A0A077ZHW4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHW4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 101 aa.

						>A0A077ZHW4_TRITR|A0A077ZHW4
MTTNESRHLDLSTVHIRQTLEGLNQNTDSSLDILIAPGFRLWMLLALVLLILLVMTVIVCCFIKLRIPRTKREIELNAVRRKLRRRKLLDTKEAHQLCKSN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.7	Very low	58.2	Low	236 Å²	236	140.6 Å²	140.6	100%	1.163	73%	0.725	S	S	*	*				0	79.8	0	-165.8	164.3	-174.8	0	0	107.6
2	T	57.3	Low	58.5	Low	129 Å²	129	136.1 Å²	136.1	79%	0.791	72%	0.715	S	S	*	*			trans	-155.7	28.3	-169.8	41.6	0	0	0	0	113.2
3	T	61.6	Low	58.6	Low	127 Å²	127	130.5 Å²	130.5	78%	0.779	69%	0.69	S	S	*	*			trans	-95.1	15.2	-172.6	50.3	0	0	0	0	115.6
4	N	66.1	Low	59.1	Low	107 Å²	107	126.6 Å²	126.6	57%	0.572	67%	0.673	S	S	*	*	S	Bend	trans	-98.6	-38.8	-175.5	-164.5	-65	0	0	0	113.9	S6 R7	N4-S6 PolarHBondContact O-N 3.41Å; N4-R7 PolarHBondContact ND2-NH1 3.18Å; N4-R7 VanDerWaalsContact ND2-NH1 3.18Å; N4-R7 PolarHBondContact O-N 3.37Å; N4-R7 VanDerWaalsContact O-N 3.15Å
5	E	59.1	Low	59.8	Low	174 Å²	174	126.9 Å²	126.9	81%	0.813	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.4	-17	-176.7	-90.3	-137	90.3	0	0	114.7	R7	E5-R7 VanDerWaalsContact C-N 3.27Å; E5-R7 PolarHBondContact O-N 3.33Å
6	S	57	Low	60.6	Low	83 Å²	83	126.8 Å²	126.8	58%	0.58	67%	0.668	S	S	*	*	H	α-helix	trans	-67.9	-24.3	176.2	-51.5	0	0	0	0	113.5	N4 H8	N4-S6 PolarHBondContact O-N 3.41Å; S6-H8 VanDerWaalsContact C-N 3.31Å; S6-H8 PolarHBondContact O-N 3.41Å
7	R	59.6	Low	61.1	Low	175 Å²	175	129.2 Å²	129.2	66%	0.66	67%	0.666	S	S	*	*	H	α-helix	trans	-70.6	-23.6	-173.9	-62.9	-167.8	-165.9	121.7	-1.6	114.1	N4 E5	N4-R7 PolarHBondContact ND2-NH1 3.18Å; N4-R7 VanDerWaalsContact ND2-NH1 3.18Å; N4-R7 PolarHBondContact O-N 3.37Å; N4-R7 VanDerWaalsContact O-N 3.15Å; E5-R7 VanDerWaalsContact C-N 3.27Å; E5-R7 PolarHBondContact O-N 3.33Å
8	H	55.9	Low	62	Low	153 Å²	153	128.7 Å²	128.7	71%	0.708	66%	0.66	S	S	*	*	H	α-helix	trans	-89.7	-26.6	-170.1	-162.2	-93.3	0	0	0	113.6	S6 D10	S6-H8 VanDerWaalsContact C-N 3.31Å; S6-H8 PolarHBondContact O-N 3.41Å; H8-D10 PolarHBondContact O-N 3.34Å
9	L	59.1	Low	62.6	Low	137 Å²	137	127.3 Å²	127.3	72%	0.717	66%	0.658	S	S	*	*	H	α-helix	trans	-67.1	-22.4	170.6	-86.1	150.8	0	0	0	112.4	T13	L9-T13 PolarHBondContact O-OG1 3.34Å
10	D	58.7	Low	63.1	Low	106 Å²	106	127.1 Å²	127.1	57%	0.567	66%	0.657	S	S	*	*	H	α-helix	trans	-64.9	-42	-179.9	-111.6	-59.9	0	0	0	112.9	H8 S12 T13 V14	H8-D10 PolarHBondContact O-N 3.34Å; D10-S12 PolarHBondContact O-N 3.06Å; D10-T13 WeakPolarHBondContact O-CB 3.38Å; D10-T13 PolarHBondContact O-N 3.44Å; D10-T13 VanDerWaalsContact O-N 3.15Å; D10-V14 PolarHBondContact O-N 3.49Å
11	L	60.7	Low	63.5	Low	120 Å²	120	127.4 Å²	127.4	63%	0.628	66%	0.656	S	S	*	*	H	α-helix	trans	-67.8	-38.3	-171.2	-171.2	64.7	0	0	0	113.5	T13 V14	L11-T13 PolarHBondContact O-N 3.36Å; L11-V14 PolarHBondContact O-N 3.15Å
12	S	61.9	Low	64.7	Low	86 Å²	86	117.4 Å²	117.4	60%	0.601	61%	0.613	S	S	*	*	H	α-helix	trans	-68.7	-28.7	177	-67.4	0	0	0	0	112	D10 V14	D10-S12 PolarHBondContact O-N 3.06Å; S12-V14 VanDerWaalsContact C-N 3.32Å; S12-V14 PolarHBondContact O-N 3.45Å
13	T	60.5	Low	65.3	Low	63 Å²	63	116.8 Å²	116.8	39%	0.387	60%	0.604	S	S	.	*	H	α-helix	trans	-70.1	-30.2	178.4	-53.7	0	0	0	0	111.7	L9 D10 L11 R17	L9-T13 PolarHBondContact O-OG1 3.34Å; D10-T13 WeakPolarHBondContact O-CB 3.38Å; D10-T13 PolarHBondContact O-N 3.44Å; D10-T13 VanDerWaalsContact O-N 3.15Å; L11-T13 PolarHBondContact O-N 3.36Å; T13-R17 PolarHBondContact O-N 3.44Å
14	V	65.5	Low	65.7	Low	76 Å²	76	115.1 Å²	115.1	46%	0.461	59%	0.59	S	S	.	*	H	α-helix	trans	-64	-43.9	179.6	178.1	0	0	0	0	111.7	D10 L11 S12 R17 Q18	D10-V14 PolarHBondContact O-N 3.49Å; L11-V14 PolarHBondContact O-N 3.15Å; S12-V14 VanDerWaalsContact C-N 3.32Å; S12-V14 PolarHBondContact O-N 3.45Å; V14-R17 PolarHBondContact O-N 3.44Å; V14-Q18 PolarHBondContact O-N 3.37Å
15	H	70	Confident	65.6	Low	131 Å²	131	116.5 Å²	116.5	61%	0.606	59%	0.593	S	S	*	*	H	α-helix	trans	-71	-38.3	-177.8	-97.6	-75.2	0	0	0	113.7	R17 Q18 T19	H15-R17 VanDerWaalsContact C-N 3.28Å; H15-R17 PolarHBondContact O-N 3.26Å; H15-Q18 PolarHBondContact O-N 2.97Å; H15-T19 PolarHBondContact O-N 3.33Å; H15-T19 PolarHBondContact O-OG1 3.46Å
16	I	72.1	Confident	65.9	Low	126 Å²	126	113.5 Å²	113.5	65%	0.646	58%	0.583	S	S	*	*	H	α-helix	trans	-64.6	-36.9	177.8	-62.5	-69.8	0	0	0	110.4	T19 L20	I16-T19 PolarHBondContact O-N 3.15Å; I16-L20 PolarHBondContact O-N 3.38Å
17	R	68.9	Low	66.3	Low	168 Å²	168	113.6 Å²	113.6	63%	0.634	58%	0.58	S	S	*	*	H	α-helix	trans	-59.1	-49.4	174.5	-85.1	-169.9	159.6	114.7	-0.9	112.2	T13 V14 H15 T19 L20 E21	T13-R17 PolarHBondContact O-N 3.44Å; V14-R17 PolarHBondContact O-N 3.44Å; H15-R17 VanDerWaalsContact C-N 3.28Å; H15-R17 PolarHBondContact O-N 3.26Å; R17-T19 PolarHBondContact O-N 3.23Å; R17-L20 PolarHBondContact O-N 3.17Å; R17-E21 WeakPolarHBondContact O-CG 3.4Å; R17-E21 PolarHBondContact O-N 3.37Å
18	Q	76.8	Confident	66.2	Low	120 Å²	120	108.9 Å²	108.9	56%	0.561	57%	0.568	S	S	*	*	H	α-helix	trans	-57.9	-34.6	-178.6	-69.1	178.7	-77.9	0	0	113	V14 H15 G22	V14-Q18 PolarHBondContact O-N 3.37Å; H15-Q18 PolarHBondContact O-N 2.97Å; Q18-G22 PolarHBondContact O-N 3.03Å
19	T	74.6	Confident	66.4	Low	101 Å²	101	105.6 Å²	105.6	62%	0.62	56%	0.562	S	S	*	*	H	α-helix	trans	-73.1	-37.2	178.2	-54	0	0	0	0	112.1	H15 I16 R17 G22 L23	H15-T19 PolarHBondContact O-N 3.33Å; H15-T19 PolarHBondContact O-OG1 3.46Å; I16-T19 PolarHBondContact O-N 3.15Å; R17-T19 PolarHBondContact O-N 3.23Å; T19-G22 PolarHBondContact O-N 3.06Å; T19-L23 PolarHBondContact O-N 3.23Å
