A0A077ZHX5_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZHX5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 90 aa.

						>A0A077ZHX5_TRITR|A0A077ZHX5
MRLFGWLLRSRTFATGNGSRVHSHFEKRQIRFSAHSDKRYAHSRFGRLQGQTGTLHVRHKVVEAAKPHHYGQLVQRIHRLGLRIQKALNM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.8	Very low	55.7	Low	213 Å²	213	125.5 Å²	125.5	100%	1.049	58%	0.581	S	S	*	*				0	128.4	0	-71.8	177.7	165.3	0	0	108.5
2	R	47.6	Very low	56.2	Low	213 Å²	213	123.6 Å²	123.6	80%	0.804	58%	0.584	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.4	119.4	176.2	-73	177.2	159.3	128.4	-2.8	108	F4	R2-F4 HydrophobicContact CB-CE2 4.08Å
3	L	46.8	Very low	56.7	Low	116 Å²	116	121.9 Å²	121.9	61%	0.607	57%	0.574	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.2	131.7	170.6	-116.4	82.1	0	0	0	108.7	F32	L3-F32 HydrophobicContact CB-CB 3.87Å; L3-F32 PolarHBondContact N-O 3.48Å; L3-F32 WeakPolarHBondContact O-CA 3.29Å; L3-F32 VanDerWaalsContact O-CB 3.29Å; L3-F32 WeakPolarHBondContact O-CB 3.31Å; L3-F32 PolarHBondContact O-N 2.87Å
4	F	55.9	Low	57	Low	133 Å²	133	119.7 Å²	119.7	58%	0.583	59%	0.587	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-109.7	134.8	168.1	-64.3	-85.4	0	0	0	107.7	R2 R31	R2-F4 HydrophobicContact CB-CE2 4.08Å; F4-R31 HydrophobicContact CD1-CG 4.35Å; F4-R31 HydrophobicContact CE1-CG 4.14Å
5	G	60.6	Low	57	Low	23 Å²	23	116.7 Å²	116.7	24%	0.237	58%	0.578	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-138.3	143.2	173.5	0	0	0	0	0	110.6	I30	G5-I30 PolarHBondContact N-O 2.86Å; G5-I30 PolarHBondContact O-N 3.33Å
6	W	60	Low	57.2	Low	169 Å²	169	114.7 Å²	114.7	64%	0.64	60%	0.596	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.4	122.2	171.1	-67.7	95.8	0	0	0	108.3	L8 K27 Q29	W6-L8 HydrophobicContact CB-CD1 4.08Å; W6-K27 HydrophobicContact CE3-CB 4.36Å; W6-K27 HydrophobicContact CZ3-CB 4.32Å; W6-Q29 HydrophobicContact CE3-CB 4.27Å; W6-Q29 HydrophobicContact CH2-CB 4.2Å; W6-Q29 HydrophobicContact CH2-CG 4.4Å; W6-Q29 HydrophobicContact CZ3-CB 3.91Å; W6-Q29 HydrophobicContact CZ3-CG 4.5Å
7	L	60.1	Low	57.4	Low	102 Å²	102	116.8 Å²	116.8	53%	0.534	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.9	108.3	166.5	-170.7	74.8	0	0	0	107.4	R9 R28 I30	L7-R9 PolarHBondContact O-N 2.81Å; L7-R28 PolarHBondContact N-O 3.25Å; L7-R28 VanDerWaalsContact N-O 3.17Å; L7-R28 PolarHBondContact O-N 3.2Å; L7-I30 HydrophobicContact CB-CD1 3.38Å; L7-I30 HydrophobicContact CB-CG1 3.93Å; L7-I30 HydrophobicContact CD2-CD1 3.75Å; L7-I30 HydrophobicContact CG-CD1 4.09Å
8	L	59	Low	57.5	Low	97 Å²	97	114.7 Å²	114.7	51%	0.508	62%	0.62	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.8	109.2	168.7	-93.1	56.7	0	0	0	107.7	W6 F25	W6-L8 HydrophobicContact CB-CD1 4.08Å; L8-F25 HydrophobicContact CB-CZ 4.16Å; L8-F25 HydrophobicContact CD1-CE1 4.35Å; L8-F25 HydrophobicContact CD2-CE1 3.8Å; L8-F25 HydrophobicContact CD2-CE2 4.14Å; L8-F25 HydrophobicContact CD2-CZ 3.21Å; L8-F25 HydrophobicContact CG-CE1 3.55Å; L8-F25 HydrophobicContact CG-CE2 4.25Å; L8-F25 HydrophobicContact CG-CZ 3.36Å
9	R	59.6	Low	57.6	Low	134 Å²	134	114.7 Å²	114.7	51%	0.506	63%	0.63	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.7	104	167.9	-170	178.7	-169.1	169.7	5.7	108	L7 R11 E26	L7-R9 PolarHBondContact O-N 2.81Å; R9-R11 HydrophobicContact CG-CG 4.44Å; R9-R11 VanDerWaalsContact NH2-NH2 3.15Å; R9-E26 PolarHBondContact N-O 2.99Å; R9-E26 PolarHBondContact O-N 2.81Å
