A0A077ZHQ0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHQ0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 74 aa.

						>A0A077ZHQ0_TRITR|A0A077ZHQ0
MFASIATTVFSSAQMSMNALIALQLVTIAALLLMLMLCGGGAKPAEGAAGAPAAGGDAAAPAAGGDKPPDAPKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58	Low	60.6	Low	208 Å²	208	108.1 Å²	108.1	100%	1.025	62%	0.615	S	S	*	*				0	-47	0	-70.2	-173	179.5	0	112.8	A3 S4 I5	M1-A3 PolarHBondContact O-N 2.6Å; M1-S4 PolarHBondContact O-N 3.25Å; M1-I5 PolarHBondContact O-N 3.44Å
2	F	55.6	Low	60.5	Low	176 Å²	176	102.3 Å²	102.3	77%	0.772	59%	0.586	S	S	*	*	H	α-helix	trans	-62.4	-40.1	-177.6	-161.4	-96.9	0	0	114.7	S4 I5 A6	F2-S4 VanDerWaalsContact C-N 3.29Å; F2-S4 PolarHBondContact O-N 2.76Å; F2-I5 PolarHBondContact O-N 3.5Å; F2-A6 PolarHBondContact O-N 2.75Å; F2-A6 VanDerWaalsContact O-N 3.08Å
3	A	56.6	Low	60.4	Low	73 Å²	73	100.8 Å²	100.8	60%	0.603	59%	0.593	S	S	*	*	H	α-helix	trans	-60.8	-36.6	177.7	0	0	0	0	113	M1 A6 T7	M1-A3 PolarHBondContact O-N 2.6Å; A3-A6 PolarHBondContact O-N 2.61Å; A3-T7 PolarHBondContact O-N 3.19Å; A3-T7 VanDerWaalsContact O-N 3.09Å; A3-T7 PolarHBondContact O-OG1 2.78Å
4	S	67.1	Low	60.5	Low	80 Å²	80	105.2 Å²	105.2	56%	0.559	61%	0.605	S	S	*	*	H	α-helix	trans	-65.8	-39.8	177.6	-51.4	0	0	0	111.5	M1 F2 T7 T8	M1-S4 PolarHBondContact O-N 3.25Å; F2-S4 VanDerWaalsContact C-N 3.29Å; F2-S4 PolarHBondContact O-N 2.76Å; S4-T7 PolarHBondContact O-N 3.36Å; S4-T8 PolarHBondContact O-N 3.07Å; S4-T8 PolarHBondContact O-OG1 2.92Å
5	I	65.8	Low	60.4	Low	103 Å²	103	103.7 Å²	103.7	53%	0.528	59%	0.592	S	S	.	*	H	α-helix	trans	-67.4	-43.7	178.9	-59.8	166.3	0	0	110.3	M1 F2 T7 T8 V9	M1-I5 PolarHBondContact O-N 3.44Å; F2-I5 PolarHBondContact O-N 3.5Å; I5-T7 PolarHBondContact O-N 2.94Å; I5-T8 PolarHBondContact O-N 2.82Å; I5-V9 HydrophobicContact CG2-CG2 4.37Å; I5-V9 VanDerWaalsContact O-CG2 3.31Å; I5-V9 WeakPolarHBondContact O-CG2 3.11Å; I5-V9 PolarHBondContact O-N 2.9Å
6	A	56.4	Low	61	Low	52 Å²	52	101.9 Å²	101.9	43%	0.43	59%	0.588	S	S	.	*	H	α-helix	trans	-62.1	-42.5	177.8	0	0	0	0	112.2	F2 A3 V9 F10	F2-A6 PolarHBondContact O-N 2.75Å; F2-A6 VanDerWaalsContact O-N 3.08Å; A3-A6 PolarHBondContact O-N 2.61Å; A6-V9 PolarHBondContact O-N 2.72Å; A6-F10 VanDerWaalsContact O-CB 3.26Å; A6-F10 WeakPolarHBondContact O-CB 3.41Å; A6-F10 PolarHBondContact O-N 3.29Å
7	T	62.4	Low	61.7	Low	94 Å²	94	104.1 Å²	104.1	58%	0.577	59%	0.593	S	S	*	*	H	α-helix	trans	-64.8	-40.3	175	-54.5	0	0	0	111.7	A3 S4 I5 F10 S11	A3-T7 PolarHBondContact O-N 3.19Å; A3-T7 VanDerWaalsContact O-N 3.09Å; A3-T7 PolarHBondContact O-OG1 2.78Å; S4-T7 PolarHBondContact O-N 3.36Å; I5-T7 PolarHBondContact O-N 2.94Å; T7-F10 PolarHBondContact O-N 2.75Å; T7-S11 WeakPolarHBondContact O-CB 2.96Å; T7-S11 PolarHBondContact O-N 3.49Å