20	L	73	Confident	66.4	Low	123 Å²	123	103.3 Å²	103.3	64%	0.644	56%	0.558	S	S	*	*	H	α-helix	trans	-68.2	-38.1	177	-168.7	69.7	0	0	0	111.7	I16 R17 G22 L23 N24	I16-L20 PolarHBondContact O-N 3.38Å; R17-L20 PolarHBondContact O-N 3.17Å; L20-G22 VanDerWaalsContact C-N 3.31Å; L20-G22 PolarHBondContact O-N 2.8Å; L20-L23 PolarHBondContact O-N 3.37Å; L20-N24 PolarHBondContact O-N 3.21Å
21	E	70.7	Confident	66.3	Low	135 Å²	135	101.3 Å²	101.3	63%	0.631	55%	0.547	S	S	*	.	H	α-helix	trans	-64.5	-35.9	177.1	-59.9	-152.4	127.9	0	0	112	R17 L23 N24 Q25	R17-E21 WeakPolarHBondContact O-CG 3.4Å; R17-E21 PolarHBondContact O-N 3.37Å; E21-L23 PolarHBondContact O-N 3.38Å; E21-N24 PolarHBondContact O-N 3.19Å; E21-Q25 WeakPolarHBondContact O-CG 3.39Å; E21-Q25 PolarHBondContact O-N 3.45Å; E21-Q25 VanDerWaalsContact O-N 3.09Å
22	G	70.5	Confident	66.2	Low	25 Å²	25	100.7 Å²	100.7	26%	0.258	54%	0.544	S	S	.	.	H	α-helix	trans	-63.7	-37.9	175.1	0	0	0	0	0	114.1	Q18 T19 L20 N26	Q18-G22 PolarHBondContact O-N 3.03Å; T19-G22 PolarHBondContact O-N 3.06Å; L20-G22 VanDerWaalsContact C-N 3.31Å; L20-G22 PolarHBondContact O-N 2.8Å; G22-N26 PolarHBondContact O-ND2 3.09Å
23	L	70.1	Confident	66.1	Low	116 Å²	116	103.5 Å²	103.5	61%	0.607	55%	0.551	S	S	*	*	H	α-helix	trans	-69.4	-37.5	174.7	-77.8	172.3	0	0	0	112.2	T19 L20 E21 N26 T27	T19-L23 PolarHBondContact O-N 3.23Å; L20-L23 PolarHBondContact O-N 3.37Å; E21-L23 PolarHBondContact O-N 3.38Å; L23-N26 PolarHBondContact O-N 3.47Å; L23-T27 PolarHBondContact O-N 3.32Å; L23-T27 PolarHBondContact O-OG1 3.47Å
24	N	68.2	Low	66	Low	93 Å²	93	107.4 Å²	107.4	50%	0.497	57%	0.569	S	S	.	*	H	α-helix	trans	-61.9	-46.3	177.5	-166.6	76.6	0	0	0	111.3	L20 E21 N26 T27 D28	L20-N24 PolarHBondContact O-N 3.21Å; E21-N24 PolarHBondContact O-N 3.19Å; N24-N26 VanDerWaalsContact C-N 3.26Å; N24-N26 PolarHBondContact O-N 3.19Å; N24-T27 WeakPolarHBondContact O-CB 3.37Å; N24-T27 PolarHBondContact O-N 3.31Å; N24-D28 PolarHBondContact ND2-OD2 3.12Å; N24-D28 PolarHBondContact O-N 2.95Å
25	Q	63.9	Low	65.5	Low	135 Å²	135	105.3 Å²	105.3	63%	0.631	55%	0.554	S	S	*	*	H	α-helix	trans	-57	-35.3	178.7	-71.5	-179.9	-60.4	0	0	113.7	E21 S29	E21-Q25 WeakPolarHBondContact O-CG 3.39Å; E21-Q25 PolarHBondContact O-N 3.45Å; E21-Q25 VanDerWaalsContact O-N 3.09Å; Q25-S29 PolarHBondContact O-OG 3.29Å
26	N	66.9	Low	65.2	Low	111 Å²	111	102.2 Å²	102.2	59%	0.594	55%	0.551	S	S	*	*	H	α-helix	trans	-69.6	-33	175.9	-71.2	-63.9	0	0	0	112.6	G22 L23 N24	G22-N26 PolarHBondContact O-ND2 3.09Å; L23-N26 PolarHBondContact O-N 3.47Å; N24-N26 VanDerWaalsContact C-N 3.26Å; N24-N26 PolarHBondContact O-N 3.19Å
27	T	64.1	Low	64.6	Low	85 Å²	85	103.1 Å²	103.1	52%	0.521	57%	0.565	S	S	.	*	H	α-helix	trans	-70.3	-41.2	179.7	-56.5	0	0	0	0	111.3	L23 N24 S29 S30 L31	L23-T27 PolarHBondContact O-N 3.32Å; L23-T27 PolarHBondContact O-OG1 3.47Å; N24-T27 WeakPolarHBondContact O-CB 3.37Å; N24-T27 PolarHBondContact O-N 3.31Å; T27-S29 VanDerWaalsContact C-N 3.32Å; T27-S29 PolarHBondContact O-N 3.18Å; T27-S30 PolarHBondContact O-N 3.24Å; T27-L31 PolarHBondContact O-N 3.4Å
28	D	59.2	Low	64.3	Low	77 Å²	77	98.3 Å²	98.3	41%	0.412	57%	0.569	S	S	.	*	H	α-helix	trans	-57.5	-45.6	179.7	-63.8	-39	0	0	0	111.2	N24 S30 L31 D32	N24-D28 PolarHBondContact ND2-OD2 3.12Å; N24-D28 PolarHBondContact O-N 2.95Å; D28-S30 PolarHBondContact O-N 3.25Å; D28-L31 PolarHBondContact O-N 3.38Å; D28-D32 PolarHBondContact O-N 3.23Å; D28-D32 VanDerWaalsContact O-N 3.12Å
29	S	59.8	Low	63.6	Low	84 Å²	84	99.7 Å²	99.7	59%	0.587	57%	0.573	S	S	*	*	H	α-helix	trans	-60.9	-39.3	-176.6	-54.7	0	0	0	0	114	Q25 T27	Q25-S29 PolarHBondContact O-OG 3.29Å; T27-S29 VanDerWaalsContact C-N 3.32Å; T27-S29 PolarHBondContact O-N 3.18Å
30	S	58.4	Low	63.8	Low	89 Å²	89	103.9 Å²	103.9	62%	0.622	58%	0.577	S	S	*	*	H	α-helix	trans	-83.1	-22.8	-177.9	-65.9	0	0	0	0	112.7	T27 D28 I33	T27-S30 PolarHBondContact O-N 3.24Å; D28-S30 PolarHBondContact O-N 3.25Å; S30-I33 VanDerWaalsContact O-CG2 3.25Å; S30-I33 WeakPolarHBondContact O-CG2 3.44Å
31	L	57.6	Low	64	Low	63 Å²	63	103.8 Å²	103.8	33%	0.33	58%	0.577	S	S	.	*	H	α-helix	trans	-79.8	-38.9	178.2	-150.8	70.7	0	0	0	110.3	T27 D28 I33 L34 I35 L44	T27-L31 PolarHBondContact O-N 3.4Å; D28-L31 PolarHBondContact O-N 3.38Å; L31-I33 VanDerWaalsContact C-N 3.29Å; L31-I33 PolarHBondContact O-N 3.27Å; L31-L34 CarbonylContact O-C 3.54Å; L31-L34 PolarHBondContact O-N 3.45Å; L31-I35 HydrophobicContact CB-CD1 3.74Å; L31-I35 HydrophobicContact CD2-CD1 3.55Å; L31-I35 HydrophobicContact CG-CD1 3.32Å; L31-I35 HydrophobicContact CG-CG1 4.01Å; L31-I35 WeakPolarHBondContact O-CB 3.25Å; L31-I35 WeakPolarHBondContact O-CD1 3.15Å; L31-I35 WeakPolarHBondContact O-CG1 3.33Å; L31-I35 PolarHBondContact O-N 3.24Å; L31-L44 HydrophobicContact CD2-CD2 4.28Å
32	D	56.8	Low	64.8	Low	107 Å²	107	106.8 Å²	106.8	57%	0.572	58%	0.583	S	S	*	*	H	α-helix	trans	-56.7	-37.5	-177.5	-77.2	-32.8	0	0	0	113.8	D28 L34 I35 A36	D28-D32 PolarHBondContact O-N 3.23Å; D28-D32 VanDerWaalsContact O-N 3.12Å; D32-L34 VanDerWaalsContact C-N 3.32Å; D32-L34 PolarHBondContact O-N 2.99Å; D32-I35 PolarHBondContact O-N 2.86Å; D32-A36 PolarHBondContact O-N 3.26Å
33	I	61.1	Low	65.4	Low	146 Å²	146	110.5 Å²	110.5	75%	0.749	60%	0.595	S	S	*	*	H	α-helix	trans	-66.7	-32.9	177	-170.6	67.4	0	0	0	112.4	S30 L31	S30-I33 VanDerWaalsContact O-CG2 3.25Å; S30-I33 WeakPolarHBondContact O-CG2 3.44Å; L31-I33 VanDerWaalsContact C-N 3.29Å; L31-I33 PolarHBondContact O-N 3.27Å