10	S	60.9	Low	57.3	Low	73 Å²	73	118 Å²	118	51%	0.51	63%	0.632	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84	121.7	167.8	-55.9	0	0	0	0	108.5	F25	S10-F25 WeakPolarHBondContact OG-CE2 3.22Å
11	R	60.1	Low	57.4	Low	108 Å²	108	117.4 Å²	117.4	41%	0.408	63%	0.633	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.4	112	166.4	-74.9	-174.4	165.6	-175.5	-6.9	108.3	R9 F13 H24	R9-R11 HydrophobicContact CG-CG 4.44Å; R9-R11 VanDerWaalsContact NH2-NH2 3.15Å; R11-F13 HydrophobicContact CB-CD2 4.22Å; R11-F13 HydrophobicContact CB-CE2 3.54Å; R11-F13 HydrophobicContact CB-CZ 3.91Å; R11-F13 HydrophobicContact CG-CE2 4.48Å; R11-F13 HydrophobicContact CG-CZ 4.43Å; R11-H24 PolarHBondContact N-O 3.39Å; R11-H24 PolarHBondContact O-N 3.12Å
12	T	62.3	Low	58.2	Low	102 Å²	102	112.8 Å²	112.8	63%	0.626	61%	0.608	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.2	119.7	167.6	30.2	0	0	0	0	108.6	V21	T12-V21 HydrophobicContact CG2-CG1 3.97Å
13	F	62.6	Low	58.7	Low	102 Å²	102	106 Å²	106	45%	0.447	59%	0.594	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.5	123.5	171.6	-62.3	-85.5	0	0	0	108.5	R11 H22 H24	R11-F13 HydrophobicContact CB-CD2 4.22Å; R11-F13 HydrophobicContact CB-CE2 3.54Å; R11-F13 HydrophobicContact CB-CZ 3.91Å; R11-F13 HydrophobicContact CG-CE2 4.48Å; R11-F13 HydrophobicContact CG-CZ 4.43Å; F13-H22 PolarHBondContact N-O 2.96Å; F13-H22 PolarHBondContact O-N 3.28Å; F13-H24 HydrophobicContact CE2-CB 4.19Å
14	A	60.4	Low	59.4	Low	91 Å²	91	104.9 Å²	104.9	75%	0.752	59%	0.585	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-82.3	116	164.5	0	0	0	0	0	107.5
15	T	57.3	Low	59.7	Low	74 Å²	74	103 Å²	103	45%	0.454	58%	0.577	S	S	.	*			trans	-74.5	135.2	167.3	44.2	0	0	0	0	108.6	N17 G18 R20	T15-N17 PolarHBondContact O-N 2.72Å; T15-G18 PolarHBondContact O-N 2.83Å; T15-R20 PolarHBondContact N-O 3.24Å; T15-R20 PolarHBondContact OG1-O 3.24Å
16	G	60.4	Low	59.5	Low	85 Å²	85	105.3 Å²	105.3	88%	0.876	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.4	4.7	-173	0	0	0	0	0	116.7
17	N	60.2	Low	59.6	Low	150 Å²	150	104.3 Å²	104.3	80%	0.802	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.8	20	177.5	-82.6	7.2	0	0	0	113.7	T15 S19	T15-N17 PolarHBondContact O-N 2.72Å; N17-S19 PolarHBondContact O-N 2.76Å; N17-S19 PolarHBondContact O-OG 3.25Å
18	G	59.6	Low	59.7	Low	80 Å²	80	108.1 Å²	108.1	83%	0.825	59%	0.589	S	S	*	*	S	Bend	trans	67.5	-0.8	165.8	0	0	0	0	0	117.5	T15	T15-G18 PolarHBondContact O-N 2.83Å
19	S	59.1	Low	59.9	Low	114 Å²	114	109 Å²	109	80%	0.797	59%	0.591	S	S	*	*	S	Bend	trans	-129.6	0.3	-170.2	-50.8	0	0	0	0	116.1	N17	N17-S19 PolarHBondContact O-N 2.76Å; N17-S19 PolarHBondContact O-OG 3.25Å
20	R	51.4	Low	60.1	Low	181 Å²	181	105.4 Å²	105.4	68%	0.683	58%	0.581	S	S	*	*			trans	-145.1	107.5	-178.1	-141.3	170.7	-177.3	179.5	0.9	113	T15	T15-R20 PolarHBondContact N-O 3.24Å; T15-R20 PolarHBondContact OG1-O 3.24Å
21	V	59.4	Low	60	Low	106 Å²	106	111.1 Å²	111.1	64%	0.642	59%	0.591	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.4	116.7	167.2	-178.9	0	0	0	0	107.6	T12	T12-V21 HydrophobicContact CG2-CG1 3.97Å
22	H	58.8	Low	59.7	Low	115 Å²	115	111.1 Å²	111.1	53%	0.532	59%	0.594	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.6	120.7	172.7	-131.6	99.6	0	0	0	108.4	F13	F13-H22 PolarHBondContact N-O 2.96Å; F13-H22 PolarHBondContact O-N 3.28Å