8	T	64.4	Low	62.6	Low	89 Å²	89	105.2 Å²	105.2	55%	0.546	60%	0.598	S	S	.	*	H	α-helix	trans	-62.3	-47.9	175.5	-58.1	0	0	0	111.3	S4 I5 F10 S11 S12	S4-T8 PolarHBondContact O-N 3.07Å; S4-T8 PolarHBondContact O-OG1 2.92Å; I5-T8 PolarHBondContact O-N 2.82Å; T8-F10 PolarHBondContact O-N 2.92Å; T8-S11 PolarHBondContact O-N 3.5Å; T8-S12 WeakPolarHBondContact O-CB 3.48Å; T8-S12 PolarHBondContact O-N 2.94Å; T8-S12 PolarHBondContact O-OG 3.28Å
9	V	60.5	Low	63.3	Low	94 Å²	94	101.4 Å²	101.4	57%	0.57	58%	0.58	S	S	*	*	H	α-helix	trans	-64.5	-39.9	178.7	176.4	0	0	0	111.4	I5 A6 S12 A13	I5-V9 HydrophobicContact CG2-CG2 4.37Å; I5-V9 VanDerWaalsContact O-CG2 3.31Å; I5-V9 WeakPolarHBondContact O-CG2 3.11Å; I5-V9 PolarHBondContact O-N 2.9Å; A6-V9 PolarHBondContact O-N 2.72Å; V9-S12 PolarHBondContact O-N 3.24Å; V9-A13 PolarHBondContact O-N 3.38Å
10	F	58.5	Low	64	Low	148 Å²	148	100.2 Å²	100.2	65%	0.649	57%	0.571	S	S	*	*	H	α-helix	trans	-68.5	-39.9	178.1	-169.4	-96.1	0	0	112.5	A6 T7 T8 S12 A13 Q14	A6-F10 VanDerWaalsContact O-CB 3.26Å; A6-F10 WeakPolarHBondContact O-CB 3.41Å; A6-F10 PolarHBondContact O-N 3.29Å; T7-F10 PolarHBondContact O-N 2.75Å; T8-F10 PolarHBondContact O-N 2.92Å; F10-S12 VanDerWaalsContact C-N 3.32Å; F10-A13 PolarHBondContact O-N 2.78Å; F10-Q14 PolarHBondContact O-N 2.91Å
11	S	61.4	Low	64.7	Low	72 Å²	72	99.6 Å²	99.6	50%	0.503	57%	0.566	S	S	.	*	H	α-helix	trans	-65.4	-34.4	171	-92.7	0	0	0	112.5	T7 T8	T7-S11 WeakPolarHBondContact O-CB 2.96Å; T7-S11 PolarHBondContact O-N 3.49Å; T8-S11 PolarHBondContact O-N 3.5Å
12	S	59.8	Low	65.9	Low	38 Å²	38	92.1 Å²	92.1	27%	0.266	54%	0.537	S	S	.	.	H	α-helix	trans	-71.2	-29.1	174.7	-61.7	0	0	0	112.9	T8 V9 F10 Q14 M15	T8-S12 WeakPolarHBondContact O-CB 3.48Å; T8-S12 PolarHBondContact O-N 2.94Å; T8-S12 PolarHBondContact O-OG 3.28Å; V9-S12 PolarHBondContact O-N 3.24Å; F10-S12 VanDerWaalsContact C-N 3.32Å; S12-Q14 VanDerWaalsContact C-N 3.31Å; S12-Q14 PolarHBondContact O-N 3.31Å; S12-M15 WeakPolarHBondContact O-CB 3.04Å; S12-M15 PolarHBondContact O-N 2.85Å
13	A	59.3	Low	67.2	Low	83 Å²	83	88 Å²	88	69%	0.686	52%	0.522	S	S	*	.	H	α-helix	trans	-72.9	-20.6	177.2	0	0	0	0	113.7	V9 F10	V9-A13 PolarHBondContact O-N 3.38Å; F10-A13 PolarHBondContact O-N 2.78Å
14	Q	61.1	Low	68.5	Low	163 Å²	163	89.8 Å²	89.8	76%	0.762	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.3	-3.9	173.3	-67.7	-116.2	-68.6	0	113.1	F10 S12 S16	F10-Q14 PolarHBondContact O-N 2.91Å; S12-Q14 VanDerWaalsContact C-N 3.31Å; S12-Q14 PolarHBondContact O-N 3.31Å; Q14-S16 PolarHBondContact O-N 3.41Å
15	M	59.9	Low	69.4	Low	83 Å²	83	91.2 Å²	91.2	41%	0.409	52%	0.519	S	S	.	.	S	Bend	trans	-70	129.5	177	-76.6	-173.8	179.8	0	109.8	S12 A19 L20	S12-M15 WeakPolarHBondContact O-CB 3.04Å; S12-M15 PolarHBondContact O-N 2.85Å; M15-A19 HydrophobicContact CB-CB 3.82Å; M15-A19 HydrophobicContact CG-CB 4.14Å; M15-A19 HydrophobicContact SD-CB 4.25Å; M15-L20 HydrophobicContact CB-CD2 4.48Å; M15-L20 HydrophobicContact CB-CG 4.42Å