34	L	58.4	Low	65.9	Low	145 Å²	145	109.2 Å²	109.2	76%	0.759	59%	0.588	S	S	*	*	H	α-helix	trans	-81.3	-28.8	175.6	-170.9	65	0	0	0	111.6	L31 D32	L31-L34 CarbonylContact O-C 3.54Å; L31-L34 PolarHBondContact O-N 3.45Å; D32-L34 VanDerWaalsContact C-N 3.32Å; D32-L34 PolarHBondContact O-N 2.99Å
35	I	55.4	Low	66.8	Low	31 Å²	31	109.9 Å²	109.9	16%	0.159	59%	0.591	C	S	.	*	H	α-helix	trans	-77.7	-18.4	-175.6	-70.1	160.5	0	0	0	113	L31 D32	L31-I35 HydrophobicContact CB-CD1 3.74Å; L31-I35 HydrophobicContact CD2-CD1 3.55Å; L31-I35 HydrophobicContact CG-CD1 3.32Å; L31-I35 HydrophobicContact CG-CG1 4.01Å; L31-I35 WeakPolarHBondContact O-CB 3.25Å; L31-I35 WeakPolarHBondContact O-CD1 3.15Å; L31-I35 WeakPolarHBondContact O-CG1 3.33Å; L31-I35 PolarHBondContact O-N 3.24Å; D32-I35 PolarHBondContact O-N 2.86Å
36	A	62.1	Low	68	Low	66 Å²	66	106.2 Å²	106.2	55%	0.545	58%	0.584	S	S	.	*	G	3₁₀ helix	trans	34.8	102.4	172.8	0	0	0	0	0	113.8	D32 G38	D32-A36 PolarHBondContact O-N 3.26Å; A36-G38 VanDerWaalsContact C-N 3.34Å; A36-G38 PolarHBondContact O-N 2.73Å
37	P	60	Low	69	Low	145 Å²	145	105.5 Å²	105.5	94%	0.942	58%	0.579	S	S	*	*	G	3₁₀ helix	trans	-51.7	75.8	-144.6	30.3	-39.6	0	0	0	116.4
38	G	63.7	Low	70.4	Confident	68 Å²	68	105.1 Å²	105.1	70%	0.701	58%	0.577	S	S	*	*	G	3₁₀ helix	trans	-179.4	-17.7	177.2	0	0	0	0	0	117.6	A36 R40	A36-G38 VanDerWaalsContact C-N 3.34Å; A36-G38 PolarHBondContact O-N 2.73Å; G38-R40 PolarHBondContact O-N 3.39Å
39	F	61.5	Low	72.1	Confident	148 Å²	148	106.5 Å²	106.5	65%	0.649	58%	0.584	S	S	*	*	S	Bend	trans	-94.4	99.3	-179.3	-144.6	-109.7	0	0	0	111.2	L41 M43	F39-L41 PolarHBondContact O-N 2.98Å; F39-M43 HydrophobicContact CD1-CE 4.43Å; F39-M43 HydrophobicContact CE1-CE 3.68Å; F39-M43 HydrophobicContact CE1-CG 4.22Å; F39-M43 HydrophobicContact CE2-CE 4.15Å; F39-M43 HydrophobicContact CZ-CE 3.53Å
40	R	78.1	Confident	73.8	Confident	189 Å²	189	107.3 Å²	107.3	71%	0.713	58%	0.581	S	S	*	*			trans	-38.8	122.8	-171.1	-75.6	176	170.6	-159.5	-3.4	114.7	G38 W42 M43	G38-R40 PolarHBondContact O-N 3.39Å; R40-W42 HydrophobicContact CB-CB 4.41Å; R40-W42 PolarHBondContact O-N 3.13Å; R40-M43 VanDerWaalsContact O-CB 3.27Å; R40-M43 WeakPolarHBondContact O-CB 3.33Å; R40-M43 PolarHBondContact O-N 3.24Å
41	L	77.9	Confident	75.6	Confident	122 Å²	122	107.2 Å²	107.2	64%	0.639	57%	0.573	S	S	*	*	H	α-helix	trans	-47.1	-33	169.7	-69.3	92.5	0	0	0	113.6	F39 M43 L44 L45	F39-L41 PolarHBondContact O-N 2.98Å; L41-M43 PolarHBondContact O-N 3.34Å; L41-L44 WeakPolarHBondContact O-CB 3.38Å; L41-L44 PolarHBondContact O-N 3.48Å; L41-L45 PolarHBondContact O-N 3.07Å; L41-L45 VanDerWaalsContact O-N 3.13Å
42	W	87.1	Confident	77.4	Confident	197 Å²	197	109.2 Å²	109.2	75%	0.746	58%	0.583	S	S	*	*	H	α-helix	trans	-54.2	-35.7	174.4	-68.2	95.5	0	0	0	113.6	R40 A46	R40-W42 HydrophobicContact CB-CB 4.41Å; R40-W42 PolarHBondContact O-N 3.13Å; W42-A46 VanDerWaalsContact O-CB 3.28Å; W42-A46 WeakPolarHBondContact O-CB 3.46Å; W42-A46 PolarHBondContact O-N 2.92Å
43	M	83.1	Confident	79.2	Confident	104 Å²	104	109.5 Å²	109.5	51%	0.512	58%	0.584	S	S	.	*	H	α-helix	trans	-66.7	-40.5	177.9	-155.5	96	77.6	0	0	111.1	F39 R40 L41 L47	F39-M43 HydrophobicContact CD1-CE 4.43Å; F39-M43 HydrophobicContact CE1-CE 3.68Å; F39-M43 HydrophobicContact CE1-CG 4.22Å; F39-M43 HydrophobicContact CE2-CE 4.15Å; F39-M43 HydrophobicContact CZ-CE 3.53Å; R40-M43 VanDerWaalsContact O-CB 3.27Å; R40-M43 WeakPolarHBondContact O-CB 3.33Å; R40-M43 PolarHBondContact O-N 3.24Å; L41-M43 PolarHBondContact O-N 3.34Å; M43-L47 VanDerWaalsContact O-CB 3.25Å; M43-L47 WeakPolarHBondContact O-CB 3.25Å; M43-L47 PolarHBondContact O-N 3Å
44	L	81.2	Confident	80.9	Confident	88 Å²	88	105.4 Å²	105.4	46%	0.461	57%	0.566	S	S	.	*	H	α-helix	trans	-64.5	-49.2	179.2	-131.1	81.7	0	0	0	110.6	L31 L41 A46 L47 V48	L31-L44 HydrophobicContact CD2-CD2 4.28Å; L41-L44 WeakPolarHBondContact O-CB 3.38Å; L41-L44 PolarHBondContact O-N 3.48Å; L44-A46 VanDerWaalsContact C-N 3.34Å; L44-A46 PolarHBondContact O-N 3.26Å; L44-L47 PolarHBondContact O-N 3.45Å; L44-V48 WeakPolarHBondContact O-CG2 3.38Å; L44-V48 PolarHBondContact O-N 2.77Å
45	L	86.7	Confident	82.7	Confident	107 Å²	107	103.3 Å²	103.3	56%	0.56	55%	0.553	S	S	*	*	H	α-helix	trans	-61.1	-44.8	178.7	-175.4	62.3	0	0	0	111.4	L41 L47 V48 L49	L41-L45 PolarHBondContact O-N 3.07Å; L41-L45 VanDerWaalsContact O-N 3.13Å; L45-L47 PolarHBondContact O-N 2.85Å; L45-V48 PolarHBondContact O-N 3.33Å; L45-L49 HydrophobicContact CG-CD1 4.37Å; L45-L49 WeakPolarHBondContact O-CG 3.36Å; L45-L49 PolarHBondContact O-N 3.02Å; L45-L49 VanDerWaalsContact O-N 3.14Å
46	A	88.9	Confident	84.5	Confident	59 Å²	59	105.8 Å²	105.8	49%	0.488	57%	0.57	S	S	.	*	H	α-helix	trans	-62	-43.1	177	0	0	0	0	0	112.2	W42 L44 L49 L50	W42-A46 VanDerWaalsContact O-CB 3.28Å; W42-A46 WeakPolarHBondContact O-CB 3.46Å; W42-A46 PolarHBondContact O-N 2.92Å; L44-A46 VanDerWaalsContact C-N 3.34Å; L44-A46 PolarHBondContact O-N 3.26Å; A46-L49 PolarHBondContact O-N 3.49Å; A46-L50 VanDerWaalsContact O-CB 3.29Å; A46-L50 WeakPolarHBondContact O-CB 3.24Å; A46-L50 PolarHBondContact O-N 3.16Å
47	L	88.7	Confident	86.1	Confident	95 Å²	95	106.4 Å²	106.4	50%	0.497	57%	0.567	S	S	.	*	H	α-helix	trans	-63.9	-44.7	-179.9	-175.5	64.4	0	0	0	111.8	M43 L44 L45 L50 I51	M43-L47 VanDerWaalsContact O-CB 3.25Å; M43-L47 WeakPolarHBondContact O-CB 3.25Å; M43-L47 PolarHBondContact O-N 3Å; L44-L47 PolarHBondContact O-N 3.45Å; L45-L47 PolarHBondContact O-N 2.85Å; L47-L50 PolarHBondContact O-N 3.01Å; L47-I51 HydrophobicContact CD1-CD1 4.04Å; L47-I51 HydrophobicContact CD1-CG1 4.39Å; L47-I51 HydrophobicContact CG-CD1 3.82Å; L47-I51 WeakPolarHBondContact O-CD1 3.38Å; L47-I51 VanDerWaalsContact O-CG1 3.24Å; L47-I51 WeakPolarHBondContact O-CG1 3.27Å; L47-I51 PolarHBondContact O-N 3.41Å