23	S	59.2	Low	59.1	Low	72 Å²	72	111 Å²	111	50%	0.503	60%	0.598	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.4	107.9	172.9	-167.9	0	0	0	0	108.2
24	H	61.4	Low	58.4	Low	92 Å²	92	110 Å²	110	43%	0.426	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.1	124.5	172.7	-173.7	-101.5	0	0	0	108.9	R11 F13 E26	R11-H24 PolarHBondContact N-O 3.39Å; R11-H24 PolarHBondContact O-N 3.12Å; F13-H24 HydrophobicContact CE2-CB 4.19Å; H24-E26 WeakPolarHBondContact CE1-CG 3.43Å; H24-E26 IonicContact CE1-OE1 3.52Å; H24-E26 WeakPolarHBondContact ND1-CG 3.19Å
25	F	61	Low	57.9	Low	94 Å²	94	112.7 Å²	112.7	41%	0.412	61%	0.605	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.9	103.5	-174.5	-154.4	-99.3	0	0	0	110.1	L8 S10 K27	L8-F25 HydrophobicContact CB-CZ 4.16Å; L8-F25 HydrophobicContact CD1-CE1 4.35Å; L8-F25 HydrophobicContact CD2-CE1 3.8Å; L8-F25 HydrophobicContact CD2-CE2 4.14Å; L8-F25 HydrophobicContact CD2-CZ 3.21Å; L8-F25 HydrophobicContact CG-CE1 3.55Å; L8-F25 HydrophobicContact CG-CE2 4.25Å; L8-F25 HydrophobicContact CG-CZ 3.36Å; S10-F25 WeakPolarHBondContact OG-CE2 3.22Å; F25-K27 HydrophobicContact CD1-CG 3.91Å; F25-K27 HydrophobicContact CE1-CG 3.94Å
26	E	56.2	Low	57.4	Low	71 Å²	71	114 Å²	114	33%	0.332	62%	0.618	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94	114.4	173.9	-66.8	-169.9	143.2	0	0	109.7	R9 H24	R9-E26 PolarHBondContact N-O 2.99Å; R9-E26 PolarHBondContact O-N 2.81Å; H24-E26 WeakPolarHBondContact CE1-CG 3.43Å; H24-E26 IonicContact CE1-OE1 3.52Å; H24-E26 WeakPolarHBondContact ND1-CG 3.19Å
27	K	63.2	Low	56.8	Low	148 Å²	148	114 Å²	114	64%	0.643	60%	0.597	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.1	107.4	166.5	-65.6	-178.9	-176.8	176.6	0	108	W6 F25	W6-K27 HydrophobicContact CE3-CB 4.36Å; W6-K27 HydrophobicContact CZ3-CB 4.32Å; F25-K27 HydrophobicContact CD1-CG 3.91Å; F25-K27 HydrophobicContact CE1-CG 3.94Å
28	R	61.8	Low	56.2	Low	181 Å²	181	116.2 Å²	116.2	68%	0.683	60%	0.6	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-109.9	124.5	168.7	-81.6	-175.4	166.4	-157.9	-2.6	109.9	L7 I30	L7-R28 PolarHBondContact N-O 3.25Å; L7-R28 VanDerWaalsContact N-O 3.17Å; L7-R28 PolarHBondContact O-N 3.2Å; R28-I30 PolarHBondContact O-N 3.1Å
29	Q	62.9	Low	55.7	Low	117 Å²	117	122.2 Å²	122.2	55%	0.547	60%	0.597	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-73.8	119.6	172.4	-168	-178.3	19.1	0	0	108.5	W6	W6-Q29 HydrophobicContact CE3-CB 4.27Å; W6-Q29 HydrophobicContact CH2-CB 4.2Å; W6-Q29 HydrophobicContact CH2-CG 4.4Å; W6-Q29 HydrophobicContact CZ3-CB 3.91Å; W6-Q29 HydrophobicContact CZ3-CG 4.5Å
30	I	64.6	Low	54.8	Low	57 Å²	57	128.6 Å²	128.6	29%	0.292	61%	0.606	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.7	125.4	174.4	-55.4	-169	0	0	0	108.5	G5 L7 R28 F32	G5-I30 PolarHBondContact N-O 2.86Å; G5-I30 PolarHBondContact O-N 3.33Å; L7-I30 HydrophobicContact CB-CD1 3.38Å; L7-I30 HydrophobicContact CB-CG1 3.93Å; L7-I30 HydrophobicContact CD2-CD1 3.75Å; L7-I30 HydrophobicContact CG-CD1 4.09Å; R28-I30 PolarHBondContact O-N 3.1Å; I30-F32 HydrophobicContact CB-CE2 4.02Å; I30-F32 HydrophobicContact CB-CZ 4.36Å; I30-F32 HydrophobicContact CG2-CD2 4.19Å; I30-F32 HydrophobicContact CG2-CE1 4.3Å; I30-F32 HydrophobicContact CG2-CE2 3.84Å; I30-F32 HydrophobicContact CG2-CZ 3.9Å