16	S	69	Low	70.6	Confident	75 Å²	75	90.9 Å²	90.9	52%	0.524	52%	0.522	S	S	.	.			trans	-53.9	150.3	170.9	61.2	0	0	0	109.8	Q14 N18 A19 L20	Q14-S16 PolarHBondContact O-N 3.41Å; S16-N18 PolarHBondContact O-N 2.8Å; S16-A19 WeakPolarHBondContact O-CA 3.36Å; S16-A19 WeakPolarHBondContact O-CB 3.44Å; S16-A19 PolarHBondContact O-N 2.83Å; S16-L20 PolarHBondContact O-N 2.88Å
17	M	72.5	Confident	72.2	Confident	138 Å²	138	91.3 Å²	91.3	68%	0.68	52%	0.519	S	S	*	.	H	α-helix	trans	-48.2	-35.7	176.9	-175.2	66.3	103.6	0	111.8	A19 L20 I21	M17-A19 PolarHBondContact O-N 3.42Å; M17-L20 PolarHBondContact O-N 2.97Å; M17-I21 HydrophobicContact CG-CD1 3.94Å; M17-I21 VanDerWaalsContact O-CG1 3.25Å; M17-I21 WeakPolarHBondContact O-CG1 3.34Å; M17-I21 PolarHBondContact O-N 2.93Å
18	N	78.3	Confident	73.4	Confident	125 Å²	125	90.6 Å²	90.6	67%	0.668	51%	0.511	S	S	*	.	H	α-helix	trans	-62.6	-38.2	176.1	-66	2.2	0	0	113.3	S16 I21 A22	S16-N18 PolarHBondContact O-N 2.8Å; N18-I21 PolarHBondContact O-N 3.35Å; N18-A22 WeakPolarHBondContact O-CB 3.03Å; N18-A22 PolarHBondContact O-N 3.42Å
19	A	76.2	Confident	74.5	Confident	32 Å²	32	88.5 Å²	88.5	26%	0.264	50%	0.503	S	S	.	.	H	α-helix	trans	-71.6	-36.3	177	0	0	0	0	111.9	M15 S16 M17 A22 L23	M15-A19 HydrophobicContact CB-CB 3.82Å; M15-A19 HydrophobicContact CG-CB 4.14Å; M15-A19 HydrophobicContact SD-CB 4.25Å; S16-A19 WeakPolarHBondContact O-CA 3.36Å; S16-A19 WeakPolarHBondContact O-CB 3.44Å; S16-A19 PolarHBondContact O-N 2.83Å; M17-A19 PolarHBondContact O-N 3.42Å; A19-A22 PolarHBondContact O-N 2.93Å; A19-L23 WeakPolarHBondContact O-CB 3.36Å; A19-L23 PolarHBondContact O-N 3.34Å
20	L	76.6	Confident	75.9	Confident	77 Å²	77	86.5 Å²	86.5	40%	0.403	50%	0.496	S	S	.	.	H	α-helix	trans	-63.5	-43.6	171.3	-67.3	173.5	0	0	111.5	M15 S16 M17 L23 Q24	M15-L20 HydrophobicContact CB-CD2 4.48Å; M15-L20 HydrophobicContact CB-CG 4.42Å; S16-L20 PolarHBondContact O-N 2.88Å; M17-L20 PolarHBondContact O-N 2.97Å; L20-L23 PolarHBondContact O-N 3.37Å; L20-Q24 WeakPolarHBondContact O-CB 3.36Å; L20-Q24 PolarHBondContact O-N 3.38Å
21	I	80.3	Confident	77.2	Confident	88 Å²	88	84.6 Å²	84.6	45%	0.451	49%	0.492	S	S	.	.	H	α-helix	trans	-61.6	-47.4	175.6	-68.2	164.2	0	0	110.5	M17 N18 L23 Q24 L25	M17-I21 HydrophobicContact CG-CD1 3.94Å; M17-I21 VanDerWaalsContact O-CG1 3.25Å; M17-I21 WeakPolarHBondContact O-CG1 3.34Å; M17-I21 PolarHBondContact O-N 2.93Å; N18-I21 PolarHBondContact O-N 3.35Å; I21-L23 PolarHBondContact O-N 3.23Å; I21-Q24 PolarHBondContact O-N 3.26Å; I21-L25 HydrophobicContact CG2-CD1 4.1Å; I21-L25 HydrophobicContact CG2-CG 4.44Å; I21-L25 WeakPolarHBondContact O-CG 3.28Å; I21-L25 PolarHBondContact O-N 3.31Å
22	A	81.4	Confident	78.3	Confident	51 Å²	51	85.8 Å²	85.8	42%	0.421	49%	0.492	S	S	.	.	H	α-helix	trans	-60.8	-45.3	178.3	0	0	0	0	111.8	N18 A19 Q24 L25 V26	N18-A22 WeakPolarHBondContact O-CB 3.03Å; N18-A22 PolarHBondContact O-N 3.42Å; A19-A22 PolarHBondContact O-N 2.93Å; A22-Q24 VanDerWaalsContact C-N 3.33Å; A22-Q24 PolarHBondContact O-N 2.91Å; A22-L25 PolarHBondContact O-N 2.92Å; A22-V26 VanDerWaalsContact O-CG2 3.3Å; A22-V26 WeakPolarHBondContact O-CG2 3.46Å; A22-V26 PolarHBondContact O-N 3.04Å
