A0A077ZIN0_TRITR Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A077ZIN0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 70 aa.

						>A0A077ZIN0_TRITR|A0A077ZIN0
MSKAAQGQIEALRHQLEQLRMEASLPRKKISEVARDLMDYCEKNKAQDVLVTGIADSHNPFQEKKSCSIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.4	Low	89.8	Confident	178 Å²	178	94.3 Å²	94.3	88%	0.877	53%	0.527	S	S	*	.				0	136	0	-67.6	-118.6	-86.3	0	0	108.1	Q6 I9	M1-Q6 HydrophobicContact CB-CG 4.49Å; M1-I9 HydrophobicContact CE-CD1 3.46Å; M1-I9 VanDerWaalsContact CE-CD1 3.46Å; M1-I9 HydrophobicContact SD-CD1 4.43Å
2	S	84.5	Confident	90.5	Very high	71 Å²	71	94.2 Å²	94.2	50%	0.497	52%	0.524	S	S	.	.			trans	-70.6	153.2	179	67.8	0	0	0	0	110.8	A4 A5 Q6	S2-A4 PolarHBondContact O-N 3.43Å; S2-A5 WeakPolarHBondContact O-CB 3.41Å; S2-A5 PolarHBondContact O-N 3.5Å; S2-A5 WeakPolarHBondContact OG-CB 3.41Å; S2-A5 PolarHBondContact OG-N 3.33Å; S2-A5 VanDerWaalsContact OG-N 3.11Å; S2-Q6 PolarHBondContact O-N 3.02Å
3	K	86.7	Confident	91	Very high	187 Å²	187	99.2 Å²	99.2	81%	0.813	53%	0.53	S	S	*	.	H	α-helix	trans	-55.3	-36.5	173.5	-74.9	-173.1	176.2	-177.2	0	111.9	Q6 G7	K3-Q6 PolarHBondContact O-N 3.01Å; K3-G7 PolarHBondContact O-N 3.04Å
4	A	90.7	Very high	91.5	Very high	76 Å²	76	101.1 Å²	101.1	63%	0.628	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-43.7	174.3	0	0	0	0	0	112	S2 Q6 G7 Q8	S2-A4 PolarHBondContact O-N 3.43Å; A4-Q6 PolarHBondContact O-N 3.11Å; A4-G7 PolarHBondContact O-N 3.44Å; A4-Q8 WeakPolarHBondContact O-CB 3.45Å; A4-Q8 PolarHBondContact O-N 2.98Å
5	A	92.8	Very high	91.9	Very high	29 Å²	29	102 Å²	102	24%	0.24	53%	0.534	C	S	.	.	H	α-helix	trans	-65.4	-37.5	176.2	0	0	0	0	0	112.3	S2 Q8 I9	S2-A5 WeakPolarHBondContact O-CB 3.41Å; S2-A5 PolarHBondContact O-N 3.5Å; S2-A5 WeakPolarHBondContact OG-CB 3.41Å; S2-A5 PolarHBondContact OG-N 3.33Å; S2-A5 VanDerWaalsContact OG-N 3.11Å; A5-Q8 PolarHBondContact O-N 3.16Å; A5-I9 WeakPolarHBondContact O-CD1 3.45Å; A5-I9 VanDerWaalsContact O-CG1 3.24Å; A5-I9 WeakPolarHBondContact O-CG1 3.48Å; A5-I9 PolarHBondContact O-N 3.36Å
6	Q	92	Very high	92.3	Very high	100 Å²	100	100.7 Å²	100.7	47%	0.467	53%	0.527	S	S	.	.	H	α-helix	trans	-63.1	-49.4	174.4	-71.9	175.6	-39.7	0	0	111.7	M1 S2 K3 A4 Q8 I9 E10	M1-Q6 HydrophobicContact CB-CG 4.49Å; S2-Q6 PolarHBondContact O-N 3.02Å; K3-Q6 PolarHBondContact O-N 3.01Å; A4-Q6 PolarHBondContact O-N 3.11Å; Q6-Q8 VanDerWaalsContact C-N 3.3Å; Q6-Q8 PolarHBondContact O-N 2.95Å; Q6-I9 PolarHBondContact O-N 3.26Å; Q6-I9 VanDerWaalsContact O-N 3.16Å; Q6-E10 PolarHBondContact O-N 3.47Å