48	V	92.8	Very high	87.6	Confident	78 Å²	78	102.9 Å²	102.9	47%	0.473	54%	0.539	S	S	.	.	H	α-helix	trans	-61.1	-48	178.4	172.4	0	0	0	0	110.8	L44 L45 L50 I51 L52	L44-V48 WeakPolarHBondContact O-CG2 3.38Å; L44-V48 PolarHBondContact O-N 2.77Å; L45-V48 PolarHBondContact O-N 3.33Å; V48-L50 VanDerWaalsContact C-N 3.35Å; V48-L50 PolarHBondContact O-N 3.46Å; V48-I51 PolarHBondContact O-N 3.03Å; V48-L52 HydrophobicContact CG1-CD1 4.18Å; V48-L52 WeakPolarHBondContact O-CG 3.29Å; V48-L52 PolarHBondContact O-N 3.43Å; V48-L52 VanDerWaalsContact O-N 3.16Å
49	L	94.8	Very high	88.9	Confident	106 Å²	106	103.4 Å²	103.4	56%	0.555	53%	0.528	S	S	*	.	H	α-helix	trans	-62.1	-42.1	177.9	-70.1	174.9	0	0	0	112.2	L45 A46 L53	L45-L49 HydrophobicContact CG-CD1 4.37Å; L45-L49 WeakPolarHBondContact O-CG 3.36Å; L45-L49 PolarHBondContact O-N 3.02Å; L45-L49 VanDerWaalsContact O-N 3.14Å; A46-L49 PolarHBondContact O-N 3.49Å; L49-L53 WeakPolarHBondContact O-CB 3.38Å; L49-L53 PolarHBondContact O-N 2.92Å
50	L	95.3	Very high	90.3	Very high	100 Å²	100	99 Å²	99	52%	0.524	52%	0.515	S	S	.	.	H	α-helix	trans	-62.1	-47.4	178.9	179.9	64.5	0	0	0	111.7	A46 L47 V48 L52 L53 V54	A46-L50 VanDerWaalsContact O-CB 3.29Å; A46-L50 WeakPolarHBondContact O-CB 3.24Å; A46-L50 PolarHBondContact O-N 3.16Å; L47-L50 PolarHBondContact O-N 3.01Å; V48-L50 VanDerWaalsContact C-N 3.35Å; V48-L50 PolarHBondContact O-N 3.46Å; L50-L52 PolarHBondContact O-N 3.49Å; L50-L53 PolarHBondContact O-N 3.34Å; L50-V54 HydrophobicContact CD1-CG2 4.1Å; L50-V54 HydrophobicContact CG-CG2 4.41Å; L50-V54 WeakPolarHBondContact O-CB 3.27Å; L50-V54 VanDerWaalsContact O-CG2 3.24Å; L50-V54 WeakPolarHBondContact O-CG2 3.28Å; L50-V54 PolarHBondContact O-N 3.42Å
51	I	96	Very high	90.7	Very high	88 Å²	88	92.5 Å²	92.5	45%	0.451	50%	0.498	S	S	.	.	H	α-helix	trans	-61.2	-47.4	-179.2	-68.1	163.7	0	0	0	110.4	L47 V48 L53 V54 M55	L47-I51 HydrophobicContact CD1-CD1 4.04Å; L47-I51 HydrophobicContact CD1-CG1 4.39Å; L47-I51 HydrophobicContact CG-CD1 3.82Å; L47-I51 WeakPolarHBondContact O-CD1 3.38Å; L47-I51 VanDerWaalsContact O-CG1 3.24Å; L47-I51 WeakPolarHBondContact O-CG1 3.27Å; L47-I51 PolarHBondContact O-N 3.41Å; V48-I51 PolarHBondContact O-N 3.03Å; I51-L53 VanDerWaalsContact C-N 3.33Å; I51-L53 PolarHBondContact O-N 2.95Å; I51-V54 PolarHBondContact O-N 3.47Å; I51-M55 HydrophobicContact CG2-CG 4.34Å; I51-M55 WeakPolarHBondContact O-CB 3.34Å; I51-M55 VanDerWaalsContact O-CG 3.31Å; I51-M55 WeakPolarHBondContact O-CG 3.41Å; I51-M55 PolarHBondContact O-N 3.14Å
52	L	95.7	Very high	91	Very high	105 Å²	105	91.7 Å²	91.7	55%	0.55	49%	0.49	S	S	.	.	H	α-helix	trans	-61.2	-41.9	179.2	-69.8	176.1	0	0	0	112	V48 L50 T56	V48-L52 HydrophobicContact CG1-CD1 4.18Å; V48-L52 WeakPolarHBondContact O-CG 3.29Å; V48-L52 PolarHBondContact O-N 3.43Å; V48-L52 VanDerWaalsContact O-N 3.16Å; L50-L52 PolarHBondContact O-N 3.49Å; L52-T56 WeakPolarHBondContact O-CB 3.44Å; L52-T56 PolarHBondContact O-N 3.02Å; L52-T56 PolarHBondContact O-OG1 3.39Å
53	L	95.8	Very high	90.7	Very high	112 Å²	112	87.6 Å²	87.6	59%	0.586	48%	0.481	S	S	*	.	H	α-helix	trans	-63.8	-48.7	177.6	-167.9	77.9	0	0	0	111.2	L49 L50 I51 M55 T56 V57	L49-L53 WeakPolarHBondContact O-CB 3.38Å; L49-L53 PolarHBondContact O-N 2.92Å; L50-L53 PolarHBondContact O-N 3.34Å; I51-L53 VanDerWaalsContact C-N 3.33Å; I51-L53 PolarHBondContact O-N 2.95Å; L53-M55 PolarHBondContact O-N 3.02Å; L53-T56 PolarHBondContact O-N 3.32Å; L53-V57 VanDerWaalsContact O-CG2 3.29Å; L53-V57 WeakPolarHBondContact O-CG2 3.28Å; L53-V57 PolarHBondContact O-N 3.46Å
54	V	95.9	Very high	90.7	Very high	61 Å²	61	90 Å²	90	37%	0.37	49%	0.489	S	S	.	.	H	α-helix	trans	-61.8	-46.4	-179.9	172.8	0	0	0	0	110.6	L50 I51 T56 V57 I58	L50-V54 HydrophobicContact CD1-CG2 4.1Å; L50-V54 HydrophobicContact CG-CG2 4.41Å; L50-V54 WeakPolarHBondContact O-CB 3.27Å; L50-V54 VanDerWaalsContact O-CG2 3.24Å; L50-V54 WeakPolarHBondContact O-CG2 3.28Å; L50-V54 PolarHBondContact O-N 3.42Å; I51-V54 PolarHBondContact O-N 3.47Å; V54-T56 VanDerWaalsContact C-N 3.35Å; V54-T56 PolarHBondContact O-N 3.39Å; V54-V57 PolarHBondContact O-N 2.97Å; V54-I58 HydrophobicContact CG1-CD1 3.54Å; V54-I58 HydrophobicContact CG1-CG1 4.24Å; V54-I58 WeakPolarHBondContact O-CB 3.31Å; V54-I58 WeakPolarHBondContact O-CG1 3.45Å; V54-I58 PolarHBondContact O-N 2.89Å
55	M	95.4	Very high	90.1	Very high	100 Å²	100	90.6 Å²	90.6	49%	0.493	49%	0.492	S	S	.	.	H	α-helix	trans	-59.9	-45	177.4	-72.3	-58	109.4	0	0	111.8	I51 L53 I58 V59	I51-M55 HydrophobicContact CG2-CG 4.34Å; I51-M55 WeakPolarHBondContact O-CB 3.34Å; I51-M55 VanDerWaalsContact O-CG 3.31Å; I51-M55 WeakPolarHBondContact O-CG 3.41Å; I51-M55 PolarHBondContact O-N 3.14Å; L53-M55 PolarHBondContact O-N 3.02Å; M55-I58 HydrophobicContact CE-CD1 4.02Å; M55-I58 PolarHBondContact O-N 3.43Å; M55-V59 WeakPolarHBondContact O-CB 3.24Å; M55-V59 VanDerWaalsContact O-CG2 3.27Å; M55-V59 WeakPolarHBondContact O-CG2 3.16Å; M55-V59 PolarHBondContact O-N 2.89Å
