L17-T21 PolarHBondContact O-OG1 2.59Å
18	L	64.8	Low	55.3	Low	114 Å²	114	96.7 Å²	96.7	60%	0.597	52%	0.524	S	S	*	.	H	α-helix	trans	-64.7	-33.4	177.6	-158.3	109.2	0	0	0	113.1	A14 R15 T21 L22	A14-L18 WeakPolarHBondContact O-CB 3.43Å; A14-L18 PolarHBondContact O-N 3.48Å; R15-L18 PolarHBondContact O-N 3.36Å; L18-T21 PolarHBondContact O-OG1 3.05Å; L18-L22 WeakPolarHBondContact O-CD1 3.17Å; L18-L22 VanDerWaalsContact O-CG 3.31Å; L18-L22 WeakPolarHBondContact O-CG 3.34Å; L18-L22 PolarHBondContact O-N 3.4Å
19	L	60.8	Low	55	Low	45 Å²	45	98.3 Å²	98.3	24%	0.236	54%	0.542	C	S	.	.	H	α-helix	trans	-75.1	-36.9	175.4	-71.9	169.4	0	0	0	111.4	R15 V16 L17 T21 L22 G23 I24 V26	R15-L19 HydrophobicContact CG-CD1 4.08Å; R15-L19 WeakPolarHBondContact O-CB 3.03Å; R15-L19 VanDerWaalsContact O-CG 3.24Å; R15-L19 WeakPolarHBondContact O-CG 3.22Å; R15-L19 PolarHBondContact O-N 3.1Å; V16-L19 PolarHBondContact O-N 2.96Å; L17-L19 VanDerWaalsContact C-N 3.32Å; L17-L19 PolarHBondContact O-N 2.03Å; L19-T21 PolarHBondContact O-N 3.15Å; L19-L22 CarbonylContact O-C 3.51Å; L19-L22 WeakPolarHBondContact O-CA 3.15Å; L19-L22 WeakPolarHBondContact O-CB 3.28Å; L19-L22 PolarHBondContact O-N 2.72Å; L19-L22 VanDerWaalsContact O-N 3.09Å; L19-G23 PolarHBondContact O-N 3.1Å; L19-I24 HydrophobicContact CB-CB 4.28Å; L19-I24 HydrophobicContact CD2-CD1 3.79Å; L19-I24 WeakPolarHBondContact O-CB 3.37Å; L19-I24 PolarHBondContact O-N 3.36Å; L19-V26 HydrophobicContact CB-CG2 4.45Å; L19-V26 HydrophobicContact CD1-CG2 4.2Å
20	S	51.7	Low	54.4	Low	64 Å²	64	97.5 Å²	97.5	45%	0.448	56%	0.557	S	S	.	*	H	α-helix	trans	-66.2	-35.8	176.6	68.8	0	0	0	0	112.6	V16 L17 L22 G23	V16-S20 WeakPolarHBondContact O-CB 3.21Å; V16-S20 PolarHBondContact O-N 2.87Å; V16-S20 PolarHBondContact O-OG 2.83Å; L17-S20 WeakPolarHBondContact CA-OG 3.08Å; L17-S20 PolarHBondContact O-N 2.92Å; L17-S20 PolarHBondContact O-OG 3.08Å; S20-L22 PolarHBondContact O-N 3.37Å; S20-G23 PolarHBondContact O-N 2.94Å
21	T	59.6	Low	53.8	Low	117 Å²	117	100.2 Å²	100.2	72%	0.718	57%	0.568	S	S	*	*	H	α-helix	trans	-68.2	-21.2	172	52.9	0	0	0	0	113.1	L17 L18 L19 G23	L17-T21 PolarHBondContact O-N 3.18Å; L17-T21 PolarHBondContact O-OG1 2.59Å; L18-T21 PolarHBondContact O-OG1 3.05Å; L19-T21 PolarHBondContact O-N 3.15Å; T21-G23 VanDerWaalsContact C-N 3.3Å
22	L	63	Low	52.8	Low	119 Å²	119	101.1 Å²	101.1	62%	0.623	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	4.6	171.4	-64.7	170.6	0	0	0	113	L18 L19 S20 I24	L18-L22 WeakPolarHBondContact O-CD1 3.17Å; L18-L22 VanDerWaalsContact O-CG 3.31Å; L18-L22 WeakPolarHBondContact O-CG 3.34Å; L18-L22 PolarHBondContact O-N 3.4Å; L19-L22 CarbonylContact O-C 3.51Å; L19-L22 WeakPolarHBondContact O-CA 3.15Å; L19-L22 WeakPolarHBondContact O-CB 3.28Å; L19-L22 PolarHBondContact O-N 2.72Å; L19-L22 VanDerWaalsContact O-N 3.09Å; S20-L22 PolarHBondContact O-N 3.37Å; L22-I24 VanDerWaalsContact C-N 3.33Å; L22-I24 HydrophobicContact CB-CD1 4.17Å; L22-I24 HydrophobicContact CB-CG1 4.35Å
23	G	48.8	Very low	51.6	Low	65 Å²	65	104.4 Å²	104.4	67%	0.67	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	76.6	15.9	-179.5	0	0	0	0	0	114.4	L19 S20 T21	L19-G23 PolarHBondContact O-N 3.1Å; S20-G23 PolarHBondContact O-N 2.94Å; T21-G23 VanDerWaalsContact C-N 3.3Å
24	I	47.1	Very low	50.2	Low	88 Å²	88	102.3 Å²	102.3	45%	0.451	61%	0.61	S	S	.	*			trans	-96.5	109.7	-179.1	-56.5	168.8	0	0	0	108.6	L19 L22	L19-I24 HydrophobicContact CB-CB 4.28Å; L19-I24 HydrophobicContact CD2-CD1 3.79Å; L19-I24 WeakPolarHBondContact O-CB 3.37Å; L19-I24 PolarHBondContact O-N 3.36Å; L22-I24 VanDerWaalsContact C-N 3.33Å; L22-I24 HydrophobicContact CB-CD1 4.17Å; L22-I24 HydrophobicContact CB-CG1 4.35Å
25	S	48	Very low	48.5	Very low	120 Å²	120	104.9 Å²	104.9	84%	0.839	62%	0.624	S	S	*	*			trans	-73.5	127.9	176	-45	0	0	0	0	110.6
26	V	52.4	Low	47.1	Very low	65 Å²	65	105.1 Å²	105.1	39%	0.394	64%	0.641	S	S	.	*			trans	-115.9	116.5	174	-176.8	0	0	0	0	108.2	L19	L19-V26 HydrophobicContact CB-CG2 4.45Å; L19-V26 HydrophobicContact CD1-CG2 4.2Å
27	D	41.3	Very low	45.6	Very low	136 Å²	136	109.1 Å²	109.1	73%	0.727	67%	0.67	S	S	*	*			trans	-73.4	126	176.7	-157.7	-42.9	0	0	0	109.9	S29	D27-S29 WeakPolarHBondContact OD1-CB 3.03Å; D27-S29 PolarHBondContact OD1-N 2.52Å; D27-S29 PolarHBondContact OD1-OG 2.87Å
28	L	45.8	Very low	43.8	Very low	119 Å²	119	111 Å²	111	62%	0.623	68%	0.681	S	S	*	*			trans	-103.4	10.9	-170.9	-84.4	152.2	0	0	0	113.3	G30	L28-G30 PolarHBondContact O-N 3.49Å
29	S	41.5	Very low	42.3	Very low	110 Å²	110	110.7 Å²	110.7	77%	0.769	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.5	18.6	-170.8	49	0	0	0	0	116.9	D27	D27-S29 WeakPolarHBondContact OD1-CB 3.03Å; D27-S29 PolarHBondContact OD1-N 2.52Å; D27-S29 PolarHBondContact OD1-OG 2.87Å
30	G	36.8	Very low	40.7	Very low	70 Å²	70	114.5 Å²	114.5	72%	0.722	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.7	3.2	-167.1	0	0	0	0	0	119.3	L28	L28-G30 PolarHBondContact O-N 3.49Å
31	T	41.9	Very low	39.6	Very low	116 Å²	116	116.6 Å²	116.6	71%	0.712	73%	0.728	S	S	*	*			trans	-125.3	23.7	-163.8	47.4	0	0	0	0	117.9
32	D	34.6	Very low	38.2	Very low	161 Å²	161	120.5 Å²	120.5	86%	0.861	74%	0.735	S	S	*	*			trans	-111.2	60.7	178.7	-70.8	-27.5	0	0	0	113.5
33	Q	31.6	Very low	36.5	Very low	187 Å²	187	123.9 Å²	123.9	87%	0.874	75%	0.748	S	S	*	*			trans	-146.3	83.1	163.2	-68.4	-167.6	46.5	0	0	111.6
34	C	31	Very low	35.7	Very low	112 Å²	112	127.2 Å²	127.2	76%	0.757	76%	0.755	S	S	*	*			trans	-107.5	89.9	163.9	-80.4	0	0	0	0	108.8
35	S	28.7	Very low	35	Very low	111 Å²	111	128.3 Å²	128.3	78%	0.776	76%	0.758	S	S	*	*			trans	-96	107.2	167.8	-58.8	0	0	0	0	108.6