23	L	83.9	Confident	79.5	Confident	90 Å²	90	89.9 Å²	89.9	47%	0.471	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-44.6	176.1	-175.1	67.2	0	0	111	A19 L20 I21 L25 V26 T27	A19-L23 WeakPolarHBondContact O-CB 3.36Å; A19-L23 PolarHBondContact O-N 3.34Å; L20-L23 PolarHBondContact O-N 3.37Å; I21-L23 PolarHBondContact O-N 3.23Å; L23-L25 PolarHBondContact O-N 3.46Å; L23-V26 PolarHBondContact O-N 2.89Å; L23-T27 PolarHBondContact O-N 2.89Å; L23-T27 PolarHBondContact O-OG1 3.43Å
24	Q	83.4	Confident	80.7	Confident	111 Å²	111	91.7 Å²	91.7	52%	0.519	51%	0.506	S	S	.	.	H	α-helix	trans	-62.2	-42	178.3	-174.6	59.7	75.8	0	112.1	L20 I21 A22 T27 I28	L20-Q24 WeakPolarHBondContact O-CB 3.36Å; L20-Q24 PolarHBondContact O-N 3.38Å; I21-Q24 PolarHBondContact O-N 3.26Å; A22-Q24 VanDerWaalsContact C-N 3.33Å; A22-Q24 PolarHBondContact O-N 2.91Å; Q24-T27 PolarHBondContact O-N 3.46Å; Q24-I28 HydrophobicContact CG-CD1 4.15Å; Q24-I28 VanDerWaalsContact O-CG1 3.29Å; Q24-I28 WeakPolarHBondContact O-CG1 3.29Å; Q24-I28 PolarHBondContact O-N 3.34Å
25	L	87.4	Confident	81.6	Confident	110 Å²	110	89.5 Å²	89.5	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-63.5	-41.6	175.3	-71.2	174.3	0	0	111.7	I21 A22 L23 I28 A29	I21-L25 HydrophobicContact CG2-CD1 4.1Å; I21-L25 HydrophobicContact CG2-CG 4.44Å; I21-L25 WeakPolarHBondContact O-CG 3.28Å; I21-L25 PolarHBondContact O-N 3.31Å; A22-L25 PolarHBondContact O-N 2.92Å; L23-L25 PolarHBondContact O-N 3.46Å; L25-I28 PolarHBondContact O-N 3.08Å; L25-A29 WeakPolarHBondContact O-CB 3.25Å; L25-A29 PolarHBondContact O-N 3.45Å
26	V	89.2	Confident	82.5	Confident	95 Å²	95	92.4 Å²	92.4	58%	0.576	51%	0.513	S	S	*	.	H	α-helix	trans	-63.1	-43.9	175.5	171.5	0	0	0	111	A22 L23 A29 A30	A22-V26 VanDerWaalsContact O-CG2 3.3Å; A22-V26 WeakPolarHBondContact O-CG2 3.46Å; A22-V26 PolarHBondContact O-N 3.04Å; L23-V26 PolarHBondContact O-N 2.89Å; V26-A29 PolarHBondContact O-N 2.89Å; V26-A30 WeakPolarHBondContact O-CB 3.29Å; V26-A30 PolarHBondContact O-N 3.43Å
27	T	89.9	Confident	83.1	Confident	62 Å²	62	95.5 Å²	95.5	38%	0.38	52%	0.523	S	S	.	.	H	α-helix	trans	-61.7	-43.9	176.1	-56.2	0	0	0	111.7	L23 Q24 A30 L31	L23-T27 PolarHBondContact O-N 2.89Å; L23-T27 PolarHBondContact O-OG1 3.43Å; Q24-T27 PolarHBondContact O-N 3.46Å; T27-A30 PolarHBondContact O-N 3.23Å; T27-L31 HydrophobicContact CG2-CD1 4.3Å; T27-L31 WeakPolarHBondContact O-CG 3.4Å; T27-L31 PolarHBondContact O-N 2.97Å
28	I	88.5	Confident	83.2	Confident	78 Å²	78	94.4 Å²	94.4	40%	0.4	53%	0.528	S	S	.	.	H	α-helix	trans	-62.1	-46.8	176.8	-69	164.3	0	0	110.4	Q24 L25 A30 L31 L32	Q24-I28 HydrophobicContact CG-CD1 4.15Å; Q24-I28 VanDerWaalsContact O-CG1 3.29Å; Q24-I28 WeakPolarHBondContact O-CG1 3.29Å; Q24-I28 PolarHBondContact O-N 3.34Å; L25-I28 PolarHBondContact O-N 3.08Å; I28-A30 VanDerWaalsContact C-N 3.33Å; I28-A30 PolarHBondContact O-N 3.18Å; I28-L31 PolarHBondContact O-N 3.3Å; I28-L32 HydrophobicContact CG2-CD1 4.08Å; I28-L32 HydrophobicContact CG2-CG 4.41Å; I28-L32 WeakPolarHBondContact O-CG 3.32Å; I28-L32 PolarHBondContact O-N 2.94Å