56	T	95	Very high	89.5	Confident	84 Å²	84	93.2 Å²	93.2	52%	0.515	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-44.8	-179.9	-56.9	0	0	0	0	111.6	L52 L53 V54 V59 C60	L52-T56 WeakPolarHBondContact O-CB 3.44Å; L52-T56 PolarHBondContact O-N 3.02Å; L52-T56 PolarHBondContact O-OG1 3.39Å; L53-T56 PolarHBondContact O-N 3.32Å; V54-T56 VanDerWaalsContact C-N 3.35Å; V54-T56 PolarHBondContact O-N 3.39Å; T56-V59 PolarHBondContact O-N 3.38Å; T56-C60 VanDerWaalsContact O-CB 3.26Å; T56-C60 WeakPolarHBondContact O-CB 3.26Å; T56-C60 PolarHBondContact O-N 3.3Å; T56-C60 PolarHBondContact O-SG 2.91Å
57	V	94.5	Very high	88.9	Confident	79 Å²	79	95.9 Å²	95.9	48%	0.479	50%	0.5	S	S	.	.	H	α-helix	trans	-64.1	-46.6	178.2	172.3	0	0	0	0	110.6	L53 V54 C60 C61	L53-V57 VanDerWaalsContact O-CG2 3.29Å; L53-V57 WeakPolarHBondContact O-CG2 3.28Å; L53-V57 PolarHBondContact O-N 3.46Å; V54-V57 PolarHBondContact O-N 2.97Å; V57-C60 PolarHBondContact O-N 3.49Å; V57-C61 VanDerWaalsContact O-CB 3.24Å; V57-C61 WeakPolarHBondContact O-CB 3.29Å; V57-C61 PolarHBondContact O-N 3.48Å; V57-C61 PolarHBondContact O-SG 3.46Å
58	I	91.4	Very high	87.9	Confident	70 Å²	70	94.1 Å²	94.1	36%	0.359	49%	0.494	S	S	.	.	H	α-helix	trans	-55.7	-56.6	175.2	-72	172.4	0	0	0	109.6	V54 M55 C60 C61 F62	V54-I58 HydrophobicContact CG1-CD1 3.54Å; V54-I58 HydrophobicContact CG1-CG1 4.24Å; V54-I58 WeakPolarHBondContact O-CB 3.31Å; V54-I58 WeakPolarHBondContact O-CG1 3.45Å; V54-I58 PolarHBondContact O-N 2.89Å; M55-I58 HydrophobicContact CE-CD1 4.02Å; M55-I58 PolarHBondContact O-N 3.43Å; I58-C60 VanDerWaalsContact C-N 3.32Å; I58-C60 PolarHBondContact O-N 2.93Å; I58-C61 PolarHBondContact O-N 3.05Å; I58-C61 VanDerWaalsContact O-N 3.14Å; I58-F62 HydrophobicContact CB-CD2 4.47Å; I58-F62 HydrophobicContact CG2-CD2 3.54Å; I58-F62 HydrophobicContact CG2-CE2 3.6Å; I58-F62 WeakPolarHBondContact O-CB 3.43Å; I58-F62 WeakPolarHBondContact O-CD2 3.38Å; I58-F62 PolarHBondContact O-N 2.77Å
59	V	92.1	Very high	87.1	Confident	79 Å²	79	97.8 Å²	97.8	48%	0.479	50%	0.499	S	S	.	.	H	α-helix	trans	-58.6	-44.9	-177.5	172.3	0	0	0	0	111.4	M55 T56 C61 F62 I63	M55-V59 WeakPolarHBondContact O-CB 3.24Å; M55-V59 VanDerWaalsContact O-CG2 3.27Å; M55-V59 WeakPolarHBondContact O-CG2 3.16Å; M55-V59 PolarHBondContact O-N 2.89Å; T56-V59 PolarHBondContact O-N 3.38Å; V59-C61 PolarHBondContact O-N 2.95Å; V59-F62 PolarHBondContact O-N 3.14Å; V59-I63 HydrophobicContact CG1-CD1 3.69Å; V59-I63 HydrophobicContact CG1-CG1 4.44Å; V59-I63 VanDerWaalsContact O-CG1 3.28Å; V59-I63 WeakPolarHBondContact O-CG1 3.24Å; V59-I63 PolarHBondContact O-N 3.44Å
60	C	89.7	Confident	86.3	Confident	55 Å²	55	96.2 Å²	96.2	37%	0.372	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-44.7	176.6	-72.8	0	0	0	0	112.7	T56 V57 I58 K64	T56-C60 VanDerWaalsContact O-CB 3.26Å; T56-C60 WeakPolarHBondContact O-CB 3.26Å; T56-C60 PolarHBondContact O-N 3.3Å; T56-C60 PolarHBondContact O-SG 2.91Å; V57-C60 PolarHBondContact O-N 3.49Å; I58-C60 VanDerWaalsContact C-N 3.32Å; I58-C60 PolarHBondContact O-N 2.93Å; C60-K64 WeakPolarHBondContact O-CB 3.33Å; C60-K64 WeakPolarHBondContact O-CG 3.47Å; C60-K64 PolarHBondContact O-N 2.74Å
61	C	87.4	Confident	85.4	Confident	53 Å²	53	98.1 Å²	98.1	36%	0.358	50%	0.498	S	S	.	.	H	α-helix	trans	-68.4	-41.7	178.5	-74.6	0	0	0	0	111.5	V57 I58 V59 K64 L65	V57-C61 VanDerWaalsContact O-CB 3.24Å; V57-C61 WeakPolarHBondContact O-CB 3.29Å; V57-C61 PolarHBondContact O-N 3.48Å; V57-C61 PolarHBondContact O-SG 3.46Å; I58-C61 PolarHBondContact O-N 3.05Å; I58-C61 VanDerWaalsContact O-N 3.14Å; V59-C61 PolarHBondContact O-N 2.95Å; C61-K64 PolarHBondContact O-N 2.84Å; C61-L65 HydrophobicContact CB-CD1 4.04Å; C61-L65 WeakPolarHBondContact O-CA 3.18Å; C61-L65 WeakPolarHBondContact O-CB 3.4Å; C61-L65 WeakPolarHBondContact O-CG 2.95Å; C61-L65 PolarHBondContact O-N 3.25Å
62	F	83.3	Confident	84.6	Confident	106 Å²	106	102.9 Å²	102.9	47%	0.465	51%	0.51	S	S	.	.	I	π-helix	trans	-64.8	-45.2	178.9	-89.5	-102.4	0	0	0	111	I58 V59 R66	I58-F62 HydrophobicContact CB-CD2 4.47Å; I58-F62 HydrophobicContact CG2-CD2 3.54Å; I58-F62 HydrophobicContact CG2-CE2 3.6Å; I58-F62 WeakPolarHBondContact O-CB 3.43Å; I58-F62 WeakPolarHBondContact O-CD2 3.38Å; I58-F62 PolarHBondContact O-N 2.77Å; V59-F62 PolarHBondContact O-N 3.14Å; F62-R66 WeakPolarHBondContact O-CB 3.11Å; F62-R66 PolarHBondContact O-N 3.14Å
63	I	80.5	Confident	83.9	Confident	110 Å²	110	102.5 Å²	102.5	56%	0.564	51%	0.506	S	S	*	.	I	π-helix	trans	-64.2	-46.6	177.6	-65.1	168.6	0	0	0	110.5	V59	V59-I63 HydrophobicContact CG1-CD1 3.69Å; V59-I63 HydrophobicContact CG1-CG1 4.44Å; V59-I63 VanDerWaalsContact O-CG1 3.28Å; V59-I63 WeakPolarHBondContact O-CG1 3.24Å; V59-I63 PolarHBondContact O-N 3.44Å
64	K	82.7	Confident	83.4	Confident	154 Å²	154	102.6 Å²	102.6	67%	0.67	51%	0.505	S	S	*	.	I	π-helix	trans	-77.6	-35.6	-176.2	-69.9	-166.6	179.9	88.9	0	114.2	C60 C61 P68	C60-K64 WeakPolarHBondContact O-CB 3.33Å; C60-K64 WeakPolarHBondContact O-CG 3.47Å; C60-K64 PolarHBondContact O-N 2.74Å; C61-K64 PolarHBondContact O-N 2.84Å; K64-P68 WeakPolarHBondContact O-CD 3.31Å; K64-P68 WeakPolarHBondContact O-CG 2.93Å
65	L	68.7	Low	82.8	Confident	101 Å²	101	105.8 Å²	105.8	53%	0.529	52%	0.516	S	S	.	.	I	π-helix	trans	-103.2	-31.2	-170	-59.9	168.5	0	0	0	113.7	C61 P68 R69	C61-L65 HydrophobicContact CB-CD1 4.04Å; C61-L65 WeakPolarHBondContact O-CA 3.18Å; C61-L65 WeakPolarHBondContact O-CB 3.4Å; C61-L65 WeakPolarHBondContact O-CG 2.95Å; C61-L65 PolarHBondContact O-N 3.25Å; L65-P68 VanDerWaalsContact C-CD 3.49Å; L65-P68 WeakPolarHBondContact O-CD 3.4Å; L65-P68 WeakPolarHBondContact O-CG 3.23Å; L65-R69 VanDerWaalsContact O-CB 3.31Å; L65-R69 WeakPolarHBondContact O-CB 3.08Å; L65-R69 WeakPolarHBondContact O-CG 3.32Å; L65-R69 PolarHBondContact O-N 3.47Å