31	R	58.4	Low	54.6	Low	194 Å²	194	124 Å²	124	73%	0.732	61%	0.607	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.2	109.9	170.8	-63	-176.8	-129.2	175.2	2.2	107.6	F4 S33	F4-R31 HydrophobicContact CD1-CG 4.35Å; F4-R31 HydrophobicContact CE1-CG 4.14Å; R31-S33 PolarHBondContact O-N 2.84Å
32	F	52.7	Low	53.8	Low	107 Å²	107	128.2 Å²	128.2	47%	0.469	62%	0.619	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-86	94.1	168.7	-62.2	-91.6	0	0	0	107.7	L3 I30 A34	L3-F32 HydrophobicContact CB-CB 3.87Å; L3-F32 PolarHBondContact N-O 3.48Å; L3-F32 WeakPolarHBondContact O-CA 3.29Å; L3-F32 VanDerWaalsContact O-CB 3.29Å; L3-F32 WeakPolarHBondContact O-CB 3.31Å; L3-F32 PolarHBondContact O-N 2.87Å; I30-F32 HydrophobicContact CB-CE2 4.02Å; I30-F32 HydrophobicContact CB-CZ 4.36Å; I30-F32 HydrophobicContact CG2-CD2 4.19Å; I30-F32 HydrophobicContact CG2-CE1 4.3Å; I30-F32 HydrophobicContact CG2-CE2 3.84Å; I30-F32 HydrophobicContact CG2-CZ 3.9Å; F32-A34 PolarHBondContact O-N 3.19Å
33	S	50.3	Low	53.1	Low	100 Å²	100	127.9 Å²	127.9	70%	0.699	63%	0.63	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-78.8	99.2	164.6	-69.6	0	0	0	0	107.6	R31 H35	R31-S33 PolarHBondContact O-N 2.84Å; S33-H35 PolarHBondContact O-N 2.93Å
34	A	49.3	Very low	52.7	Low	82 Å²	82	135.6 Å²	135.6	68%	0.678	65%	0.648	S	S	*	*			trans	-69.1	70.7	160	0	0	0	0	0	108.1	F32 S36	F32-A34 PolarHBondContact O-N 3.19Å; A34-S36 PolarHBondContact O-N 3.44Å
35	H	48	Very low	51.8	Low	146 Å²	146	142 Å²	142	68%	0.676	68%	0.675	S	S	*	*			trans	-75.8	106.1	162.8	-147.3	-124.7	0	0	0	104.8	S33 D37	S33-H35 PolarHBondContact O-N 2.93Å; H35-D37 IonicContact CE1-OD2 3.24Å; H35-D37 PolarHBondContact CE1-OD2 3.28Å; H35-D37 VanDerWaalsContact CE1-OD2 3.24Å; H35-D37 IonicContact CG-OD2 3.97Å; H35-D37 IonicContact ND1-OD2 2.72Å; H35-D37 PolarHBondContact ND1-OD2 3.01Å; H35-D37 PolarHBondContact O-N 2.86Å
36	S	47.5	Very low	51.2	Low	103 Å²	103	140.4 Å²	140.4	72%	0.72	69%	0.686	S	S	*	*			trans	-64.9	63.9	163.9	169.4	0	0	0	0	108.3	A34 K38	A34-S36 PolarHBondContact O-N 3.44Å; S36-K38 PolarHBondContact O-N 3.35Å; S36-K38 VanDerWaalsContact O-N 3.12Å
37	D	48.8	Very low	50.2	Low	84 Å²	84	148.6 Å²	148.6	45%	0.449	71%	0.714	S	S	.	*			trans	-79.7	95.5	171.9	-130.6	-56.8	0	0	0	106.9	H35 R39	H35-D37 IonicContact CE1-OD2 3.24Å; H35-D37 PolarHBondContact CE1-OD2 3.28Å; H35-D37 VanDerWaalsContact CE1-OD2 3.24Å; H35-D37 IonicContact CG-OD2 3.97Å; H35-D37 IonicContact ND1-OD2 2.72Å; H35-D37 PolarHBondContact ND1-OD2 3.01Å; H35-D37 PolarHBondContact O-N 2.86Å; D37-R39 PolarHBondContact O-N 3.44Å; D37-R39 VanDerWaalsContact OD1-CD 3.22Å; D37-R39 WeakPolarHBondContact OD1-CD 3.25Å; D37-R39 WeakPolarHBondContact OD1-CG 3.41Å; D37-R39 IonicContact OD1-NE 3.8Å
38	K	47.3	Very low	49.3	Very low	196 Å²	196	150 Å²	150	85%	0.852	73%	0.727	S	S	*	*			trans	-66	44.6	166.2	-73.5	-178.9	173.3	178.3	0	111.1	S36	S36-K38 PolarHBondContact O-N 3.35Å; S36-K38 VanDerWaalsContact O-N 3.12Å
39	R	48.5	Very low	48.1	Very low	206 Å²	206	150.6 Å²	150.6	78%	0.777	74%	0.738	S	S	*	*			trans	-111.9	69.1	173.2	-70.5	-175.4	177.6	-170.4	-0.9	108.3	D37 A41	D37-R39 PolarHBondContact O-N 3.44Å; D37-R39 VanDerWaalsContact OD1-CD 3.22Å; D37-R39 WeakPolarHBondContact OD1-CD 3.25Å; D37-R39 WeakPolarHBondContact OD1-CG 3.41Å; D37-R39 IonicContact OD1-NE 3.8Å; R39-A41 PolarHBondContact O-N 3.46Å