29	A	87.8	Confident	82.4	Confident	46 Å²	46	90.1 Å²	90.1	38%	0.38	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-42.9	177.3	0	0	0	0	111.9	L25 V26 L32 L33	L25-A29 WeakPolarHBondContact O-CB 3.25Å; L25-A29 PolarHBondContact O-N 3.45Å; V26-A29 PolarHBondContact O-N 2.89Å; A29-L32 PolarHBondContact O-N 3.42Å; A29-L33 WeakPolarHBondContact O-CB 3.44Å; A29-L33 VanDerWaalsContact O-CG 3.29Å; A29-L33 WeakPolarHBondContact O-CG 3.33Å; A29-L33 PolarHBondContact O-N 3.42Å
30	A	89.1	Confident	81.4	Confident	51 Å²	51	92 Å²	92	42%	0.421	54%	0.535	S	S	.	.	H	α-helix	trans	-63.8	-40.4	176.2	0	0	0	0	112.5	V26 T27 I28 L33 M34	V26-A30 WeakPolarHBondContact O-CB 3.29Å; V26-A30 PolarHBondContact O-N 3.43Å; T27-A30 PolarHBondContact O-N 3.23Å; I28-A30 VanDerWaalsContact C-N 3.33Å; I28-A30 PolarHBondContact O-N 3.18Å; A30-L33 PolarHBondContact O-N 2.91Å; A30-M34 WeakPolarHBondContact O-CB 3.31Å; A30-M34 PolarHBondContact O-N 2.88Å
31	L	86.5	Confident	80.2	Confident	108 Å²	108	91.5 Å²	91.5	57%	0.565	55%	0.549	S	S	*	.	H	α-helix	trans	-65.3	-39.8	174.7	-72.1	174.8	0	0	112	T27 I28 M34 L35	T27-L31 HydrophobicContact CG2-CD1 4.3Å; T27-L31 WeakPolarHBondContact O-CG 3.4Å; T27-L31 PolarHBondContact O-N 2.97Å; I28-L31 PolarHBondContact O-N 3.3Å; L31-M34 PolarHBondContact O-N 3.48Å; L31-L35 WeakPolarHBondContact O-CB 3.26Å; L31-L35 PolarHBondContact O-N 3.47Å
32	L	85.4	Confident	78.9	Confident	98 Å²	98	91.1 Å²	91.1	51%	0.513	56%	0.559	S	S	.	*	H	α-helix	trans	-66.2	-41.6	175	-70.3	175.2	0	0	111.7	I28 A29 L35 M36	I28-L32 HydrophobicContact CG2-CD1 4.08Å; I28-L32 HydrophobicContact CG2-CG 4.41Å; I28-L32 WeakPolarHBondContact O-CG 3.32Å; I28-L32 PolarHBondContact O-N 2.94Å; A29-L32 PolarHBondContact O-N 3.42Å; L32-L35 HydrophobicContact CD2-CD1 4.47Å; L32-L35 WeakPolarHBondContact O-CB 3.44Å; L32-L35 PolarHBondContact O-N 2.92Å; L32-M36 VanDerWaalsContact O-CG 3.28Å; L32-M36 WeakPolarHBondContact O-CG 3.39Å; L32-M36 PolarHBondContact O-N 3.47Å
33	L	85	Confident	77.7	Confident	123 Å²	123	95.4 Å²	95.4	64%	0.644	57%	0.568	S	S	*	*	H	α-helix	trans	-65.2	-40.3	174.5	-71.3	174.7	0	0	111.7	A29 A30 M36 L37	A29-L33 WeakPolarHBondContact O-CB 3.44Å; A29-L33 VanDerWaalsContact O-CG 3.29Å; A29-L33 WeakPolarHBondContact O-CG 3.33Å; A29-L33 PolarHBondContact O-N 3.42Å; A30-L33 PolarHBondContact O-N 2.91Å; L33-M36 PolarHBondContact O-N 2.9Å; L33-L37 VanDerWaalsContact O-CB 3.25Å; L33-L37 WeakPolarHBondContact O-CB 3.3Å; L33-L37 PolarHBondContact O-N 3.09Å