36	T	35.5	Very low	34.4	Very low	142 Å²	142	127.1 Å²	127.1	87%	0.871	75%	0.747	S	S	*	*			trans	-84	110.3	173.5	41.3	0	0	0	0	110.2
37	S	29.3	Very low	33.5	Very low	115 Å²	115	128 Å²	128	80%	0.804	76%	0.757	S	S	*	*			trans	-81.6	141.4	162.6	-37.3	0	0	0	0	110.3
38	D	26.7	Very low	33.3	Very low	156 Å²	156	126.5 Å²	126.5	83%	0.834	75%	0.752	S	S	*	*			trans	-43.5	141.8	176.4	-75.7	-54.1	0	0	0	116.5
39	S	31.3	Very low	33	Very low	107 Å²	107	128.4 Å²	128.4	75%	0.748	76%	0.756	S	S	*	*				168.9	117.6	112.6	-73.5	0	0	0	0	113.1
40	T	28.4	Very low	32.8	Very low	125 Å²	125	131.4 Å²	131.4	77%	0.767	75%	0.75	S	S	*	*			trans	35.3	111.5	136.6	19	0	0	0	0	121.2
41	S	27.8	Very low	32.6	Very low	107 Å²	107	134.7 Å²	134.7	75%	0.748	75%	0.747	S	S	*	*			trans	65.8	95.6	130.9	-54.6	0	0	0	0	119
42	K	30.2	Very low	32.6	Very low	199 Å²	199	137.3 Å²	137.3	87%	0.865	74%	0.744	S	S	*	*				-178.2	104.5	100.3	-93.2	179	-174.1	-177.3	0	108.5	V44	K42-V44 PolarHBondContact O-N 2.99Å; K42-V44 VanDerWaalsContact O-N 3.15Å
43	E	28.5	Very low	32.9	Very low	190 Å²	190	134 Å²	134	89%	0.888	72%	0.721	S	S	*	*			trans	-59.6	108.1	168.6	-69.5	170.1	119.5	0	0	109.6
44	V	31.6	Very low	32.9	Very low	136 Å²	136	131.4 Å²	131.4	82%	0.824	71%	0.709	S	S	*	*			trans	-124.9	78.4	146	-177.2	0	0	0	0	104.7	K42	K42-V44 PolarHBondContact O-N 2.99Å; K42-V44 VanDerWaalsContact O-N 3.15Å
45	E	33.1	Very low	33.3	Very low	110 Å²	110	131.2 Å²	131.2	51%	0.514	70%	0.7	S	S	.	*			trans	-68.5	128.4	176.3	-161.9	-167.7	153.2	0	0	109	S47 R50	E45-S47 PolarHBondContact O-N 2.74Å; E45-R50 WeakPolarHBondContact OE1-CD 3.42Å; E45-R50 IonicContact OE1-CZ 3.94Å; E45-R50 IonicContact OE1-NE 3.61Å; E45-R50 IonicContact OE1-NH1 3.6Å; E45-R50 PolarHBondContact OE1-NH1 3.47Å; E45-R50 IonicContact OE2-NH1 2.79Å
46	P	34.5	Very low	33.8	Very low	95 Å²	95	129 Å²	129	62%	0.617	69%	0.688	S	S	*	*			trans	-74.2	88.2	176	28.7	-32.5	0	0	0	110.5	V48 F49	P46-V48 PolarHBondContact O-N 2.94Å; P46-V48 VanDerWaalsContact O-N 3.1Å; P46-F49 PolarHBondContact O-N 2.69Å
47	S	34.1	Very low	34	Very low	85 Å²	85	129.6 Å²	129.6	59%	0.594	69%	0.685	S	S	*	*	H	α-helix	trans	-57.2	-19.8	177.9	38.2	0	0	0	0	114.6	E45 F49	E45-S47 PolarHBondContact O-N 2.74Å; S47-F49 PolarHBondContact O-N 3.49Å
48	V	37	Very low	34.4	Very low	104 Å²	104	131.3 Å²	131.3	63%	0.63	68%	0.68	S	S	*	*	H	α-helix	trans	-69.6	-29.6	-178.4	-174.6	0	0	0	0	113.2	P46	P46-V48 PolarHBondContact O-N 2.94Å; P46-V48 VanDerWaalsContact O-N 3.1Å
49	F	39.8	Very low	35	Very low	158 Å²	158	130.8 Å²	130.8	69%	0.693	67%	0.672	S	S	*	*	H	α-helix	trans	-86.7	-25.8	-174.6	-144.8	-96.2	0	0	0	113.2	P46 S47	P46-F49 PolarHBondContact O-N 2.69Å; S47-F49 PolarHBondContact O-N 3.49Å
50	R	36	Very low	35.2	Very low	173 Å²	173	128.4 Å²	128.4	65%	0.653	67%	0.665	S	S	*	*	H	α-helix	trans	-78.4	-35.7	-179.1	-138.3	173.2	-176	173.4	-4.7	111.9	E45 R52 K53	E45-R50 WeakPolarHBondContact OE1-CD 3.42Å; E45-R50 IonicContact OE1-CZ 3.94Å; E45-R50 IonicContact OE1-NE 3.61Å; E45-R50 IonicContact OE1-NH1 3.6Å; E45-R50 PolarHBondContact OE1-NH1 3.47Å; E45-R50 IonicContact OE2-NH1 2.79Å; R50-R52 PolarHBondContact O-N 3.45Å; R50-K53 PolarHBondContact O-N 3.44Å
51	E	33.8	Very low	35.4	Very low	140 Å²	140	133.2 Å²	133.2	65%	0.654	67%	0.669	S	S	*	*	H	α-helix	trans	-70.1	-33.2	-175.9	-156.1	163	-167.4	0	0	112.9	K53 H54	E51-K53 VanDerWaalsContact C-N 3.34Å; E51-K53 PolarHBondContact O-N 3.43Å; E51-H54 PolarHBondContact O-N 3.37Å
52	R	40.4	Very low	35.8	Very low	170 Å²	170	134.4 Å²	134.4	64%	0.642	67%	0.672	S	S	*	*	H	α-helix	trans	-69.9	-25.7	178.8	-70.5	-173.8	179.2	-166.3	0.1	114.3	R50	R50-R52 PolarHBondContact O-N 3.45Å
53	K	41.1	Very low	36.1	Very low	91 Å²	91	130.1 Å²	130.1	40%	0.396	66%	0.658	S	S	.	*	H	α-helix	trans	-74	-30.7	177.5	-92.1	-180	179.2	168.1	0	112.7	A7 R50 E51	A7-K53 HydrophobicContact CB-CD 4.25Å; A7-K53 VanDerWaalsContact CB-CE 3.47Å; R50-K53 PolarHBondContact O-N 3.44Å; E51-K53 VanDerWaalsContact C-N 3.34Å; E51-K53 PolarHBondContact O-N 3.43Å
54	H	33.1	Very low	36.8	Very low	134 Å²	134	129 Å²	129	62%	0.62	66%	0.658	S	S	*	*	H	α-helix	trans	-72.4	-33.2	179.2	-104	-83.6	0	0	0	112.9	E51 A56	E51-H54 PolarHBondContact O-N 3.37Å; H54-A56 VanDerWaalsContact C-N 3.34Å; H54-A56 PolarHBondContact O-N 3.47Å
55	I	38.4	Very low	37.2	Very low	108 Å²	108	126 Å²	126	55%	0.554	66%	0.655	S	S	*	*	H	α-helix	trans	-67.8	-35.3	179.6	-59.3	171.9	0	0	0	111.2	L57	I55-L57 PolarHBondContact O-N 3.39Å
56	A	39.4	Very low	37.2	Very low	64 Å²	64	131.3 Å²	131.3	53%	0.529	67%	0.67	S	S	.	*	H	α-helix	trans	-71.6	-26.8	-177	0	0	0	0	0	114.3	H54	H54-A56 VanDerWaalsContact C-N 3.34Å; H54-A56 PolarHBondContact O-N 3.47Å
57	L	40.4	Very low	37.6	Very low	155 Å²	155	134.7 Å²	134.7	81%	0.812	68%	0.683	S	S	*	*	H	α-helix	trans	-87.2	-21.7	-178.3	-89	156.5	0	0	0	113.6	I55	I55-L57 PolarHBondContact O-N 3.39Å
58	Q	36.9	Very low	38	Very low	150 Å²	150	135.9 Å²	135.9	70%	0.701	68%	0.682	S	S	*	*	H	α-helix	trans	-84.2	-17.9	-177.7	-77.6	-173.4	-18.2	0	0	114.2
59	H	38.7	Very low	38.6	Very low	145 Å²	145	138.4 Å²	138.4	67%	0.671	69%	0.691	S	S	*	*	S	Bend	trans	-111.2	-0.5	-167.7	-76.7	-126.5	0	0	0	115.3	R61	H59-R61 PolarHBondContact O-N 2.79Å
60	G	35.1	Very low	38.9	Very low	58 Å²	58	135.5 Å²	135.5	60%	0.598	69%	0.691	S	S	*	*			trans	-87.6	77.8	173.3	0	0	0	0	0	112.1	V62	G60-V62 PolarHBondContact O-N 3.21Å
61	R	32.9	Very low	39.6	Very low	226 Å²	226	131 Å²	131	85%	0.853	68%	0.682	S	S	*	*			trans	-68.8	96.5	168.6	-134.5	-177.9	-173.6	166.9	1.5	108.1	H59 N63	H59-R61 PolarHBondContact O-N 2.79Å; R61-N63 PolarHBondContact O-N 3.11Å