40	Y	40.4	Very low	47.1	Very low	248 Å²	248	148.1 Å²	148.1	97%	0.973	74%	0.744	S	S	*	*			trans	-62.3	83.6	154.3	-105.7	-97.3	0	0	0	107.2
41	A	46.2	Very low	46	Very low	86 Å²	86	154 Å²	154	71%	0.711	77%	0.77	S	S	*	*			trans	-125.6	98.6	168.6	0	0	0	0	0	107	R39	R39-A41 PolarHBondContact O-N 3.46Å
42	H	43.7	Very low	45.3	Very low	193 Å²	193	151 Å²	151	89%	0.894	77%	0.773	S	S	*	*			trans	-33.9	147.5	153.6	-137.3	-91.9	0	0	0	111.1
43	S	45	Very low	44.6	Very low	109 Å²	109	149.4 Å²	149.4	76%	0.762	79%	0.787	S	S	*	*			trans	100.1	88.2	164.3	-153	0	0	0	0	117.4
44	R	49	Very low	44.5	Very low	233 Å²	233	151.5 Å²	151.5	88%	0.879	80%	0.795	S	S	*	*				-176.4	98.7	115	-107.3	175.4	170.1	174.5	-3.3	110.4	G46	R44-G46 PolarHBondContact O-N 3.45Å
45	F	43	Very low	44.3	Very low	226 Å²	226	155 Å²	155	99%	0.991	80%	0.802	S	S	*	*			trans	-59	112.3	147.4	-89.1	-100.5	0	0	0	107
46	G	48.2	Very low	43.9	Very low	62 Å²	62	157 Å²	157	64%	0.639	81%	0.811	S	S	*	*			trans	-139.3	97.4	-176.1	0	0	0	0	0	110.4	R44	R44-G46 PolarHBondContact O-N 3.45Å
47	R	36.4	Very low	44	Very low	243 Å²	243	157.6 Å²	157.6	92%	0.917	81%	0.81	S	S	*	*			trans	0.2	112.6	162.7	-68.1	176.4	178.7	174.6	-1.7	116.2
48	L	44.6	Very low	43.9	Very low	177 Å²	177	164.6 Å²	164.6	93%	0.927	83%	0.83	S	S	*	*			trans	-127	86.1	148.6	-90.9	159.9	0	0	0	108
49	Q	36.6	Very low	43.8	Very low	194 Å²	194	163.3 Å²	163.3	91%	0.907	83%	0.827	S	S	*	*			trans	-74.7	117	163.5	-174.9	177	24.4	0	0	106.4
50	G	40.4	Very low	43.7	Very low	65 Å²	65	162.7 Å²	162.7	67%	0.67	83%	0.83	S	S	*	*			trans	170.5	101.5	179	0	0	0	0	0	113.4
51	Q	43	Very low	44.2	Very low	181 Å²	181	156 Å²	156	85%	0.846	81%	0.814	S	S	*	*			trans	79.1	103.5	148.2	-69.6	178.2	-24.7	0	0	118.8
52	T	43.2	Very low	44.1	Very low	131 Å²	131	157.6 Å²	157.6	80%	0.804	82%	0.815	S	S	*	*				65.8	96.9	126.9	55.3	0	0	0	0	118.2
53	G	37.9	Very low	44.2	Very low	73 Å²	73	156.4 Å²	156.4	75%	0.753	81%	0.81	S	S	*	*				63.3	89.8	127.5	0	0	0	0	0	117
54	T	47.3	Very low	44.4	Very low	143 Å²	143	156.1 Å²	156.1	88%	0.877	81%	0.814	S	S	*	*			trans	-165.8	119.6	138.1	-0.3	0	0	0	0	111.5
55	L	45.6	Very low	44.2	Very low	155 Å²	155	147.6 Å²	147.6	81%	0.812	79%	0.794	S	S	*	*			trans	18.9	116.4	155.3	-98.7	76.5	0	0	0	118.7	V57	L55-V57 PolarHBondContact O-N 3Å
56	H	39.1	Very low	44.7	Very low	188 Å²	188	144.7 Å²	144.7	87%	0.87	78%	0.781	S	S	*	*			trans	-12.9	95.4	142.6	-93.3	129.4	0	0	0	114.7
57	V	50	Low	45	Very low	116 Å²	116	147.3 Å²	147.3	70%	0.703	79%	0.787	S	S	*	*			trans	-107.1	107.5	148.1	-177.1	0	0	0	0	105.2	L55 H59	L55-V57 PolarHBondContact O-N 3Å; V57-H59 VanDerWaalsContact C-N 3.26Å; V57-H59 PolarHBondContact O-N 3.11Å
58	R	46.1	Very low	45.9	Very low	232 Å²	232	143.8 Å²	143.8	88%	0.875	78%	0.78	S	S	*	*			trans	-53.3	94	167.5	-85.5	174.8	146.7	179	-5.8	108	K60	R58-K60 PolarHBondContact O-N 2.98Å
59	H	45.7	Very low	46.1	Very low	168 Å²	168	141.1 Å²	141.1	78%	0.778	76%	0.763	S	S	*	*			trans	-64.8	85.7	154	-75.1	156.1	0	0	0	106.3	V57 V61	V57-H59 VanDerWaalsContact C-N 3.26Å; V57-H59 PolarHBondContact O-N 3.11Å; H59-V61 HydrophobicContact CB-CG2 4.18Å; H59-V61 PolarHBondContact O-N 2.77Å
60	K	45.8	Very low	46.8	Very low	193 Å²	193	139.6 Å²	139.6	84%	0.839	75%	0.75	S	S	*	*			trans	-70.4	76.4	158.2	-155.9	177.3	-173.2	-176.3	0	105.3	R58 V62	R58-K60 PolarHBondContact O-N 2.98Å; K60-V62 PolarHBondContact O-N 3.17Å