66	R	75.3	Confident	82.4	Confident	163 Å²	163	105.4 Å²	105.4	62%	0.615	52%	0.516	S	S	*	.	I	π-helix	trans	-66.3	-45.5	-174.7	-163.8	-178.9	-156.1	164.3	4.7	111.6	F62 T70	F62-R66 WeakPolarHBondContact O-CB 3.11Å; F62-R66 PolarHBondContact O-N 3.14Å; R66-T70 PolarHBondContact O-N 3.47Å; R66-T70 PolarHBondContact O-OG1 3.02Å; R66-T70 VanDerWaalsContact O-OG1 3.1Å
67	I	75.4	Confident	82	Confident	115 Å²	115	105.1 Å²	105.1	59%	0.59	51%	0.511	S	S	*	.	H	α-helix	trans	-65.7	-47	-179.5	-60.9	160.8	0	0	0	111.9	K71	I67-K71 VanDerWaalsContact O-CG 3.23Å; I67-K71 WeakPolarHBondContact O-CG 3.19Å; I67-K71 PolarHBondContact O-N 3.07Å
68	P	69	Low	81.6	Confident	57 Å²	57	103.3 Å²	103.3	37%	0.37	50%	0.504	S	S	.	.	H	α-helix	trans	-77.2	-34.6	-177.9	27.9	-36.2	0	0	0	115	K64 L65 R72	K64-P68 WeakPolarHBondContact O-CD 3.31Å; K64-P68 WeakPolarHBondContact O-CG 2.93Å; L65-P68 VanDerWaalsContact C-CD 3.49Å; L65-P68 WeakPolarHBondContact O-CD 3.4Å; L65-P68 WeakPolarHBondContact O-CG 3.23Å; P68-R72 PolarHBondContact O-N 3.04Å
69	R	74.6	Confident	81.4	Confident	155 Å²	155	104.4 Å²	104.4	59%	0.585	51%	0.514	S	S	*	.	H	α-helix	trans	-65.4	-46.4	-179.2	-77.8	-85.2	-100.8	138.2	-7	111	L65 K71 R72 E73	L65-R69 VanDerWaalsContact O-CB 3.31Å; L65-R69 WeakPolarHBondContact O-CB 3.08Å; L65-R69 WeakPolarHBondContact O-CG 3.32Å; L65-R69 PolarHBondContact O-N 3.47Å; R69-K71 PolarHBondContact O-N 3.33Å; R69-R72 PolarHBondContact O-N 3.46Å; R69-E73 IonicContact CZ-OE1 3.77Å; R69-E73 IonicContact NH1-OE1 2.83Å; R69-E73 PolarHBondContact NH1-OE1 3.31Å; R69-E73 WeakPolarHBondContact O-CB 3.48Å; R69-E73 WeakPolarHBondContact O-CG 3.34Å; R69-E73 PolarHBondContact O-N 3.15Å
70	T	78.9	Confident	81.3	Confident	74 Å²	74	107.4 Å²	107.4	45%	0.454	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-40.9	-179.5	-53.4	0	0	0	0	111.7	R66 I74	R66-T70 PolarHBondContact O-N 3.47Å; R66-T70 PolarHBondContact O-OG1 3.02Å; R66-T70 VanDerWaalsContact O-OG1 3.1Å; T70-I74 HydrophobicContact CG2-CD1 4Å; T70-I74 WeakPolarHBondContact O-CD1 3.41Å; T70-I74 WeakPolarHBondContact O-CG1 3.48Å; T70-I74 PolarHBondContact O-N 3.1Å; T70-I74 VanDerWaalsContact O-N 3.15Å
71	K	75.4	Confident	81.2	Confident	139 Å²	139	112.4 Å²	112.4	60%	0.604	53%	0.528	S	S	*	.	H	α-helix	trans	-59.9	-49.6	174.2	-71.4	-95.1	-173.1	173.6	0	111.6	I67 R69 I74 E75	I67-K71 VanDerWaalsContact O-CG 3.23Å; I67-K71 WeakPolarHBondContact O-CG 3.19Å; I67-K71 PolarHBondContact O-N 3.07Å; R69-K71 PolarHBondContact O-N 3.33Å; K71-I74 PolarHBondContact O-N 2.91Å; K71-E75 WeakPolarHBondContact O-CG 3.3Å; K71-E75 PolarHBondContact O-N 3.3Å
72	R	79.5	Confident	81.2	Confident	189 Å²	189	116.6 Å²	116.6	71%	0.713	54%	0.54	S	S	*	.	H	α-helix	trans	-65.6	-40.4	-179.5	-77	-169.4	179.3	-138.6	1.9	113.5	P68 R69 I74 E75 L76	P68-R72 PolarHBondContact O-N 3.04Å; R69-R72 PolarHBondContact O-N 3.46Å; R72-I74 VanDerWaalsContact C-N 3.29Å; R72-I74 PolarHBondContact O-N 2.84Å; R72-E75 PolarHBondContact O-N 2.99Å; R72-L76 WeakPolarHBondContact O-CB 3.47Å; R72-L76 PolarHBondContact O-N 3.46Å
73	E	80.5	Confident	81.5	Confident	97 Å²	97	116.2 Å²	116.2	45%	0.453	54%	0.543	S	S	.	.	H	α-helix	trans	-63.9	-37.5	177.5	-75.2	-178.6	-178.6	0	0	111.5	R69 N77	R69-E73 IonicContact CZ-OE1 3.77Å; R69-E73 IonicContact NH1-OE1 2.83Å; R69-E73 PolarHBondContact NH1-OE1 3.31Å; R69-E73 WeakPolarHBondContact O-CB 3.48Å; R69-E73 WeakPolarHBondContact O-CG 3.34Å; R69-E73 PolarHBondContact O-N 3.15Å; E73-N77 WeakPolarHBondContact O-CB 3.5Å; E73-N77 PolarHBondContact O-N 2.83Å; E73-N77 PolarHBondContact O-ND2 3.42Å
74	I	85.1	Confident	81.9	Confident	113 Å²	113	118.1 Å²	118.1	58%	0.579	54%	0.543	S	S	*	.	H	α-helix	trans	-65.6	-46.6	173.7	-66.7	165.1	0	0	0	110.8	T70 K71 R72 N77 A78	T70-I74 HydrophobicContact CG2-CD1 4Å; T70-I74 WeakPolarHBondContact O-CD1 3.41Å; T70-I74 WeakPolarHBondContact O-CG1 3.48Å; T70-I74 PolarHBondContact O-N 3.1Å; T70-I74 VanDerWaalsContact O-N 3.15Å; K71-I74 PolarHBondContact O-N 2.91Å; R72-I74 VanDerWaalsContact C-N 3.29Å; R72-I74 PolarHBondContact O-N 2.84Å; I74-N77 PolarHBondContact O-N 3.42Å; I74-A78 VanDerWaalsContact O-CB 3.3Å; I74-A78 WeakPolarHBondContact O-CB 3.39Å; I74-A78 PolarHBondContact O-N 3.05Å
75	E	85	Confident	82.1	Confident	128 Å²	128	119.3 Å²	119.3	60%	0.598	54%	0.543	S	S	*	.	H	α-helix	trans	-60.4	-46.8	178.5	-75.3	179.9	178.5	0	0	112.3	K71 R72 A78 V79	K71-E75 WeakPolarHBondContact O-CG 3.3Å; K71-E75 PolarHBondContact O-N 3.3Å; R72-E75 PolarHBondContact O-N 2.99Å; E75-A78 WeakPolarHBondContact O-CB 3.38Å; E75-A78 PolarHBondContact O-N 2.92Å; E75-V79 WeakPolarHBondContact O-CG2 3.37Å; E75-V79 PolarHBondContact O-N 3.2Å
76	L	86.4	Confident	83.1	Confident	92 Å²	92	123.3 Å²	123.3	48%	0.482	55%	0.551	S	S	.	*	H	α-helix	trans	-68.1	-39.3	-179.1	-160.2	152.2	0	0	0	111.3	R72 A78 V79 R80	R72-L76 WeakPolarHBondContact O-CB 3.47Å; R72-L76 PolarHBondContact O-N 3.46Å; L76-A78 VanDerWaalsContact C-N 3.34Å; L76-V79 PolarHBondContact O-N 2.92Å; L76-R80 HydrophobicContact CD2-CG 4.08Å; L76-R80 WeakPolarHBondContact O-CB 3.47Å; L76-R80 WeakPolarHBondContact O-CG 3.19Å; L76-R80 PolarHBondContact O-N 2.88Å
77	N	86.5	Confident	83.7	Confident	79 Å²	79	122 Å²	122	42%	0.422	55%	0.55	S	S	.	.	H	α-helix	trans	-65.5	-36.2	172.8	-76.8	-31.5	0	0	0	112.2	E73 I74 R81	E73-N77 WeakPolarHBondContact O-CB 3.5Å; E73-N77 PolarHBondContact O-N 2.83Å; E73-N77 PolarHBondContact O-ND2 3.42Å; I74-N77 PolarHBondContact O-N 3.42Å; N77-R81 WeakPolarHBondContact O-CB 3.49Å; N77-R81 VanDerWaalsContact O-CG 3.24Å; N77-R81 WeakPolarHBondContact O-CG 3.43Å; N77-R81 PolarHBondContact O-N 2.91Å