62	V	37.8	Very low	40.5	Very low	132 Å²	132	129.7 Å²	129.7	80%	0.8	69%	0.689	S	S	*	*			trans	-69.7	93.4	175	-176.1	0	0	0	0	108.3	G60	G60-V62 PolarHBondContact O-N 3.21Å
63	N	36.6	Very low	41.5	Very low	108 Å²	108	126.6 Å²	126.6	58%	0.578	69%	0.685	S	S	*	*			trans	-90.3	104.5	169.2	-79.1	-19.8	0	0	0	109	R61 G65 R66	R61-N63 PolarHBondContact O-N 3.11Å; N63-G65 VanDerWaalsContact C-N 3.31Å; N63-G65 PolarHBondContact O-N 2.77Å; N63-R66 PolarHBondContact O-N 2.87Å
64	N	42.8	Very low	42.6	Very low	166 Å²	166	127.7 Å²	127.7	89%	0.888	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	43.2	44.2	164.3	-68	-4.5	0	0	0	116.7	R66	N64-R66 VanDerWaalsContact C-N 3.27Å; N64-R66 PolarHBondContact O-N 2.79Å
65	G	39.4	Very low	45	Very low	74 Å²	74	126.7 Å²	126.7	76%	0.763	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.2	6.9	167.4	0	0	0	0	0	116.3	N63	N63-G65 VanDerWaalsContact C-N 3.31Å; N63-G65 PolarHBondContact O-N 2.77Å
66	R	33.8	Very low	47.4	Very low	221 Å²	221	127.5 Å²	127.5	83%	0.834	69%	0.685	S	S	*	*			trans	-103	116.1	167.4	-69.3	-176.6	106.8	119	-1.6	108.8	N63 N64 D68	N63-R66 PolarHBondContact O-N 2.87Å; N64-R66 VanDerWaalsContact C-N 3.27Å; N64-R66 PolarHBondContact O-N 2.79Å; R66-D68 PolarHBondContact O-N 2.74Å; R66-D68 VanDerWaalsContact O-N 3.11Å
67	L	42	Very low	49.9	Very low	167 Å²	167	125 Å²	125	87%	0.874	66%	0.663	S	S	*	*			trans	-60.7	110.9	165.5	-88.1	148.4	0	0	0	107.7	L69	L67-L69 PolarHBondContact O-N 2.81Å
68	D	43.2	Very low	52.1	Low	109 Å²	109	123.4 Å²	123.4	58%	0.583	65%	0.65	S	S	*	*			trans	-75.9	100.9	173.9	-169.7	-6.6	0	0	0	108.7	R66 S70	R66-D68 PolarHBondContact O-N 2.74Å; R66-D68 VanDerWaalsContact O-N 3.11Å; D68-S70 VanDerWaalsContact CG-OG 3.25Å; D68-S70 PolarHBondContact O-N 3.13Å; D68-S70 VanDerWaalsContact OD1-CB 3.23Å; D68-S70 WeakPolarHBondContact OD1-CB 3.02Å; D68-S70 PolarHBondContact OD1-N 2.84Å; D68-S70 PolarHBondContact OD1-OG 3.45Å; D68-S70 PolarHBondContact OD2-OG 2.91Å
69	L	49.2	Very low	54.3	Low	158 Å²	158	123.8 Å²	123.8	83%	0.827	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.8	-0.5	178	-70.1	159.7	0	0	0	112.7	L67 V71	L67-L69 PolarHBondContact O-N 2.81Å; L69-V71 VanDerWaalsContact C-N 3.34Å
70	S	46.2	Very low	56.4	Low	97 Å²	97	122.3 Å²	122.3	68%	0.678	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-17.6	180	72.6	0	0	0	0	113.6	D68 S72	D68-S70 VanDerWaalsContact CG-OG 3.25Å; D68-S70 PolarHBondContact O-N 3.13Å; D68-S70 VanDerWaalsContact OD1-CB 3.23Å; D68-S70 WeakPolarHBondContact OD1-CB 3.02Å; D68-S70 PolarHBondContact OD1-N 2.84Å; D68-S70 PolarHBondContact OD1-OG 3.45Å; D68-S70 PolarHBondContact OD2-OG 2.91Å; S70-S72 PolarHBondContact O-N 2.82Å
71	V	50	Low	59	Low	78 Å²	78	121.7 Å²	121.7	47%	0.473	64%	0.635	S	S	.	*	S	Bend	trans	-76.6	118.7	168.9	-171	0	0	0	0	106.8	L69 D73	L69-V71 VanDerWaalsContact C-N 3.34Å; V71-D73 HydrophobicContact CG1-CB 4.35Å; V71-D73 WeakPolarHBondContact CG1-OD2 3.49Å; V71-D73 PolarHBondContact O-N 2.81Å
72	S	52.7	Low	61.9	Low	113 Å²	113	112.3 Å²	112.3	79%	0.79	60%	0.603	S	S	*	*			trans	-68.3	45.8	179.8	52.3	0	0	0	0	113.4	S70 I74	S70-S72 PolarHBondContact O-N 2.82Å; S72-I74 PolarHBondContact O-N 2.87Å
73	D	61.4	Low	64.6	Low	104 Å²	104	106.3 Å²	106.3	56%	0.556	57%	0.566	S	S	*	*			trans	-92.2	31.4	174.6	-71.7	-17.3	0	0	0	110.8	V71 K75	V71-D73 HydrophobicContact CG1-CB 4.35Å; V71-D73 WeakPolarHBondContact CG1-OD2 3.49Å; V71-D73 PolarHBondContact O-N 2.81Å; D73-K75 VanDerWaalsContact C-N 3.32Å; D73-K75 PolarHBondContact O-N 3.36Å
74	I	64	Low	67.3	Low	115 Å²	115	104.2 Å²	104.2	59%	0.59	55%	0.553	S	S	*	*			trans	-66.2	99.1	169.9	-61.7	179.6	0	0	0	106.9	S72 Y76 T106	S72-I74 PolarHBondContact O-N 2.87Å; I74-Y76 PolarHBondContact O-N 3.19Å; I74-T106 HydrophobicContact CG2-CG2 3.25Å
75	K	84.3	Confident	69.7	Low	112 Å²	112	98 Å²	98	49%	0.487	52%	0.519	S	S	.	.	P	Polyproline II helix	trans	-81.5	119.9	176.5	-65.2	-177	-175.8	177.1	0	108.7	D73 W104 C105 T106	D73-K75 VanDerWaalsContact C-N 3.32Å; D73-K75 PolarHBondContact O-N 3.36Å; K75-W104 HydrophobicContact CB-CE3 4.15Å; K75-W104 HydrophobicContact CB-CZ3 3.65Å; K75-W104 HydrophobicContact CD-CE3 4.15Å; K75-W104 HydrophobicContact CD-CZ3 3.65Å; K75-W104 HydrophobicContact CG-CZ3 4.28Å; K75-C105 CarbonylContact O-C 3.58Å; K75-C105 WeakPolarHBondContact O-CA 3.23Å; K75-C105 VanDerWaalsContact O-CB 3.28Å; K75-C105 WeakPolarHBondContact O-CB 3.45Å; K75-T106 PolarHBondContact O-N 2.87Å
76	Y	89.8	Confident	72.2	Confident	126 Å²	126	94.5 Å²	94.5	49%	0.494	48%	0.482	S	S	.	.	B	Isolated β-bridge	trans	-70.9	140.9	171.8	-65.4	-61.5	0	0	0	110.9	I74 T106 N108	I74-Y76 PolarHBondContact O-N 3.19Å; Y76-T106 CarbonylContact C-O 3.5Å; Y76-T106 VanDerWaalsContact CA-O 3.22Å; Y76-T106 WeakPolarHBondContact CA-O 3.42Å; Y76-T106 HydrophobicContact CD1-CG2 4.14Å; Y76-T106 HydrophobicContact CE1-CG2 4.38Å; Y76-N108 WeakPolarHBondContact CB-OD1 3.22Å; Y76-N108 HydrophobicContact CD1-CB 4.4Å; Y76-N108 WeakPolarHBondContact CD1-OD1 3.28Å; Y76-N108 WeakPolarHBondContact CD2-OD1 3.46Å
77	C	90.6	Very high	74.8	Confident	11 Å²	11	87.4 Å²	87.4	7%	0.074	46%	0.459	C	S	.	.	P	Polyproline II helix	trans	-68.1	141.2	176.8	-60.8	0	0	0	0	110.3	E81 C105 T106	C77-E81 HydrophobicContact CB-CB 4.31Å; C77-C105 WeakPolarHBondContact CA-SG 3.16Å; C77-C105 HydrophobicContact CB-CB 3.88Å; C77-C105 WeakPolarHBondContact CB-SG 3.44Å; C77-C105 WeakPolarHBondContact SG-CB 3.44Å; C77-C105 PolarHBondContact SG-O 2.94Å; C77-C105 CovalentContact SG-SG 2.03Å; C77-C105 PolarHBondContact SG-SG 3.49Å; C77-T106 PolarHBondContact N-O 3.31Å; C77-T106 PolarHBondContact SG-N 3.38Å