34	M	82.8	Confident	76	Confident	121 Å²	121	95.8 Å²	95.8	60%	0.596	58%	0.576	S	S	*	*	H	α-helix	trans	-64.1	-39.8	171.9	-86.4	-69.2	-167.2	0	111.9	A30 L31 M36 L37 C38	A30-M34 WeakPolarHBondContact O-CB 3.31Å; A30-M34 PolarHBondContact O-N 2.88Å; L31-M34 PolarHBondContact O-N 3.48Å; M34-M36 VanDerWaalsContact C-N 3.31Å; M34-M36 PolarHBondContact O-N 3.03Å; M34-L37 PolarHBondContact O-N 2.95Å; M34-C38 WeakPolarHBondContact O-CA 3.25Å; M34-C38 WeakPolarHBondContact O-CB 3.36Å; M34-C38 PolarHBondContact O-N 3.46Å
35	L	80.1	Confident	74.6	Confident	117 Å²	117	94.2 Å²	94.2	61%	0.613	58%	0.582	S	S	*	*	H	α-helix	trans	-63.3	-35.9	172.3	-90.3	161.3	0	0	111.9	L31 L32 G39	L31-L35 WeakPolarHBondContact O-CB 3.26Å; L31-L35 PolarHBondContact O-N 3.47Å; L32-L35 HydrophobicContact CD2-CD1 4.47Å; L32-L35 WeakPolarHBondContact O-CB 3.44Å; L32-L35 PolarHBondContact O-N 2.92Å; L35-G39 WeakPolarHBondContact O-CA 3.34Å; L35-G39 PolarHBondContact O-N 3.4Å
36	M	78.5	Confident	72.6	Confident	145 Å²	145	96 Å²	96	71%	0.714	59%	0.588	S	S	*	*	H	α-helix	trans	-75.1	-37.1	175.6	-70.9	-70	168.7	0	112.1	L32 L33 M34 G39 G40	L32-M36 VanDerWaalsContact O-CG 3.28Å; L32-M36 WeakPolarHBondContact O-CG 3.39Å; L32-M36 PolarHBondContact O-N 3.47Å; L33-M36 PolarHBondContact O-N 2.9Å; M34-M36 VanDerWaalsContact C-N 3.31Å; M34-M36 PolarHBondContact O-N 3.03Å; M36-G39 CarbonylContact O-C 3.49Å; M36-G40 PolarHBondContact O-N 2.99Å
37	L	81.6	Confident	70.6	Confident	140 Å²	140	94 Å²	94	73%	0.733	59%	0.586	S	S	*	*	H	α-helix	trans	-72.4	-44.7	178	-174.2	65.5	0	0	111.6	L33 M34	L33-L37 VanDerWaalsContact O-CB 3.25Å; L33-L37 WeakPolarHBondContact O-CB 3.3Å; L33-L37 PolarHBondContact O-N 3.09Å; M34-L37 PolarHBondContact O-N 2.95Å
38	C	74.6	Confident	68.5	Low	115 Å²	115	95.3 Å²	95.3	78%	0.777	60%	0.603	S	S	*	*	H	α-helix	trans	-75.8	-32.2	175.1	-164.7	0	0	0	111.4	M34 G40	M34-C38 WeakPolarHBondContact O-CA 3.25Å; M34-C38 WeakPolarHBondContact O-CB 3.36Å; M34-C38 PolarHBondContact O-N 3.46Å; C38-G40 VanDerWaalsContact C-N 3.28Å; C38-G40 PolarHBondContact O-N 3.25Å
39	G	62.7	Low	66.6	Low	34 Å²	34	97 Å²	97	35%	0.351	63%	0.629	S	S	.	*	S	Bend	trans	-83.1	3.4	173.5	0	0	0	0	114.3	L35 M36 G41 A42	L35-G39 WeakPolarHBondContact O-CA 3.34Å; L35-G39 PolarHBondContact O-N 3.4Å; M36-G39 CarbonylContact O-C 3.49Å; G39-G41 PolarHBondContact O-N 3.48Å; G39-A42 PolarHBondContact O-N 3.48Å
40	G	55.1	Low	64.6	Low	71 Å²	71	97.6 Å²	97.6	73%	0.732	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.7	4.7	168.3	0	0	0	0	114.2	M36 C38	M36-G40 PolarHBondContact O-N 2.99Å; C38-G40 VanDerWaalsContact C-N 3.28Å; C38-G40 PolarHBondContact O-N 3.25Å
41	G	51.4	Low	62.5	Low	67 Å²	67	99.3 Å²	99.3	69%	0.691	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.3	11.3	169.4	0	0	0	0	114.2	G39 K43	G39-G41 PolarHBondContact O-N 3.48Å; G41-K43 PolarHBondContact O-N 2.9Å
42	A	53.4	Low	61	Low	81 Å²	81	99.7 Å²	99.7	67%	0.669	66%	0.663	S	S	*	*	S	Bend	trans	-66.6	93.4	160.9	0	0	0	0	106.1	G39	G39-A42 PolarHBondContact O-N 3.48Å