78	A	85.3	Confident	84.3	Confident	40 Å²	40	122 Å²	122	33%	0.331	55%	0.55	S	S	.	.	H	α-helix	trans	-66.3	-43.9	175.1	0	0	0	0	0	111.6	I74 E75 L76 R81 K82	I74-A78 VanDerWaalsContact O-CB 3.3Å; I74-A78 WeakPolarHBondContact O-CB 3.39Å; I74-A78 PolarHBondContact O-N 3.05Å; E75-A78 WeakPolarHBondContact O-CB 3.38Å; E75-A78 PolarHBondContact O-N 2.92Å; L76-A78 VanDerWaalsContact C-N 3.34Å; A78-R81 WeakPolarHBondContact O-CB 3.39Å; A78-R81 PolarHBondContact O-N 3.29Å; A78-K82 WeakPolarHBondContact O-CG 3.39Å; A78-K82 PolarHBondContact O-N 2.92Å
79	V	89	Confident	85.2	Confident	93 Å²	93	124.2 Å²	124.2	56%	0.564	56%	0.558	S	S	*	*	H	α-helix	trans	-63.5	-45.4	175.2	174.8	0	0	0	0	111	E75 L76 R81 K82 L83	E75-V79 WeakPolarHBondContact O-CG2 3.37Å; E75-V79 PolarHBondContact O-N 3.2Å; L76-V79 PolarHBondContact O-N 2.92Å; V79-R81 VanDerWaalsContact C-N 3.3Å; V79-R81 PolarHBondContact O-N 3.37Å; V79-K82 WeakPolarHBondContact O-CB 3.34Å; V79-K82 PolarHBondContact O-N 3.46Å; V79-K82 VanDerWaalsContact O-N 3.09Å; V79-L83 PolarHBondContact O-N 2.91Å
80	R	88.3	Confident	85.8	Confident	142 Å²	142	121.7 Å²	121.7	54%	0.536	56%	0.557	S	S	.	*	H	α-helix	trans	-58.1	-41.8	174.6	-76.7	179.8	175.3	172.1	1.4	111.9	L76 L83 R84	L76-R80 HydrophobicContact CD2-CG 4.08Å; L76-R80 WeakPolarHBondContact O-CB 3.47Å; L76-R80 WeakPolarHBondContact O-CG 3.19Å; L76-R80 PolarHBondContact O-N 2.88Å; R80-L83 PolarHBondContact O-N 3.09Å; R80-R84 WeakPolarHBondContact O-CG 3.24Å; R80-R84 PolarHBondContact O-N 3.23Å
81	R	87.4	Confident	86.3	Confident	160 Å²	160	122.5 Å²	122.5	60%	0.604	56%	0.561	S	S	*	*	H	α-helix	trans	-62.2	-42.3	174.3	-77.2	174	176.3	-120.6	-0.5	111.6	N77 A78 V79 R85	N77-R81 WeakPolarHBondContact O-CB 3.49Å; N77-R81 VanDerWaalsContact O-CG 3.24Å; N77-R81 WeakPolarHBondContact O-CG 3.43Å; N77-R81 PolarHBondContact O-N 2.91Å; A78-R81 WeakPolarHBondContact O-CB 3.39Å; A78-R81 PolarHBondContact O-N 3.29Å; V79-R81 VanDerWaalsContact C-N 3.3Å; V79-R81 PolarHBondContact O-N 3.37Å; R81-R85 WeakPolarHBondContact O-CG 3.5Å; R81-R85 PolarHBondContact O-N 3.02Å
82	K	88.1	Confident	87	Confident	142 Å²	142	122.7 Å²	122.7	62%	0.617	56%	0.562	S	S	*	*	H	α-helix	trans	-63.5	-45.8	176.7	-72.2	175.9	-178.4	-178.6	0	111.8	A78 V79 R85 R86	A78-K82 WeakPolarHBondContact O-CG 3.39Å; A78-K82 PolarHBondContact O-N 2.92Å; V79-K82 WeakPolarHBondContact O-CB 3.34Å; V79-K82 PolarHBondContact O-N 3.46Å; V79-K82 VanDerWaalsContact O-N 3.09Å; K82-R85 PolarHBondContact O-N 3.49Å; K82-R86 PolarHBondContact O-N 3.2Å
83	L	88.9	Confident	87.4	Confident	98 Å²	98	119.4 Å²	119.4	51%	0.513	56%	0.555	S	S	.	*	H	α-helix	trans	-65.6	-43.5	-179.6	-176	62.1	0	0	0	112.3	V79 R80 R85 R86 K87	V79-L83 PolarHBondContact O-N 2.91Å; R80-L83 PolarHBondContact O-N 3.09Å; L83-R85 VanDerWaalsContact C-N 3.27Å; L83-R85 PolarHBondContact O-N 3.13Å; L83-R86 PolarHBondContact O-N 3.17Å; L83-R86 VanDerWaalsContact O-N 3.15Å; L83-K87 PolarHBondContact O-N 3.33Å
84	R	89.2	Confident	87.7	Confident	150 Å²	150	117.6 Å²	117.6	57%	0.566	56%	0.557	S	S	*	*	H	α-helix	trans	-58.3	-40.3	176	-77.5	-162.8	-67.8	-105.2	6	112	R80 L88	R80-R84 WeakPolarHBondContact O-CG 3.24Å; R80-R84 PolarHBondContact O-N 3.23Å; R84-L88 WeakPolarHBondContact O-CD1 3.37Å; R84-L88 WeakPolarHBondContact O-CG 3.45Å; R84-L88 PolarHBondContact O-N 3.07Å; R84-L88 VanDerWaalsContact O-N 3.13Å
85	R	88.2	Confident	87.8	Confident	179 Å²	179	119.1 Å²	119.1	68%	0.675	56%	0.561	S	S	*	*	H	α-helix	trans	-63	-41.6	176.4	-72.5	-178.6	-172.3	-97.9	4.8	112.1	R81 K82 L83 L88 L89	R81-R85 WeakPolarHBondContact O-CG 3.5Å; R81-R85 PolarHBondContact O-N 3.02Å; K82-R85 PolarHBondContact O-N 3.49Å; L83-R85 VanDerWaalsContact C-N 3.27Å; L83-R85 PolarHBondContact O-N 3.13Å; R85-L88 PolarHBondContact O-N 2.94Å; R85-L89 WeakPolarHBondContact O-CG 3.47Å; R85-L89 PolarHBondContact O-N 3.42Å; R85-L89 VanDerWaalsContact O-N 3.17Å
86	R	88.8	Confident	88	Confident	184 Å²	184	119.8 Å²	119.8	69%	0.694	56%	0.564	S	S	*	*	H	α-helix	trans	-66.3	-44.9	178.8	-66.5	-175.8	-174	-80	2.5	112.8	K82 L83 L88 L89 D90	K82-R86 PolarHBondContact O-N 3.2Å; L83-R86 PolarHBondContact O-N 3.17Å; L83-R86 VanDerWaalsContact O-N 3.15Å; R86-L88 VanDerWaalsContact C-N 3.32Å; R86-L88 PolarHBondContact O-N 3.15Å; R86-L89 WeakPolarHBondContact O-CB 3.38Å; R86-L89 PolarHBondContact O-N 3.09Å; R86-L89 VanDerWaalsContact O-N 3.09Å; R86-D90 PolarHBondContact O-N 3.35Å
87	K	88.6	Confident	88	Confident	137 Å²	137	121.9 Å²	121.9	60%	0.596	58%	0.575	S	S	*	*	H	α-helix	trans	-61.9	-39.8	177.3	-68.9	-165.4	176.1	-161.9	0	112.5	L83 L89 D90 T91	L83-K87 PolarHBondContact O-N 3.33Å; K87-L89 VanDerWaalsContact C-N 3.27Å; K87-L89 PolarHBondContact O-N 3.24Å; K87-D90 PolarHBondContact O-N 3.43Å; K87-T91 WeakPolarHBondContact O-CB 3.46Å; K87-T91 PolarHBondContact O-N 2.99Å; K87-T91 PolarHBondContact O-OG1 2.91Å
88	L	87.2	Confident	87.8	Confident	113 Å²	113	122.9 Å²	122.9	59%	0.592	59%	0.587	S	S	*	*	H	α-helix	trans	-63.7	-32.8	174.7	-77.1	163.8	0	0	0	112.5	R84 R85 R86 K92	R84-L88 WeakPolarHBondContact O-CD1 3.37Å; R84-L88 WeakPolarHBondContact O-CG 3.45Å; R84-L88 PolarHBondContact O-N 3.07Å; R84-L88 VanDerWaalsContact O-N 3.13Å; R85-L88 PolarHBondContact O-N 2.94Å; R86-L88 VanDerWaalsContact C-N 3.32Å; R86-L88 PolarHBondContact O-N 3.15Å; L88-K92 WeakPolarHBondContact O-CB 3.38Å; L88-K92 WeakPolarHBondContact O-CG 3.42Å; L88-K92 PolarHBondContact O-N 3.43Å