78	F	87.2	Confident	76.9	Confident	121 Å²	121	85.3 Å²	85.3	53%	0.531	44%	0.44	S	S	.	.	P	Polyproline II helix	trans	-70.1	158.2	160.6	-65.4	-76	0	0	0	110.2	T80 E81	F78-T80 PolarHBondContact O-N 2.96Å; F78-T80 VanDerWaalsContact O-N 3.08Å; F78-E81 HydrophobicContact CB-CG 4.1Å; F78-E81 WeakPolarHBondContact CD2-OE2 3.23Å; F78-E81 PolarHBondContact N-OE2 3Å; F78-E81 WeakPolarHBondContact O-CB 3.35Å; F78-E81 PolarHBondContact O-N 2.96Å
79	E	82.4	Confident	78.7	Confident	158 Å²	158	86.1 Å²	86.1	74%	0.738	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.2	-27.8	-179	-65	177.4	175.4	0	0	113.4
80	T	83	Confident	80.3	Confident	115 Å²	115	84.4 Å²	84.4	71%	0.706	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.5	-9.6	179.1	57	0	0	0	0	113.5	F78	F78-T80 PolarHBondContact O-N 2.96Å; F78-T80 VanDerWaalsContact O-N 3.08Å
81	E	90.5	Very high	81.8	Confident	45 Å²	45	82.2 Å²	82.2	21%	0.21	41%	0.411	C	S	.	.	S	Bend	trans	-93	136.2	-175.7	-70.3	-179.9	158.9	0	0	111.6	C77 F78 C83 W104	C77-E81 HydrophobicContact CB-CB 4.31Å; F78-E81 HydrophobicContact CB-CG 4.1Å; F78-E81 WeakPolarHBondContact CD2-OE2 3.23Å; F78-E81 PolarHBondContact N-OE2 3Å; F78-E81 WeakPolarHBondContact O-CB 3.35Å; F78-E81 PolarHBondContact O-N 2.96Å; E81-C83 PolarHBondContact O-N 3.2Å; E81-W104 VanDerWaalsContact CD-CZ2 3.44Å; E81-W104 VanDerWaalsContact OE1-CZ2 3.28Å; E81-W104 WeakPolarHBondContact OE1-CZ2 3.28Å; E81-W104 WeakPolarHBondContact OE2-CH2 3.41Å; E81-W104 VanDerWaalsContact OE2-CZ2 3.23Å; E81-W104 WeakPolarHBondContact OE2-CZ2 3.08Å
82	P	93.1	Very high	83.4	Confident	28 Å²	28	87.7 Å²	87.7	18%	0.182	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.7	130.8	175.9	30.2	-33.9	0	0	0	110.2	F85 S103 I126 Y127	P82-F85 HydrophobicContact CB-CE1 3.85Å; P82-F85 HydrophobicContact CB-CE2 4.15Å; P82-F85 HydrophobicContact CB-CZ 3.64Å; P82-F85 HydrophobicContact CG-CE1 3.7Å; P82-F85 HydrophobicContact CG-CE2 3.94Å; P82-F85 HydrophobicContact CG-CZ 3.19Å; P82-S103 WeakPolarHBondContact O-CB 3.39Å; P82-S103 PolarHBondContact O-OG 3.19Å; P82-I126 HydrophobicContact CB-CG2 3.71Å; P82-Y127 CarbonylContact C-O 3.43Å; P82-Y127 WeakPolarHBondContact CA-O 3.45Å
83	C	94.3	Very high	84.9	Confident	6 Å²	6	88.2 Å²	88.2	4%	0.041	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	-29.6	172.7	52.1	0	0	0	0	112	E81 S103 C107 C113 Y127 T128	E81-C83 PolarHBondContact O-N 3.2Å; C83-S103 VanDerWaalsContact C-CB 3.48Å; C83-S103 WeakPolarHBondContact O-CB 3.39Å; C83-S103 PolarHBondContact O-N 3.4Å; C83-C107 VanDerWaalsContact SG-SG 3.7Å; C83-C113 HydrophobicContact CB-CB 3.99Å; C83-C113 WeakPolarHBondContact CB-SG 3.25Å; C83-C113 WeakPolarHBondContact SG-CA 3.4Å; C83-C113 WeakPolarHBondContact SG-CB 3.21Å; C83-C113 CovalentContact SG-SG 2.02Å; C83-C113 PolarHBondContact SG-SG 3.17Å; C83-Y127 PolarHBondContact N-O 2.79Å; C83-Y127 PolarHBondContact SG-O 2.81Å; C83-T128 VanDerWaalsContact SG-CA 3.53Å
84	Q	94.5	Very high	85.7	Confident	64 Å²	64	89.1 Å²	89.1	30%	0.299	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.5	159.3	175.1	-66.4	174.7	-7.4	0	0	111.6	I100 I101 C113 Y127	Q84-I100 HydrophobicContact CB-CG2 4.07Å; Q84-I100 HydrophobicContact CG-CG2 4.06Å; Q84-I101 WeakPolarHBondContact CA-O 3.49Å; Q84-C113 VanDerWaalsContact CG-SG 3.51Å; Q84-Y127 HydrophobicContact CB-CD2 4.21Å; Q84-Y127 HydrophobicContact CB-CG 4.14Å; Q84-Y127 PolarHBondContact N-O 3.01Å; Q84-Y127 PolarHBondContact O-N 2.84Å
85	F	92.5	Very high	86.6	Confident	37 Å²	37	88.9 Å²	88.9	16%	0.162	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	125.1	170.7	-52.3	-98.7	0	0	0	109.6	P82 I101 E125 I126	P82-F85 HydrophobicContact CB-CE1 3.85Å; P82-F85 HydrophobicContact CB-CE2 4.15Å; P82-F85 HydrophobicContact CB-CZ 3.64Å; P82-F85 HydrophobicContact CG-CE1 3.7Å; P82-F85 HydrophobicContact CG-CE2 3.94Å; P82-F85 HydrophobicContact CG-CZ 3.19Å; F85-I101 HydrophobicContact CB-CB 4.23Å; F85-I101 PolarHBondContact N-O 3.32Å; F85-I101 PolarHBondContact O-N 3.47Å; F85-E125 CarbonylContact C-O 3.48Å; F85-E125 VanDerWaalsContact CA-O 3.27Å; F85-E125 WeakPolarHBondContact CA-O 3.33Å; F85-I126 HydrophobicContact CD1-CD1 3.43Å; F85-I126 VanDerWaalsContact CD1-CD1 3.43Å; F85-I126 HydrophobicContact CE1-CD1 3.78Å
86	G	91.7	Very high	86.4	Confident	0 Å²	0	89.5 Å²	89.5	0%	0	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	122.6	173.7	0	0	0	0	0	111.5	Y98 M99 A124 E125	G86-Y98 VanDerWaalsContact CA-OH 3.31Å; G86-Y98 WeakPolarHBondContact CA-OH 3.15Å; G86-M99 WeakPolarHBondContact CA-O 3.4Å; G86-A124 CarbonylContact O-C 3.42Å; G86-A124 WeakPolarHBondContact O-CA 3.27Å; G86-A124 WeakPolarHBondContact O-CB 2.96Å; G86-E125 PolarHBondContact N-O 3.34Å; G86-E125 PolarHBondContact O-N 3.23Å
87	Q	88.9	Confident	86.2	Confident	72 Å²	72	86.7 Å²	86.7	34%	0.336	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	138	-178.8	-168.4	177.1	33	0	0	111.7	M99 R122 A124	Q87-M99 PolarHBondContact N-O 3.41Å; Q87-M99 PolarHBondContact O-N 3.38Å; Q87-R122 PolarHBondContact NE2-O 2.78Å; Q87-A124 HydrophobicContact CB-CB 4.38Å
88	Y	84.8	Confident	86	Confident	123 Å²	123	89.8 Å²	89.8	48%	0.482	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	123	167.1	-64.6	-82.3	0	0	0	109.9	L96 V97 Y98 W118	Y88-L96 HydrophobicContact CD1-CB 4.46Å; Y88-V97 WeakPolarHBondContact CA-O 3.31Å; Y88-Y98 AromaticContact CD1-CD2 3.9Å; Y88-Y98 HydrophobicContact CD1-CD2 3.9Å; Y88-Y98 HydrophobicContact CD1-CG 4.5Å; Y88-Y98 HydrophobicContact CD2-CD2 4.12Å; Y88-Y98 AromaticContact CE1-CD2 3.62Å; Y88-Y98 HydrophobicContact CE1-CD2 3.62Å; Y88-Y98 HydrophobicContact CE1-CG 4.21Å; Y88-Y98 AromaticContact CE2-CD2 3.84Å; Y88-Y98 HydrophobicContact CE2-CD2 3.84Å; Y88-Y98 HydrophobicContact CE2-CE2 4.12Å; Y88-Y98 HydrophobicContact CG-CD2 4.15Å; Y88-Y98 AromaticContact CZ-CD2 3.58Å; Y88-W118 HydrophobicContact CD2-CH2 4.45Å