43	K	54.8	Low	59.5	Low	140 Å²	140	99.2 Å²	99.2	61%	0.609	67%	0.672	S	S	*	*			trans	-28.5	133.8	167.3	-170.6	-179.5	164.9	66.9	107.5	G41 A45 E46	G41-K43 PolarHBondContact O-N 2.9Å; K43-A45 PolarHBondContact O-N 3.3Å; K43-A45 VanDerWaalsContact O-N 3.07Å; K43-E46 WeakPolarHBondContact CE-OE2 3.43Å; K43-E46 IonicContact NZ-OE1 3.19Å; K43-E46 PolarHBondContact NZ-OE1 3.45Å; K43-E46 IonicContact NZ-OE2 2.61Å; K43-E46 PolarHBondContact NZ-OE2 2.79Å
44	P	49.4	Very low	57.8	Low	99 Å²	99	98.8 Å²	98.8	64%	0.643	69%	0.687	S	S	*	*			trans	-46.8	132.4	165.7	-11.2	21.8	0	0	104.9	E46	P44-E46 PolarHBondContact O-N 3.2Å
45	A	53.4	Low	56.3	Low	78 Å²	78	95.8 Å²	95.8	65%	0.645	69%	0.687	S	S	*	*			trans	-58.1	91.7	167.7	0	0	0	0	106.1	K43 G47 A48	K43-A45 PolarHBondContact O-N 3.3Å; K43-A45 VanDerWaalsContact O-N 3.07Å; A45-G47 PolarHBondContact O-N 2.98Å; A45-A48 HydrophobicContact CB-CB 4.46Å; A45-A48 PolarHBondContact O-N 3.44Å
46	E	45.9	Very low	54.5	Low	147 Å²	147	94 Å²	94	69%	0.687	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.4	84	163	-93.7	152.2	87.5	0	103.3	K43 P44	K43-E46 WeakPolarHBondContact CE-OE2 3.43Å; K43-E46 IonicContact NZ-OE1 3.19Å; K43-E46 PolarHBondContact NZ-OE1 3.45Å; K43-E46 IonicContact NZ-OE2 2.61Å; K43-E46 PolarHBondContact NZ-OE2 2.79Å; P44-E46 PolarHBondContact O-N 3.2Å
47	G	46.3	Very low	53.4	Low	52 Å²	52	95.1 Å²	95.1	54%	0.536	71%	0.706	S	S	.	*	T	Hydrogen-bonded Turn	trans	163.6	-26.4	-164.3	0	0	0	0	113.3	A45 A49 G50	A45-G47 PolarHBondContact O-N 2.98Å; G47-A49 VanDerWaalsContact C-N 3.28Å; G47-A49 PolarHBondContact O-N 3.47Å; G47-G50 PolarHBondContact O-N 3.46Å
48	A	47	Very low	51.8	Low	91 Å²	91	92.9 Å²	92.9	75%	0.752	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.7	0.4	179.1	0	0	0	0	114.8	A45	A45-A48 HydrophobicContact CB-CB 4.46Å; A45-A48 PolarHBondContact O-N 3.44Å
49	A	49	Very low	50.8	Low	113 Å²	113	92.1 Å²	92.1	93%	0.934	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.2	10.3	172	0	0	0	0	113.5	G47	G47-A49 VanDerWaalsContact C-N 3.28Å; G47-A49 PolarHBondContact O-N 3.47Å
50	G	45.9	Very low	50.5	Low	58 Å²	58	94.6 Å²	94.6	60%	0.598	73%	0.727	S	S	*	*			trans	-156.8	18.7	-168.3	0	0	0	0	117.3	G47 P52	G47-G50 PolarHBondContact O-N 3.46Å; G50-P52 WeakPolarHBondContact O-CD 3.46Å
51	A	45	Very low	50.6	Low	88 Å²	88	96.7 Å²	96.7	73%	0.727	73%	0.727	S	S	*	*			trans	-83.5	99.7	163.6	0	0	0	0	108	A53	A51-A53 PolarHBondContact O-N 3.3Å
52	P	53.7	Low	50.8	Low	116 Å²	116	98.9 Å²	98.9	75%	0.753	74%	0.739	S	S	*	*			trans	-60.3	131.2	160.2	29	-32.1	0	0	105.8	G50 A54	G50-P52 WeakPolarHBondContact O-CD 3.46Å; P52-A54 PolarHBondContact O-N 2.94Å
53	A	53.4	Low	50.5	Low	87 Å²	87	99.9 Å²	99.9	72%	0.719	75%	0.747	S	S	*	*			trans	-48.9	114.6	171.6	0	0	0	0	107.7	A51 G55	A51-A53 PolarHBondContact O-N 3.3Å; A53-G55 PolarHBondContact O-N 3.29Å
54	A	49.7	Very low	50.1	Low	114 Å²	114	97 Å²	97	94%	0.942	76%	0.757	S	S	*	*	S	Bend	trans	-67	82.3	166.9	0	0	0	0	106.3	P52	P52-A54 PolarHBondContact O-N 2.94Å