89	L	88.5	Confident	88	Confident	104 Å²	104	129.5 Å²	129.5	55%	0.545	61%	0.609	S	S	.	*	H	α-helix	trans	-72.7	-48.2	175	-68.4	172.2	0	0	0	111	R85 R86 K87 T91 K92 E93	R85-L89 WeakPolarHBondContact O-CG 3.47Å; R85-L89 PolarHBondContact O-N 3.42Å; R85-L89 VanDerWaalsContact O-N 3.17Å; R86-L89 WeakPolarHBondContact O-CB 3.38Å; R86-L89 PolarHBondContact O-N 3.09Å; R86-L89 VanDerWaalsContact O-N 3.09Å; K87-L89 VanDerWaalsContact C-N 3.27Å; K87-L89 PolarHBondContact O-N 3.24Å; L89-T91 PolarHBondContact O-N 2.78Å; L89-K92 CarbonylContact O-C 3.54Å; L89-K92 WeakPolarHBondContact O-CA 3.21Å; L89-K92 WeakPolarHBondContact O-CB 3.4Å; L89-K92 PolarHBondContact O-N 2.89Å; L89-E93 WeakPolarHBondContact O-CG 3.45Å; L89-E93 PolarHBondContact O-N 3.18Å
90	D	87.9	Confident	87.9	Confident	103 Å²	103	130.3 Å²	130.3	55%	0.551	62%	0.618	S	S	*	*	H	α-helix	trans	-60.7	-42.3	178.5	178.3	-95.5	0	0	0	112.5	R86 K87 K92 E93 A94	R86-D90 PolarHBondContact O-N 3.35Å; K87-D90 PolarHBondContact O-N 3.43Å; D90-K92 VanDerWaalsContact C-N 3.31Å; D90-K92 PolarHBondContact O-N 3.4Å; D90-E93 PolarHBondContact O-N 2.81Å; D90-A94 WeakPolarHBondContact O-CB 3.34Å; D90-A94 PolarHBondContact O-N 3.41Å
91	T	89.4	Confident	87.4	Confident	90 Å²	90	133.3 Å²	133.3	55%	0.552	65%	0.645	S	S	*	*	H	α-helix	trans	-63.4	-37.1	173.2	-58.4	0	0	0	0	111.9	K87 L89 H95	K87-T91 WeakPolarHBondContact O-CB 3.46Å; K87-T91 PolarHBondContact O-N 2.99Å; K87-T91 PolarHBondContact O-OG1 2.91Å; L89-T91 PolarHBondContact O-N 2.78Å; T91-H95 WeakPolarHBondContact O-CB 3.43Å; T91-H95 PolarHBondContact O-N 2.79Å
92	K	89.2	Confident	87.4	Confident	143 Å²	143	132 Å²	132	62%	0.622	65%	0.647	S	S	*	*	H	α-helix	trans	-66	-41.2	173.6	-78.5	178.2	176.8	-163.8	0	111.3	L88 L89 D90 Q96	L88-K92 WeakPolarHBondContact O-CB 3.38Å; L88-K92 WeakPolarHBondContact O-CG 3.42Å; L88-K92 PolarHBondContact O-N 3.43Å; L89-K92 CarbonylContact O-C 3.54Å; L89-K92 WeakPolarHBondContact O-CA 3.21Å; L89-K92 WeakPolarHBondContact O-CB 3.4Å; L89-K92 PolarHBondContact O-N 2.89Å; D90-K92 VanDerWaalsContact C-N 3.31Å; D90-K92 PolarHBondContact O-N 3.4Å; K92-Q96 VanDerWaalsContact O-CB 3.26Å; K92-Q96 WeakPolarHBondContact O-CB 3.17Å; K92-Q96 PolarHBondContact O-N 3.02Å
93	E	88.2	Confident	87.3	Confident	121 Å²	121	131.4 Å²	131.4	57%	0.565	65%	0.648	S	S	*	*	H	α-helix	trans	-64.9	-48.8	177.2	-70.8	177.8	143.4	0	0	111.1	L89 D90 H95 Q96 L97	L89-E93 WeakPolarHBondContact O-CG 3.45Å; L89-E93 PolarHBondContact O-N 3.18Å; D90-E93 PolarHBondContact O-N 2.81Å; E93-H95 PolarHBondContact O-N 3.07Å; E93-Q96 CarbonylContact O-C 3.59Å; E93-Q96 WeakPolarHBondContact O-CA 3.43Å; E93-Q96 WeakPolarHBondContact O-CB 3.48Å; E93-Q96 PolarHBondContact O-N 3.44Å; E93-L97 WeakPolarHBondContact O-CB 3.26Å; E93-L97 PolarHBondContact O-N 2.96Å
94	A	87.2	Confident	87.3	Confident	59 Å²	59	133.3 Å²	133.3	49%	0.488	66%	0.656	S	S	.	*	H	α-helix	trans	-61.4	-42.5	176.8	0	0	0	0	0	112.2	D90 Q96 L97 C98	D90-A94 WeakPolarHBondContact O-CB 3.34Å; D90-A94 PolarHBondContact O-N 3.41Å; A94-Q96 VanDerWaalsContact C-N 3.28Å; A94-Q96 PolarHBondContact O-N 3.14Å; A94-L97 PolarHBondContact O-N 3.29Å; A94-C98 PolarHBondContact O-N 3.44Å
95	H	87.3	Confident	87.1	Confident	144 Å²	144	132.3 Å²	132.3	67%	0.667	66%	0.661	S	S	*	*	H	α-helix	trans	-66	-31.3	174.5	-168.6	-75.8	0	0	0	112	T91 E93	T91-H95 WeakPolarHBondContact O-CB 3.43Å; T91-H95 PolarHBondContact O-N 2.79Å; E93-H95 PolarHBondContact O-N 3.07Å
96	Q	89	Confident	87.1	Confident	143 Å²	143	129.4 Å²	129.4	67%	0.668	66%	0.66	S	S	*	*	H	α-helix	trans	-74.4	-36.3	174.1	-173	174.2	-8.1	0	0	112	K92 E93 A94 K99 S100	K92-Q96 VanDerWaalsContact O-CB 3.26Å; K92-Q96 WeakPolarHBondContact O-CB 3.17Å; K92-Q96 PolarHBondContact O-N 3.02Å; E93-Q96 CarbonylContact O-C 3.59Å; E93-Q96 WeakPolarHBondContact O-CA 3.43Å; E93-Q96 WeakPolarHBondContact O-CB 3.48Å; E93-Q96 PolarHBondContact O-N 3.44Å; A94-Q96 VanDerWaalsContact C-N 3.28Å; A94-Q96 PolarHBondContact O-N 3.14Å; Q96-K99 PolarHBondContact O-N 3.33Å; Q96-S100 PolarHBondContact O-N 3.42Å
97	L	86.9	Confident	87	Confident	135 Å²	135	125.7 Å²	125.7	71%	0.707	66%	0.658	S	S	*	*	H	α-helix	trans	-68.7	-42.4	-179.7	-142.7	134.8	0	0	0	111.5	E93 A94 K99 S100	E93-L97 WeakPolarHBondContact O-CB 3.26Å; E93-L97 PolarHBondContact O-N 2.96Å; A94-L97 PolarHBondContact O-N 3.29Å; L97-K99 PolarHBondContact O-N 3.04Å; L97-S100 PolarHBondContact O-N 3.3Å; L97-S100 VanDerWaalsContact O-N 3.14Å
98	C	82.3	Confident	86.8	Confident	100 Å²	100	124.9 Å²	124.9	68%	0.676	66%	0.662	S	S	*	*	H	α-helix	trans	-63.7	-28	174.1	-173.5	0	0	0	0	112.9	A94 S100	A94-C98 PolarHBondContact O-N 3.44Å; C98-S100 VanDerWaalsContact C-N 3.3Å
99	K	89.1	Confident	86.8	Confident	180 Å²	180	125.8 Å²	125.8	78%	0.783	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-16.6	176.9	-163.9	176.1	-178.5	-179.1	0	113.2	Q96 L97	Q96-K99 PolarHBondContact O-N 3.33Å; L97-K99 PolarHBondContact O-N 3.04Å
100	S	85.5	Confident	86.7	Confident	110 Å²	110	127.7 Å²	127.7	77%	0.769	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95	-5	-174	-167	0	0	0	0	114.3	Q96 L97 C98	Q96-S100 PolarHBondContact O-N 3.42Å; L97-S100 PolarHBondContact O-N 3.3Å; L97-S100 VanDerWaalsContact O-N 3.14Å; C98-S100 VanDerWaalsContact C-N 3.3Å
101	N	78.1	Confident	86.6	Confident	204 Å²	204	129.9 Å²	129.9	100%	1.091	69%	0.69	S	S	*	*			trans	-122.9	0	177.4	180	88.6	0	0	0	110.3

Retrieved 101 of 101 residues in 236.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).