89	K	82.3	Confident	86	Confident	125 Å²	125	87.4 Å²	87.4	54%	0.543	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	135.4	169.9	178.5	175.5	176.4	-174.3	0	109.6	S91 V97 M99	K89-S91 PolarHBondContact O-N 2.87Å; K89-V97 PolarHBondContact N-O 3.33Å; K89-V97 PolarHBondContact O-N 2.89Å; K89-M99 HydrophobicContact CB-CE 3.59Å; K89-M99 HydrophobicContact CB-SD 4.22Å; K89-M99 HydrophobicContact CD-CE 3.4Å; K89-M99 VanDerWaalsContact CD-CE 3.4Å; K89-M99 HydrophobicContact CD-SD 3.96Å; K89-M99 HydrophobicContact CG-CE 4.12Å
90	Q	81.9	Confident	86.4	Confident	122 Å²	122	83.5 Å²	83.5	57%	0.57	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.1	121.5	169.7	-168.1	169.2	6.6	0	0	109.1	D94 L96	Q90-D94 PolarHBondContact NE2-OD1 3.41Å; Q90-L96 HydrophobicContact CB-CD2 4.4Å
91	S	79.2	Confident	86.7	Confident	52 Å²	52	81.4 Å²	81.4	36%	0.364	40%	0.402	S	S	.	.			trans	-78.2	169.1	171.3	-173.6	0	0	0	0	110.7	K89 N93 D94 L95	K89-S91 PolarHBondContact O-N 2.87Å; S91-N93 PolarHBondContact O-N 3.11Å; S91-N93 VanDerWaalsContact O-N 3.14Å; S91-D94 PolarHBondContact O-N 2.86Å; S91-D94 VanDerWaalsContact O-N 3.17Å; S91-L95 WeakPolarHBondContact CB-O 3.44Å; S91-L95 PolarHBondContact N-O 2.83Å
92	Q	81.5	Confident	86.6	Confident	192 Å²	192	84.1 Å²	84.1	90%	0.897	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-25.1	179.8	-67.4	179.7	-7.2	0	0	113.5	D94	Q92-D94 VanDerWaalsContact C-N 3.35Å
93	N	84.8	Confident	86.4	Confident	124 Å²	124	84 Å²	84	66%	0.663	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.9	23	-178.6	-60.8	-6.3	0	0	0	112.9	S91 L95	S91-N93 PolarHBondContact O-N 3.11Å; S91-N93 VanDerWaalsContact O-N 3.14Å; N93-L95 HydrophobicContact CB-CD1 4.34Å; N93-L95 HydrophobicContact CB-CG 4.31Å; N93-L95 PolarHBondContact O-N 2.81Å
94	D	79.2	Confident	86.1	Confident	123 Å²	123	91.1 Å²	91.1	66%	0.658	45%	0.45	S	S	*	.	S	Bend	trans	58.5	10.5	-172.6	-65.1	-43.8	0	0	0	115.3	Q90 S91 Q92	Q90-D94 PolarHBondContact NE2-OD1 3.41Å; S91-D94 PolarHBondContact O-N 2.86Å; S91-D94 VanDerWaalsContact O-N 3.17Å; Q92-D94 VanDerWaalsContact C-N 3.35Å
95	L	81.8	Confident	85.9	Confident	111 Å²	111	88.6 Å²	88.6	58%	0.581	44%	0.439	S	S	*	.			trans	-79	129	173.3	-65.5	174.3	0	0	0	109.9	S91 N93 V97	S91-L95 WeakPolarHBondContact CB-O 3.44Å; S91-L95 PolarHBondContact N-O 2.83Å; N93-L95 HydrophobicContact CB-CD1 4.34Å; N93-L95 HydrophobicContact CB-CG 4.31Å; N93-L95 PolarHBondContact O-N 2.81Å; L95-V97 PolarHBondContact O-N 3.37Å
96	L	79.9	Confident	85.8	Confident	125 Å²	125	90.1 Å²	90.1	65%	0.654	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.3	118.7	169.8	-67.1	175.1	0	0	0	109.3	Y88 Q90	Y88-L96 HydrophobicContact CD1-CB 4.46Å; Q90-L96 HydrophobicContact CB-CD2 4.4Å
97	V	86.1	Confident	85.9	Confident	67 Å²	67	90.9 Å²	90.9	41%	0.406	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	126	174.8	179.4	0	0	0	0	108.3	Y88 K89 L95 M99	Y88-V97 WeakPolarHBondContact CA-O 3.31Å; K89-V97 PolarHBondContact N-O 3.33Å; K89-V97 PolarHBondContact O-N 2.89Å; L95-V97 PolarHBondContact O-N 3.37Å; V97-M99 HydrophobicContact CG1-CG 4.21Å
98	Y	86.6	Confident	86	Confident	76 Å²	76	90.3 Å²	90.3	30%	0.298	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.1	124.5	173.5	-172.8	-100.8	0	0	0	109.7	G86 Y88 I100 E125 Y127	G86-Y98 VanDerWaalsContact CA-OH 3.31Å; G86-Y98 WeakPolarHBondContact CA-OH 3.15Å; Y88-Y98 AromaticContact CD1-CD2 3.9Å; Y88-Y98 HydrophobicContact CD1-CD2 3.9Å; Y88-Y98 HydrophobicContact CD1-CG 4.5Å; Y88-Y98 HydrophobicContact CD2-CD2 4.12Å; Y88-Y98 AromaticContact CE1-CD2 3.62Å; Y88-Y98 HydrophobicContact CE1-CD2 3.62Å; Y88-Y98 HydrophobicContact CE1-CG 4.21Å; Y88-Y98 AromaticContact CE2-CD2 3.84Å; Y88-Y98 HydrophobicContact CE2-CD2 3.84Å; Y88-Y98 HydrophobicContact CE2-CE2 4.12Å; Y88-Y98 HydrophobicContact CG-CD2 4.15Å; Y88-Y98 AromaticContact CZ-CD2 3.58Å; Y98-I100 HydrophobicContact CD1-CD1 4.37Å; Y98-I100 HydrophobicContact CE1-CD1 3.45Å; Y98-I100 VanDerWaalsContact CE1-CD1 3.45Å; Y98-I100 HydrophobicContact CE1-CG1 4.21Å; Y98-E125 PolarHBondContact OH-OE2 3.26Å; Y98-Y127 PolarHBondContact OH-OH 3.28Å
99	M	87.6	Confident	86.1	Confident	71 Å²	71	89 Å²	89	35%	0.35	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	136.8	-178.9	-60.4	-168.5	-46.9	0	0	110.5	G86 Q87 K89 V97	G86-M99 WeakPolarHBondContact CA-O 3.4Å; Q87-M99 PolarHBondContact N-O 3.41Å; Q87-M99 PolarHBondContact O-N 3.38Å; K89-M99 HydrophobicContact CB-CE 3.59Å; K89-M99 HydrophobicContact CB-SD 4.22Å; K89-M99 HydrophobicContact CD-CE 3.4Å; K89-M99 VanDerWaalsContact CD-CE 3.4Å; K89-M99 HydrophobicContact CD-SD 3.96Å; K89-M99 HydrophobicContact CG-CE 4.12Å; V97-M99 HydrophobicContact CG1-CG 4.21Å
100	I	90.1	Very high	86.6	Confident	76 Å²	76	89.8 Å²	89.8	39%	0.39	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	125.1	170.5	-61.2	-61.2	0	0	0	109.2	Q84 Y98 Y127	Q84-I100 HydrophobicContact CB-CG2 4.07Å; Q84-I100 HydrophobicContact CG-CG2 4.06Å; Y98-I100 HydrophobicContact CD1-CD1 4.37Å; Y98-I100 HydrophobicContact CE1-CD1 3.45Å; Y98-I100 VanDerWaalsContact CE1-CD1 3.45Å; Y98-I100 HydrophobicContact CE1-CG1 4.21Å; I100-Y127 HydrophobicContact CD1-CE2 4.18Å