61	V	50.7	Low	47.5	Very low	107 Å²	107	138.7 Å²	138.7	65%	0.648	74%	0.74	S	S	*	*			trans	-52.2	110.2	164	176.7	0	0	0	0	104.2	H59 E63	H59-V61 HydrophobicContact CB-CG2 4.18Å; H59-V61 PolarHBondContact O-N 2.77Å; V61-E63 PolarHBondContact O-N 3.3Å
62	V	44	Very low	48.3	Very low	120 Å²	120	135.4 Å²	135.4	73%	0.727	73%	0.725	S	S	*	*			trans	-65.5	93.7	167.1	167.9	0	0	0	0	105.2	K60 A64	K60-V62 PolarHBondContact O-N 3.17Å; V62-A64 PolarHBondContact O-N 3.47Å
63	E	46.9	Very low	49.1	Very low	169 Å²	169	134.1 Å²	134.1	79%	0.79	71%	0.712	S	S	*	*			trans	-35.7	121.2	160.9	-95.2	166.1	114.2	0	0	110.6	V61 A65	V61-E63 PolarHBondContact O-N 3.3Å; E63-A65 PolarHBondContact O-N 2.97Å
64	A	48.9	Very low	50.2	Low	103 Å²	103	135 Å²	135	85%	0.851	70%	0.703	S	S	*	*			trans	54.7	35.2	138	0	0	0	0	0	118.4	V62 K66	V62-A64 PolarHBondContact O-N 3.47Å; A64-K66 PolarHBondContact O-N 3.44Å
65	A	45.4	Very low	51	Low	54 Å²	54	134.4 Å²	134.4	45%	0.446	69%	0.69	S	S	.	*			trans	-82.1	97.9	167.9	0	0	0	0	0	110.6	E63	E63-A65 PolarHBondContact O-N 2.97Å
66	K	52.3	Low	51.9	Low	165 Å²	165	135.8 Å²	135.8	72%	0.717	69%	0.685	S	S	*	*			trans	7.1	130.4	164	-65.7	175.3	179.9	178.9	0	117.5	A64 H68 H69	A64-K66 PolarHBondContact O-N 3.44Å; K66-H68 PolarHBondContact O-N 3.44Å; K66-H69 PolarHBondContact O-N 3.39Å; K66-H69 VanDerWaalsContact O-N 3.1Å
67	P	55.6	Low	53.2	Low	117 Å²	117	131.9 Å²	131.9	76%	0.76	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.4	-16.3	-173.3	21.8	-32.6	0	0	0	115.9	H69	P67-H69 PolarHBondContact O-N 2.98Å
68	H	53.8	Low	54	Low	169 Å²	169	132.3 Å²	132.3	78%	0.782	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-19.9	177.2	-81.5	-85.7	0	0	0	114.9	K66	K66-H68 PolarHBondContact O-N 3.44Å
69	H	50.2	Low	55	Low	121 Å²	121	129.9 Å²	129.9	56%	0.56	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.7	-20	179.4	-89.8	125.4	0	0	0	114.2	K66 P67 G71 Q72 L73	K66-H69 PolarHBondContact O-N 3.39Å; K66-H69 VanDerWaalsContact O-N 3.1Å; P67-H69 PolarHBondContact O-N 2.98Å; H69-G71 VanDerWaalsContact C-N 3.34Å; H69-G71 PolarHBondContact O-N 3.31Å; H69-Q72 PolarHBondContact O-N 2.96Å; H69-L73 PolarHBondContact O-N 3.47Å
70	Y	51.2	Low	56.1	Low	162 Å²	162	126.9 Å²	126.9	64%	0.635	64%	0.643	S	S	*	*	H	α-helix	trans	-67.6	-32.6	178.4	-99.2	-92.5	0	0	0	112.7	Q72 L73 V74	Y70-Q72 PolarHBondContact O-N 3.48Å; Y70-L73 PolarHBondContact O-N 2.99Å; Y70-V74 VanDerWaalsContact O-CG2 3.31Å; Y70-V74 WeakPolarHBondContact O-CG2 3.41Å; Y70-V74 PolarHBondContact O-N 3.47Å
71	G	55.2	Low	57.3	Low	46 Å²	46	119.5 Å²	119.5	47%	0.474	62%	0.622	S	S	.	*	H	α-helix	trans	-63.4	-38.7	178.1	0	0	0	0	0	113.4	H69 Q75	H69-G71 VanDerWaalsContact C-N 3.34Å; H69-G71 PolarHBondContact O-N 3.31Å; G71-Q75 PolarHBondContact O-N 2.89Å; G71-Q75 VanDerWaalsContact O-N 3.11Å
72	Q	59.6	Low	58.1	Low	112 Å²	112	118.6 Å²	118.6	52%	0.523	61%	0.613	S	S	.	*	H	α-helix	trans	-71.9	-35.2	177	-66.9	-175.6	-3.8	0	0	112	H69 Y70 Q75 R76	H69-Q72 PolarHBondContact O-N 2.96Å; Y70-Q72 PolarHBondContact O-N 3.48Å; Q72-Q75 PolarHBondContact O-N 2.89Å; Q72-R76 WeakPolarHBondContact O-CG 3.32Å; Q72-R76 PolarHBondContact O-N 3.19Å
73	L	60.6	Low	59.2	Low	103 Å²	103	122.3 Å²	122.3	54%	0.539	61%	0.614	S	S	.	*	H	α-helix	trans	-70.5	-40	179.8	-152.3	130.3	0	0	0	111.2	H69 Y70 R76 I77	H69-L73 PolarHBondContact O-N 3.47Å; Y70-L73 PolarHBondContact O-N 2.99Å; L73-R76 PolarHBondContact O-N 2.91Å; L73-I77 HydrophobicContact CD2-CD1 3.69Å; L73-I77 VanDerWaalsContact O-CG1 3.32Å; L73-I77 WeakPolarHBondContact O-CG1 3.46Å; L73-I77 PolarHBondContact O-N 3.03Å