55	G	50.8	Low	49.8	Very low	59 Å²	59	95.6 Å²	95.6	61%	0.608	76%	0.761	S	S	*	*	S	Bend	trans	154.3	98.1	-171.1	0	0	0	0	111.7	A53	A53-G55 PolarHBondContact O-N 3.29Å
56	G	43.3	Very low	49.8	Very low	79 Å²	79	99.5 Å²	99.5	81%	0.814	77%	0.771	S	S	*	*	S	Bend	trans	96.6	109.9	139	0	0	0	0	116.6
57	D	55	Low	50.4	Low	169 Å²	169	101.7 Å²	101.7	90%	0.904	78%	0.778	S	S	*	*			trans	79.3	109.5	162.1	-142	55.3	0	0	118.1
58	A	47.7	Very low	51.1	Low	93 Å²	93	103.5 Å²	103.5	77%	0.769	78%	0.78	S	S	*	*			trans	-84.9	113.1	178.9	0	0	0	0	109.8
59	A	53.1	Low	51.9	Low	99 Å²	99	105.1 Å²	105.1	82%	0.818	78%	0.783	S	S	*	*			trans	-100.9	91.8	148.5	0	0	0	0	107.1
60	A	57	Low	52.4	Low	86 Å²	86	107.2 Å²	107.2	71%	0.711	78%	0.779	S	S	*	*			trans	-64.3	142.6	170.9	0	0	0	0	109.6
61	P	56.9	Low	52.7	Low	115 Å²	115	108.8 Å²	108.8	75%	0.747	79%	0.786	S	S	*	*			trans	-68.6	142.7	-173	29	-34	0	0	110.5	A63	P61-A63 PolarHBondContact O-N 3.28Å
62	A	55.3	Low	53.2	Low	113 Å²	113	110.3 Å²	110.3	93%	0.934	79%	0.788	S	S	*	*			trans	-66.4	79.9	170.1	0	0	0	0	110.2	G64	A62-G64 PolarHBondContact O-N 2.88Å
63	A	48.4	Very low	53	Low	101 Å²	101	115.2 Å²	115.2	84%	0.835	80%	0.798	S	S	*	*			trans	-89.3	85.7	165.1	0	0	0	0	107.6	P61	P61-A63 PolarHBondContact O-N 3.28Å
64	G	45.3	Very low	53.1	Low	80 Å²	80	119.2 Å²	119.2	83%	0.825	83%	0.831	S	S	*	*			trans	-174.7	64.4	-176.7	0	0	0	0	111.7	A62	A62-G64 PolarHBondContact O-N 2.88Å
65	G	44.8	Very low	53.3	Low	70 Å²	70	119.5 Å²	119.5	72%	0.722	83%	0.825	S	S	*	*			trans	-163.5	38.9	-176.3	0	0	0	0	114.1
66	D	53.2	Low	53.4	Low	160 Å²	160	122.6 Å²	122.6	86%	0.856	84%	0.837	S	S	*	*			trans	-158.6	97.7	159.6	-112.1	-51.6	0	0	110
67	K	58.4	Low	54	Low	193 Å²	193	125.1 Å²	125.1	84%	0.839	84%	0.838	S	S	*	*			trans	-140.5	105.3	153.9	-172.9	168.3	-175.8	168.4	107.7	P69	K67-P69 WeakPolarHBondContact O-CD 3.4Å
68	P	60.7	Low	53.9	Low	89 Å²	89	122.5 Å²	122.5	58%	0.578	83%	0.834	S	S	*	*			trans	-65.6	128.9	167.2	-9.5	23.9	0	0	108.1	D70	P68-D70 PolarHBondContact O-N 3.43Å
69	P	64.1	Low	54.3	Low	126 Å²	126	124.3 Å²	124.3	82%	0.818	84%	0.838	S	S	*	*			trans	-74.2	103.7	157.5	28	-27.6	0	0	108.2	K67	K67-P69 WeakPolarHBondContact O-CD 3.4Å
70	D	59.4	Low	54.4	Low	157 Å²	157	126 Å²	126	84%	0.84	84%	0.839	S	S	*	*			trans	-65.4	123.8	158.5	-82.2	-54.3	0	0	109.7	P68	P68-D70 PolarHBondContact O-N 3.43Å
71	A	50.8	Low	54.2	Low	90 Å²	90	128.9 Å²	128.9	74%	0.744	85%	0.849	S	S	*	*			trans	171.4	145.2	133.1	0	0	0	0	110.5
72	P	56.1	Low	54	Low	120 Å²	120	129.9 Å²	129.9	78%	0.779	86%	0.856	S	S	*	*			trans	-84	146.5	-157	34	-33.6	0	0	112.4
73	K	50	Low	53.9	Low	219 Å²	219	131.3 Å²	131.3	95%	0.952	85%	0.85	S	S	*	*			trans	-110.9	96.3	155	-80.8	179.9	177.5	175.8	107.9
74	A	55.3	Low	54.4	Low	171 Å²	171	134.1 Å²	134.1	100%	1.413	85%	0.851	S	S	*	*			trans	-108.1	0	154.6	0	0	0	0	107.5

Retrieved 74 of 74 residues in 182.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).