101	I	88.9	Confident	87.1	Confident	70 Å²	70	85.5 Å²	85.5	36%	0.359	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	116.6	175.5	-54.5	171.8	0	0	0	107.5	Q84 F85	Q84-I101 WeakPolarHBondContact CA-O 3.49Å; F85-I101 HydrophobicContact CB-CB 4.23Å; F85-I101 PolarHBondContact N-O 3.32Å; F85-I101 PolarHBondContact O-N 3.47Å
102	P	88.5	Confident	87.8	Confident	102 Å²	102	84.5 Å²	84.5	66%	0.662	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.3	147.8	175.8	28.9	-33.9	0	0	0	111.2
103	S	90.1	Very high	88.4	Confident	27 Å²	27	77.1 Å²	77.1	19%	0.189	41%	0.412	C	S	.	.			trans	-82.3	178.6	170.2	-164.9	0	0	0	0	111.7	P82 C83 C105	P82-S103 WeakPolarHBondContact O-CB 3.39Å; P82-S103 PolarHBondContact O-OG 3.19Å; C83-S103 VanDerWaalsContact C-CB 3.48Å; C83-S103 WeakPolarHBondContact O-CB 3.39Å; C83-S103 PolarHBondContact O-N 3.4Å; S103-C105 VanDerWaalsContact C-N 3.25Å
104	W	86.9	Confident	88.8	Confident	155 Å²	155	75.3 Å²	75.3	59%	0.587	40%	0.4	S	S	*	.	S	Bend	trans	-78.3	-11.9	175.3	63.9	-89.7	0	0	0	113.1	K75 E81	K75-W104 HydrophobicContact CB-CE3 4.15Å; K75-W104 HydrophobicContact CB-CZ3 3.65Å; K75-W104 HydrophobicContact CD-CE3 4.15Å; K75-W104 HydrophobicContact CD-CZ3 3.65Å; K75-W104 HydrophobicContact CG-CZ3 4.28Å; E81-W104 VanDerWaalsContact CD-CZ2 3.44Å; E81-W104 VanDerWaalsContact OE1-CZ2 3.28Å; E81-W104 WeakPolarHBondContact OE1-CZ2 3.28Å; E81-W104 WeakPolarHBondContact OE2-CH2 3.41Å; E81-W104 VanDerWaalsContact OE2-CZ2 3.23Å; E81-W104 WeakPolarHBondContact OE2-CZ2 3.08Å
105	C	89.9	Confident	89.5	Confident	11 Å²	11	73.3 Å²	73.3	7%	0.074	39%	0.392	C	S	.	.	S	Bend	trans	-119.4	163.6	179.6	65.7	0	0	0	0	110.5	K75 C77 S103	K75-C105 CarbonylContact O-C 3.58Å; K75-C105 WeakPolarHBondContact O-CA 3.23Å; K75-C105 VanDerWaalsContact O-CB 3.28Å; K75-C105 WeakPolarHBondContact O-CB 3.45Å; C77-C105 WeakPolarHBondContact CA-SG 3.16Å; C77-C105 HydrophobicContact CB-CB 3.88Å; C77-C105 WeakPolarHBondContact CB-SG 3.44Å; C77-C105 WeakPolarHBondContact SG-CB 3.44Å; C77-C105 PolarHBondContact SG-O 2.94Å; C77-C105 CovalentContact SG-SG 2.03Å; C77-C105 PolarHBondContact SG-SG 3.49Å; S103-C105 VanDerWaalsContact C-N 3.25Å
106	T	92	Very high	90	Very high	68 Å²	68	71.6 Å²	71.6	42%	0.417	38%	0.383	S	S	.	.	B	Isolated β-bridge	trans	-126.2	162	174.7	-170.1	0	0	0	0	111.4	I74 K75 Y76 C77	I74-T106 HydrophobicContact CG2-CG2 3.25Å; K75-T106 PolarHBondContact O-N 2.87Å; Y76-T106 CarbonylContact C-O 3.5Å; Y76-T106 VanDerWaalsContact CA-O 3.22Å; Y76-T106 WeakPolarHBondContact CA-O 3.42Å; Y76-T106 HydrophobicContact CD1-CG2 4.14Å; Y76-T106 HydrophobicContact CE1-CG2 4.38Å; C77-T106 PolarHBondContact N-O 3.31Å; C77-T106 PolarHBondContact SG-N 3.38Å
107	C	92.8	Very high	90.7	Very high	17 Å²	17	71.7 Å²	71.7	12%	0.115	38%	0.375	C	S	.	.			trans	-74.2	153.7	174.5	-56.9	0	0	0	0	112.1	C83 Q111 C129	C83-C107 VanDerWaalsContact SG-SG 3.7Å; C107-Q111 HydrophobicContact CB-CB 3.89Å; C107-C129 WeakPolarHBondContact CA-SG 3.45Å; C107-C129 HydrophobicContact CB-CB 3.75Å; C107-C129 WeakPolarHBondContact CB-SG 3.25Å; C107-C129 WeakPolarHBondContact SG-CA 3.34Å; C107-C129 WeakPolarHBondContact SG-CB 3.49Å; C107-C129 CovalentContact SG-SG 2.04Å; C107-C129 PolarHBondContact SG-SG 3.2Å
108	N	90.3	Very high	91.1	Very high	60 Å²	60	74 Å²	74	32%	0.321	38%	0.377	S	S	.	.			trans	-63.6	163.9	172.1	-67.6	-1.3	0	0	0	110.9	Y76 H110 Q111	Y76-N108 WeakPolarHBondContact CB-OD1 3.22Å; Y76-N108 HydrophobicContact CD1-CB 4.4Å; Y76-N108 WeakPolarHBondContact CD1-OD1 3.28Å; Y76-N108 WeakPolarHBondContact CD2-OD1 3.46Å; N108-H110 PolarHBondContact O-N 2.94Å; N108-H110 VanDerWaalsContact O-N 3.08Å; N108-Q111 HydrophobicContact CB-CG 4.44Å; N108-Q111 PolarHBondContact O-N 2.81Å; N108-Q111 VanDerWaalsContact O-O 3.14Å
109	S	88.9	Confident	91.3	Very high	96 Å²	96	72.5 Å²	72.5	67%	0.671	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.9	-25.4	175	50.7	0	0	0	0	114.7
110	H	91.3	Very high	91.4	Very high	141 Å²	141	79.3 Å²	79.3	65%	0.653	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.3	0.4	180	-55.8	-65.2	0	0	0	113.7	N108 N132	N108-H110 PolarHBondContact O-N 2.94Å; N108-H110 VanDerWaalsContact O-N 3.08Å; H110-N132 PolarHBondContact O-N 3.5Å; H110-N132 VanDerWaalsContact O-N 3.15Å
111	Q	93.5	Very high	91.4	Very high	31 Å²	31	82.3 Å²	82.3	15%	0.145	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	154	-175.9	-69.8	175.6	-37.2	0	0	110.5	C107 N108 C129 Q130	C107-Q111 HydrophobicContact CB-CB 3.89Å; N108-Q111 HydrophobicContact CB-CG 4.44Å; N108-Q111 PolarHBondContact O-N 2.81Å; N108-Q111 VanDerWaalsContact O-O 3.14Å; Q111-C129 HydrophobicContact CB-CB 4.24Å; Q111-Q130 CarbonylContact C-O 3.46Å; Q111-Q130 WeakPolarHBondContact CA-O 3.47Å; Q111-Q130 WeakPolarHBondContact CB-O 3.45Å
112	S	93.8	Very high	91.2	Very high	32 Å²	32	86.1 Å²	86.1	22%	0.224	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	147.8	167.6	56.3	0	0	0	0	110.4	Q114 Q130 N132	S112-Q114 PolarHBondContact O-N 3.22Å; S112-Q114 WeakPolarHBondContact OG-CG 3.4Å; S112-Q114 PolarHBondContact OG-NE2 2.96Å; S112-Q130 PolarHBondContact N-O 2.98Å; S112-Q130 PolarHBondContact O-N 3.33Å; S112-N132 WeakPolarHBondContact CB-OD1 3.39Å; S112-N132 PolarHBondContact N-OD1 2.67Å; S112-N132 PolarHBondContact OG-OD1 3.28Å
113	C	93.9	Very high	91.2	Very high	36 Å²	36	88.3 Å²	88.3	24%	0.243	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	102.7	174.8	-171.2	0	0	0	0	108.2	C83 Q84 Y127	C83-C113 HydrophobicContact CB-CB 3.99Å; C83-C113 WeakPolarHBondContact CB-SG 3.25Å; C83-C113 WeakPolarHBondContact SG-CA 3.4Å; C83-C113 WeakPolarHBondContact SG-CB 3.21Å; C83-C113 CovalentContact SG-SG 2.02Å; C83-C113 PolarHBondContact SG-SG 3.17Å; Q84-C113 VanDerWaalsContact CG-SG 3.51Å; C113-Y127 WeakPolarHBondContact SG-CB 3.44Å