74	V	60.7	Low	60.1	Low	91 Å²	91	119 Å²	119	55%	0.552	60%	0.601	S	S	*	*	H	α-helix	trans	-64.6	-41.8	173.1	174.8	0	0	0	0	111.4	Y70 R76 I77 H78	Y70-V74 VanDerWaalsContact O-CG2 3.31Å; Y70-V74 WeakPolarHBondContact O-CG2 3.41Å; Y70-V74 PolarHBondContact O-N 3.47Å; V74-R76 PolarHBondContact O-N 3.24Å; V74-I77 PolarHBondContact O-N 3.25Å; V74-H78 WeakPolarHBondContact O-CB 3.32Å; V74-H78 PolarHBondContact O-N 3.33Å
75	Q	62.8	Low	60.6	Low	131 Å²	131	120.5 Å²	120.5	61%	0.612	59%	0.59	S	S	*	*	H	α-helix	trans	-63.2	-38.7	174.1	-82.8	-171.9	-5.6	0	0	113	G71 Q72 H78 R79	G71-Q75 PolarHBondContact O-N 2.89Å; G71-Q75 VanDerWaalsContact O-N 3.11Å; Q72-Q75 PolarHBondContact O-N 2.89Å; Q75-H78 PolarHBondContact O-N 3.5Å; Q75-R79 PolarHBondContact O-N 3.01Å
76	R	65.4	Low	61.5	Low	185 Å²	185	124.9 Å²	124.9	70%	0.698	60%	0.599	S	S	*	*	H	α-helix	trans	-66.8	-42.1	176.7	-77.2	-175.4	-178.8	-161.8	2	111.9	Q72 L73 V74 R79 L80	Q72-R76 WeakPolarHBondContact O-CG 3.32Å; Q72-R76 PolarHBondContact O-N 3.19Å; L73-R76 PolarHBondContact O-N 2.91Å; V74-R76 PolarHBondContact O-N 3.24Å; R76-R79 PolarHBondContact O-N 2.99Å; R76-L80 PolarHBondContact O-N 3.41Å
77	I	66.6	Low	61.9	Low	105 Å²	105	120.5 Å²	120.5	54%	0.538	59%	0.593	S	S	.	*	H	α-helix	trans	-65.7	-41.9	176	-66.8	169.4	0	0	0	110.6	L73 V74 R79 L80 G81	L73-I77 HydrophobicContact CD2-CD1 3.69Å; L73-I77 VanDerWaalsContact O-CG1 3.32Å; L73-I77 WeakPolarHBondContact O-CG1 3.46Å; L73-I77 PolarHBondContact O-N 3.03Å; V74-I77 PolarHBondContact O-N 3.25Å; I77-R79 PolarHBondContact O-N 3.07Å; I77-L80 WeakPolarHBondContact O-CB 3.45Å; I77-L80 PolarHBondContact O-N 3.41Å; I77-G81 PolarHBondContact O-N 2.9Å
78	H	67.5	Low	62	Low	126 Å²	126	121.6 Å²	121.6	58%	0.583	59%	0.592	S	S	*	*	H	α-helix	trans	-62.4	-41.5	176.5	-171.2	-104	0	0	0	112.2	V74 Q75 L80 G81 L82	V74-H78 WeakPolarHBondContact O-CB 3.32Å; V74-H78 PolarHBondContact O-N 3.33Å; Q75-H78 PolarHBondContact O-N 3.5Å; H78-L80 VanDerWaalsContact C-N 3.35Å; H78-L80 PolarHBondContact O-N 3.46Å; H78-G81 PolarHBondContact O-N 3.26Å; H78-L82 WeakPolarHBondContact O-CG 3.34Å; H78-L82 PolarHBondContact O-N 2.99Å
79	R	66.8	Low	62.2	Low	181 Å²	181	120.5 Å²	120.5	68%	0.683	59%	0.592	S	S	*	*	H	α-helix	trans	-64.4	-36.8	173.2	-80.7	-176.5	-178.2	-174.4	1.6	112.8	Q75 R76 I77 R83	Q75-R79 PolarHBondContact O-N 3.01Å; R76-R79 PolarHBondContact O-N 2.99Å; I77-R79 PolarHBondContact O-N 3.07Å; R79-R83 WeakPolarHBondContact O-CG 3.45Å; R79-R83 PolarHBondContact O-N 3.21Å; R79-R83 VanDerWaalsContact O-N 3.07Å
80	L	68.8	Low	62	Low	104 Å²	104	124.7 Å²	124.7	55%	0.545	62%	0.615	S	S	.	*	H	α-helix	trans	-65	-43.9	173.9	-97.6	153.6	0	0	0	111.4	R76 I77 H78 R83 I84	R76-L80 PolarHBondContact O-N 3.41Å; I77-L80 WeakPolarHBondContact O-CB 3.45Å; I77-L80 PolarHBondContact O-N 3.41Å; H78-L80 VanDerWaalsContact C-N 3.35Å; H78-L80 PolarHBondContact O-N 3.46Å; L80-R83 PolarHBondContact O-N 3.39Å; L80-I84 WeakPolarHBondContact O-CG1 3.43Å; L80-I84 PolarHBondContact O-N 2.95Å