114	Q	93.6	Very high	91.2	Very high	87 Å²	87	87.2 Å²	87.2	41%	0.407	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	155.6	-175.8	-61.9	-166.8	15	0	0	111.3	S112 D116 Y127 T128 Q130	S112-Q114 PolarHBondContact O-N 3.22Å; S112-Q114 WeakPolarHBondContact OG-CG 3.4Å; S112-Q114 PolarHBondContact OG-NE2 2.96Å; Q114-D116 PolarHBondContact O-N 2.82Å; Q114-Y127 CarbonylContact O-C 3.48Å; Q114-Y127 WeakPolarHBondContact O-CA 3.21Å; Q114-Y127 WeakPolarHBondContact O-CB 3.41Å; Q114-T128 PolarHBondContact N-O 3.14Å; Q114-T128 PolarHBondContact O-N 2.9Å; Q114-Q130 HydrophobicContact CB-CG 4.38Å
115	V	93.2	Very high	91.6	Very high	80 Å²	80	82.3 Å²	82.3	49%	0.485	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.6	127.7	177	66.6	0	0	0	0	109.3	E125 Y127 Q130	V115-E125 HydrophobicContact CG2-CB 4.29Å; V115-E125 HydrophobicContact CG2-CG 4.44Å; V115-Y127 HydrophobicContact CB-CD1 4.16Å; V115-Y127 HydrophobicContact CB-CE1 3.87Å; V115-Y127 VanDerWaalsContact N-CD1 3.26Å; V115-Q130 PolarHBondContact O-NE2 3.09Å
116	D	93.1	Very high	91.8	Very high	75 Å²	75	82 Å²	82	40%	0.401	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	-52.4	-178.6	173.6	52.6	0	0	0	110.5	Q114 I126 T128	Q114-D116 PolarHBondContact O-N 2.82Å; D116-I126 PolarHBondContact N-O 3.36Å; D116-T128 HydrophobicContact CB-CG2 3.85Å; D116-T128 WeakPolarHBondContact CB-OG1 3.39Å
117	R	94	Very high	92	Very high	128 Å²	128	80.6 Å²	80.6	48%	0.483	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	160.1	-175	63	-174.1	-177.2	-98.8	3.9	112.8	I126	R117-I126 HydrophobicContact CG-CB 3.81Å; R117-I126 HydrophobicContact CG-CG1 4.07Å; R117-I126 HydrophobicContact CG-CG2 4.4Å; R117-I126 PolarHBondContact N-O 3.49Å; R117-I126 WeakPolarHBondContact O-CA 3.37Å; R117-I126 WeakPolarHBondContact O-CB 3.28Å; R117-I126 PolarHBondContact O-N 3.02Å
118	W	94	Very high	92.1	Very high	115 Å²	115	80.1 Å²	80.1	44%	0.436	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	122.5	169.7	175.3	-102.1	0	0	0	111	Y88 R120 K123 E125	Y88-W118 HydrophobicContact CD2-CH2 4.45Å; W118-R120 PolarHBondContact O-N 2.72Å; W118-K123 HydrophobicContact CH2-CB 4.24Å; W118-K123 WeakPolarHBondContact CH2-O 3.49Å; W118-K123 HydrophobicContact CZ2-CB 3.88Å; W118-E125 HydrophobicContact CE3-CB 4.29Å; W118-E125 HydrophobicContact CE3-CG 3.5Å; W118-E125 VanDerWaalsContact CE3-N 3.27Å; W118-E125 HydrophobicContact CZ3-CG 3.79Å; W118-E125 VanDerWaalsContact CZ3-N 3.33Å
119	D	91.7	Very high	92.3	Very high	45 Å²	45	77.7 Å²	77.7	24%	0.241	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	109.1	170.5	-174.7	-31.1	0	0	0	109.7	V121 R122 K123 A124 I126	D119-V121 VanDerWaalsContact C-N 3.33Å; D119-V121 PolarHBondContact O-N 3.3Å; D119-V121 WeakPolarHBondContact OD1-CA 3.31Å; D119-V121 WeakPolarHBondContact OD1-CB 3.39Å; D119-V121 PolarHBondContact OD1-N 2.88Å; D119-R122 HydrophobicContact CB-CB 4.12Å; D119-R122 PolarHBondContact OD1-N 3.41Å; D119-R122 VanDerWaalsContact OD2-CD 3.25Å; D119-R122 WeakPolarHBondContact OD2-CD 3.41Å; D119-R122 WeakPolarHBondContact OD2-CG 3.24Å; D119-R122 IonicContact OD2-NE 3.71Å; D119-K123 VanDerWaalsContact O-CA 3.22Å; D119-K123 WeakPolarHBondContact O-CA 3.36Å; D119-K123 PolarHBondContact O-N 3.25Å; D119-A124 PolarHBondContact N-O 2.86Å; D119-A124 PolarHBondContact O-N 3.35Å; D119-A124 VanDerWaalsContact O-N 3.13Å; D119-I126 HydrophobicContact CB-CD1 3.9Å; D119-I126 HydrophobicContact CB-CG1 3.9Å
120	R	89.1	Confident	92.5	Very high	214 Å²	214	76 Å²	76	81%	0.808	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.4	-30.4	-179.9	-66.1	-176.5	179.4	-178.3	0.3	113.6	W118	W118-R120 PolarHBondContact O-N 2.72Å
121	V	89.2	Confident	92.5	Very high	138 Å²	138	72.8 Å²	72.8	84%	0.836	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76	-43.5	-178.3	-180	0	0	0	0	109.4	D119 K123	D119-V121 VanDerWaalsContact C-N 3.33Å; D119-V121 PolarHBondContact O-N 3.3Å; D119-V121 WeakPolarHBondContact OD1-CA 3.31Å; D119-V121 WeakPolarHBondContact OD1-CB 3.39Å; D119-V121 PolarHBondContact OD1-N 2.88Å; V121-K123 VanDerWaalsContact C-N 3.34Å
122	R	85	Confident	91.8	Very high	151 Å²	151	75.8 Å²	75.8	57%	0.57	36%	0.363	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.5	-15.1	177.1	-62.6	-177.2	-178	-150.4	-0.9	113.4	Q87 D119 A124	Q87-R122 PolarHBondContact NE2-O 2.78Å; D119-R122 HydrophobicContact CB-CB 4.12Å; D119-R122 PolarHBondContact OD1-N 3.41Å; D119-R122 VanDerWaalsContact OD2-CD 3.25Å; D119-R122 WeakPolarHBondContact OD2-CD 3.41Å; D119-R122 WeakPolarHBondContact OD2-CG 3.24Å; D119-R122 IonicContact OD2-NE 3.71Å; R122-A124 VanDerWaalsContact C-N 3.3Å; R122-A124 HydrophobicContact CB-CB 4.11Å
123	K	88.5	Confident	90.6	Very high	147 Å²	147	81.5 Å²	81.5	64%	0.639	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.4	52.7	-169.1	-58.4	-178.3	-179.4	-179.1	0	110.5	W118 D119 V121	W118-K123 HydrophobicContact CH2-CB 4.24Å; W118-K123 WeakPolarHBondContact CH2-O 3.49Å; W118-K123 HydrophobicContact CZ2-CB 3.88Å; D119-K123 VanDerWaalsContact O-CA 3.22Å; D119-K123 WeakPolarHBondContact O-CA 3.36Å; D119-K123 PolarHBondContact O-N 3.25Å; V121-K123 VanDerWaalsContact C-N 3.34Å
124	A	91.5	Very high	88.3	Confident	4 Å²	4	92.6 Å²	92.6	3%	0.033	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.2	142.1	-175	0	0	0	0	0	112.1	G86 Q87 D119 R122	G86-A124 CarbonylContact O-C 3.42Å; G86-A124 WeakPolarHBondContact O-CA 3.27Å; G86-A124 WeakPolarHBondContact O-CB 2.96Å; Q87-A124 HydrophobicContact CB-CB 4.38Å; D119-A124 PolarHBondContact N-O 2.86Å; D119-A124 PolarHBondContact O-N 3.35Å; D119-A124 VanDerWaalsContact O-N 3.13Å; R122-A124 VanDerWaalsContact C-N 3.3Å; R122-A124 HydrophobicContact CB-CB 4.11Å