81	G	70.1	Confident	62.5	Low	38 Å²	38	122.9 Å²	122.9	39%	0.392	61%	0.613	S	S	.	*	H	α-helix	trans	-59.6	-46.1	174.9	0	0	0	0	0	112.9	I77 H78 R83 I84 Q85	I77-G81 PolarHBondContact O-N 2.9Å; H78-G81 PolarHBondContact O-N 3.26Å; G81-R83 VanDerWaalsContact C-N 3.33Å; G81-R83 PolarHBondContact O-N 3.48Å; G81-I84 PolarHBondContact O-N 3.06Å; G81-Q85 WeakPolarHBondContact O-CB 3.47Å; G81-Q85 PolarHBondContact O-N 3.29Å
82	L	67.5	Low	62.9	Low	89 Å²	89	126.9 Å²	126.9	47%	0.466	62%	0.621	S	S	.	*	H	α-helix	trans	-62.6	-36.5	176.1	-75	168.6	0	0	0	112.9	H78 Q85 K86	H78-L82 WeakPolarHBondContact O-CG 3.34Å; H78-L82 PolarHBondContact O-N 2.99Å; L82-Q85 PolarHBondContact O-N 3.37Å; L82-K86 PolarHBondContact O-N 2.99Å
83	R	67.4	Low	63.1	Low	198 Å²	198	127.7 Å²	127.7	75%	0.747	63%	0.626	S	S	*	*	H	α-helix	trans	-66.6	-41.4	175.5	-81.9	-177.2	164.4	-179.4	-5.1	112.1	R79 L80 G81 Q85 K86 A87	R79-R83 WeakPolarHBondContact O-CG 3.45Å; R79-R83 PolarHBondContact O-N 3.21Å; R79-R83 VanDerWaalsContact O-N 3.07Å; L80-R83 PolarHBondContact O-N 3.39Å; G81-R83 VanDerWaalsContact C-N 3.33Å; G81-R83 PolarHBondContact O-N 3.48Å; R83-Q85 VanDerWaalsContact C-N 3.35Å; R83-K86 PolarHBondContact O-N 3.32Å; R83-A87 WeakPolarHBondContact O-CB 3.48Å; R83-A87 PolarHBondContact O-N 2.9Å
84	I	65.9	Low	63.3	Low	100 Å²	100	129.2 Å²	129.2	51%	0.513	63%	0.631	S	S	.	*	H	α-helix	trans	-67.3	-39.6	176.6	-65.5	164.8	0	0	0	110.3	L80 G81 K86 A87 L88	L80-I84 WeakPolarHBondContact O-CG1 3.43Å; L80-I84 PolarHBondContact O-N 2.95Å; G81-I84 PolarHBondContact O-N 3.06Å; I84-K86 PolarHBondContact O-N 3.04Å; I84-A87 PolarHBondContact O-N 3.43Å; I84-L88 HydrophobicContact CG2-CD1 3.88Å; I84-L88 WeakPolarHBondContact O-CG 3.47Å; I84-L88 PolarHBondContact O-N 3.47Å
85	Q	59.2	Low	63.4	Low	133 Å²	133	131.6 Å²	131.6	62%	0.621	64%	0.636	S	S	*	*	H	α-helix	trans	-66	-36.8	177.4	-164.9	170.1	11.1	0	0	112.4	G81 L82 R83 L88 N89	G81-Q85 WeakPolarHBondContact O-CB 3.47Å; G81-Q85 PolarHBondContact O-N 3.29Å; L82-Q85 PolarHBondContact O-N 3.37Å; R83-Q85 VanDerWaalsContact C-N 3.35Å; Q85-L88 PolarHBondContact O-N 2.82Å; Q85-N89 WeakPolarHBondContact O-CB 3.44Å; Q85-N89 PolarHBondContact O-N 2.7Å
86	K	64.2	Low	63.5	Low	147 Å²	147	131.6 Å²	131.6	64%	0.639	64%	0.638	S	S	*	*	H	α-helix	trans	-68.5	-35.2	172.9	-170.3	173.3	-178.2	177.8	0	112.3	L82 R83 I84 L88	L82-K86 PolarHBondContact O-N 2.99Å; R83-K86 PolarHBondContact O-N 3.32Å; I84-K86 PolarHBondContact O-N 3.04Å; K86-L88 VanDerWaalsContact C-N 3.35Å
87	A	59.8	Low	63.3	Low	72 Å²	72	127.8 Å²	127.8	60%	0.595	63%	0.634	S	S	*	*	H	α-helix	trans	-72.9	-25.3	177.1	0	0	0	0	0	113.6	R83 I84	R83-A87 WeakPolarHBondContact O-CB 3.48Å; R83-A87 PolarHBondContact O-N 2.9Å; I84-A87 PolarHBondContact O-N 3.43Å
88	L	59.5	Low	63.1	Low	140 Å²	140	129.5 Å²	129.5	73%	0.733	64%	0.641	S	S	*	*	H	α-helix	trans	-87.2	-12	176.1	-76.3	165.3	0	0	0	113.8	I84 Q85 K86	I84-L88 HydrophobicContact CG2-CD1 3.88Å; I84-L88 WeakPolarHBondContact O-CG 3.47Å; I84-L88 PolarHBondContact O-N 3.47Å; Q85-L88 PolarHBondContact O-N 2.82Å; K86-L88 VanDerWaalsContact C-N 3.35Å
89	N	56.7	Low	62.7	Low	146 Å²	146	129.8 Å²	129.8	78%	0.781	65%	0.646	S	S	*	*			trans	-109.4	20.7	-178.6	-158.7	74.9	0	0	0	112.4	Q85	Q85-N89 WeakPolarHBondContact O-CB 3.44Å; Q85-N89 PolarHBondContact O-N 2.7Å
90	M	46.6	Very low	62.3	Low	210 Å²	210	125.2 Å²	125.2	100%	1.034	64%	0.642	S	S	*	*			trans	-111	0	162.1	-79.6	-176.4	171.3	0	0	107.9

Retrieved 90 of 90 residues in 187.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).