125	E	94.4	Very high	88	Confident	52 Å²	52	92.9 Å²	92.9	24%	0.243	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.5	131.1	165.7	-71	179.3	176	0	0	108.4	F85 G86 Y98 V115 W118 Y127	F85-E125 CarbonylContact C-O 3.48Å; F85-E125 VanDerWaalsContact CA-O 3.27Å; F85-E125 WeakPolarHBondContact CA-O 3.33Å; G86-E125 PolarHBondContact N-O 3.34Å; G86-E125 PolarHBondContact O-N 3.23Å; Y98-E125 PolarHBondContact OH-OE2 3.26Å; V115-E125 HydrophobicContact CG2-CB 4.29Å; V115-E125 HydrophobicContact CG2-CG 4.44Å; W118-E125 HydrophobicContact CE3-CB 4.29Å; W118-E125 HydrophobicContact CE3-CG 3.5Å; W118-E125 VanDerWaalsContact CE3-N 3.27Å; W118-E125 HydrophobicContact CZ3-CG 3.79Å; W118-E125 VanDerWaalsContact CZ3-N 3.33Å; E125-Y127 HydrophobicContact CB-CD2 4.37Å; E125-Y127 HydrophobicContact CB-CE2 3.71Å; E125-Y127 PolarHBondContact OE2-OH 3.27Å; E125-Y127 VanDerWaalsContact OE2-OH 3.1Å
126	I	94.8	Very high	87.7	Confident	5 Å²	5	93.6 Å²	93.6	3%	0.026	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	124	177.1	-51.5	-57	0	0	0	106.8	P82 F85 D116 R117 D119	P82-I126 HydrophobicContact CB-CG2 3.71Å; F85-I126 HydrophobicContact CD1-CD1 3.43Å; F85-I126 VanDerWaalsContact CD1-CD1 3.43Å; F85-I126 HydrophobicContact CE1-CD1 3.78Å; D116-I126 PolarHBondContact N-O 3.36Å; R117-I126 HydrophobicContact CG-CB 3.81Å; R117-I126 HydrophobicContact CG-CG1 4.07Å; R117-I126 HydrophobicContact CG-CG2 4.4Å; R117-I126 PolarHBondContact N-O 3.49Å; R117-I126 WeakPolarHBondContact O-CA 3.37Å; R117-I126 WeakPolarHBondContact O-CB 3.28Å; R117-I126 PolarHBondContact O-N 3.02Å; D119-I126 HydrophobicContact CB-CD1 3.9Å; D119-I126 HydrophobicContact CB-CG1 3.9Å
127	Y	95.1	Very high	87.4	Confident	38 Å²	38	94.6 Å²	94.6	15%	0.149	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	136.3	175.5	-64.5	-112.1	0	0	0	109.1	P82 C83 Q84 Y98 I100 C113 Q114 V115 E125	P82-Y127 CarbonylContact C-O 3.43Å; P82-Y127 WeakPolarHBondContact CA-O 3.45Å; C83-Y127 PolarHBondContact N-O 2.79Å; C83-Y127 PolarHBondContact SG-O 2.81Å; Q84-Y127 HydrophobicContact CB-CD2 4.21Å; Q84-Y127 HydrophobicContact CB-CG 4.14Å; Q84-Y127 PolarHBondContact N-O 3.01Å; Q84-Y127 PolarHBondContact O-N 2.84Å; Y98-Y127 PolarHBondContact OH-OH 3.28Å; I100-Y127 HydrophobicContact CD1-CE2 4.18Å; C113-Y127 WeakPolarHBondContact SG-CB 3.44Å; Q114-Y127 CarbonylContact O-C 3.48Å; Q114-Y127 WeakPolarHBondContact O-CA 3.21Å; Q114-Y127 WeakPolarHBondContact O-CB 3.41Å; V115-Y127 HydrophobicContact CB-CD1 4.16Å; V115-Y127 HydrophobicContact CB-CE1 3.87Å; V115-Y127 VanDerWaalsContact N-CD1 3.26Å; E125-Y127 HydrophobicContact CB-CD2 4.37Å; E125-Y127 HydrophobicContact CB-CE2 3.71Å; E125-Y127 PolarHBondContact OE2-OH 3.27Å; E125-Y127 VanDerWaalsContact OE2-OH 3.1Å
128	T	94.6	Very high	87.1	Confident	8 Å²	8	92.6 Å²	92.6	5%	0.049	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	162.9	176.2	61.6	0	0	0	0	110.5	C83 Q114 D116 Q130	C83-T128 VanDerWaalsContact SG-CA 3.53Å; Q114-T128 PolarHBondContact N-O 3.14Å; Q114-T128 PolarHBondContact O-N 2.9Å; D116-T128 HydrophobicContact CB-CG2 3.85Å; D116-T128 WeakPolarHBondContact CB-OG1 3.39Å; T128-Q130 PolarHBondContact O-N 3.03Å
129	C	94.5	Very high	86.6	Confident	8 Å²	8	91.3 Å²	91.3	5%	0.054	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	113.7	178	-62.6	0	0	0	0	110.3	C107 Q111	C107-C129 WeakPolarHBondContact CA-SG 3.45Å; C107-C129 HydrophobicContact CB-CB 3.75Å; C107-C129 WeakPolarHBondContact CB-SG 3.25Å; C107-C129 WeakPolarHBondContact SG-CA 3.34Å; C107-C129 WeakPolarHBondContact SG-CB 3.49Å; C107-C129 CovalentContact SG-SG 2.04Å; C107-C129 PolarHBondContact SG-SG 3.2Å; Q111-C129 HydrophobicContact CB-CB 4.24Å
130	Q	92.8	Very high	86.3	Confident	62 Å²	62	94.3 Å²	94.3	29%	0.29	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	140.2	178.2	-60.1	-178	18.7	0	0	109.5	Q111 S112 Q114 V115 T128	Q111-Q130 CarbonylContact C-O 3.46Å; Q111-Q130 WeakPolarHBondContact CA-O 3.47Å; Q111-Q130 WeakPolarHBondContact CB-O 3.45Å; S112-Q130 PolarHBondContact N-O 2.98Å; S112-Q130 PolarHBondContact O-N 3.33Å; Q114-Q130 HydrophobicContact CB-CG 4.38Å; V115-Q130 PolarHBondContact O-NE2 3.09Å; T128-Q130 PolarHBondContact O-N 3.03Å
131	S	91.2	Very high	86.1	Confident	72 Å²	72	85.8 Å²	85.8	50%	0.503	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	135.9	177.7	-62.8	0	0	0	0	110.6	L133	S131-L133 PolarHBondContact O-N 2.93Å; S131-L133 VanDerWaalsContact O-N 3.11Å
132	N	79.3	Confident	85.8	Confident	94 Å²	94	81.8 Å²	81.8	50%	0.503	39%	0.394	S	S	.	.			trans	-78.6	15.9	178.6	-61.2	-31.3	0	0	0	113.6	H110 S112 E134	H110-N132 PolarHBondContact O-N 3.5Å; H110-N132 VanDerWaalsContact O-N 3.15Å; S112-N132 WeakPolarHBondContact CB-OD1 3.39Å; S112-N132 PolarHBondContact N-OD1 2.67Å; S112-N132 PolarHBondContact OG-OD1 3.28Å; N132-E134 PolarHBondContact O-N 3.35Å
133	L	69.4	Low	85.9	Confident	153 Å²	153	76 Å²	76	80%	0.801	38%	0.379	S	S	*	.			trans	-87.8	91.2	-178.8	-78.7	140.4	0	0	0	108.7	S131	S131-L133 PolarHBondContact O-N 2.93Å; S131-L133 VanDerWaalsContact O-N 3.11Å
134	E	44.9	Very low	85.7	Confident	269 Å²	269	69.5 Å²	69.5	100%	1.257	36%	0.355	S	S	*	.			trans	-81.3	0	150.3	-76.5	-173.6	137.2	0	0	110.4	N132	N132-E134 PolarHBondContact O-N 3.35Å

Retrieved 134 of 134 residues in 97.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).