7	G	95.4	Very high	92.6	Very high	35 Å²	35	101 Å²	101	36%	0.361	53%	0.525	S	S	.	.	H	α-helix	trans	-61.7	-36.1	177	0	0	0	0	0	113.1	K3 A4 E10 A11	K3-G7 PolarHBondContact O-N 3.04Å; A4-G7 PolarHBondContact O-N 3.44Å; G7-E10 PolarHBondContact O-N 3.29Å; G7-A11 WeakPolarHBondContact O-CB 3.24Å; G7-A11 PolarHBondContact O-N 3.34Å
8	Q	96.4	Very high	92.9	Very high	128 Å²	128	100.4 Å²	100.4	60%	0.598	52%	0.519	S	S	*	.	H	α-helix	trans	-66.4	-40.2	174.6	-173.1	177.2	-6.7	0	0	112.3	A4 A5 Q6 E10 A11 L12	A4-Q8 WeakPolarHBondContact O-CB 3.45Å; A4-Q8 PolarHBondContact O-N 2.98Å; A5-Q8 PolarHBondContact O-N 3.16Å; Q6-Q8 VanDerWaalsContact C-N 3.3Å; Q6-Q8 PolarHBondContact O-N 2.95Å; Q8-E10 VanDerWaalsContact C-N 3.35Å; Q8-A11 PolarHBondContact O-N 3.46Å; Q8-L12 HydrophobicContact CG-CD1 4.3Å; Q8-L12 WeakPolarHBondContact O-CB 3.34Å; Q8-L12 WeakPolarHBondContact O-CG 3.49Å; Q8-L12 PolarHBondContact O-N 3.2Å
9	I	95.5	Very high	93.2	Very high	61 Å²	61	99.8 Å²	99.8	31%	0.313	52%	0.517	S	S	.	.	H	α-helix	trans	-64.3	-41.3	176.4	-70.5	164.1	0	0	0	110.9	M1 A5 Q6 L12 R13	M1-I9 HydrophobicContact CE-CD1 3.46Å; M1-I9 VanDerWaalsContact CE-CD1 3.46Å; M1-I9 HydrophobicContact SD-CD1 4.43Å; A5-I9 WeakPolarHBondContact O-CD1 3.45Å; A5-I9 VanDerWaalsContact O-CG1 3.24Å; A5-I9 WeakPolarHBondContact O-CG1 3.48Å; A5-I9 PolarHBondContact O-N 3.36Å; Q6-I9 PolarHBondContact O-N 3.26Å; Q6-I9 VanDerWaalsContact O-N 3.16Å; I9-L12 PolarHBondContact O-N 3.03Å; I9-R13 WeakPolarHBondContact O-CG 3.48Å; I9-R13 PolarHBondContact O-N 2.99Å
10	E	95.9	Very high	93.5	Very high	115 Å²	115	103.5 Å²	103.5	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-63.6	-45.5	176.4	-71.9	169.7	-174.4	0	0	111.7	Q6 G7 Q8 L12 R13 H14	Q6-E10 PolarHBondContact O-N 3.47Å; G7-E10 PolarHBondContact O-N 3.29Å; Q8-E10 VanDerWaalsContact C-N 3.35Å; E10-L12 VanDerWaalsContact C-N 3.35Å; E10-L12 PolarHBondContact O-N 2.93Å; E10-R13 WeakPolarHBondContact O-CB 3.32Å; E10-R13 PolarHBondContact O-N 3.42Å; E10-H14 PolarHBondContact O-CD2 3.47Å; E10-H14 VanDerWaalsContact O-CD2 3.29Å; E10-H14 PolarHBondContact O-N 3.42Å
11	A	96.7	Very high	93.7	Very high	57 Å²	57	103.7 Å²	103.7	47%	0.471	52%	0.524	S	S	.	.	H	α-helix	trans	-59.6	-43.4	175.2	0	0	0	0	0	112.4	G7 Q8 R13 H14 Q15	G7-A11 WeakPolarHBondContact O-CB 3.24Å; G7-A11 PolarHBondContact O-N 3.34Å; Q8-A11 PolarHBondContact O-N 3.46Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 2.99Å; A11-H14 PolarHBondContact O-N 3.44Å; A11-Q15 WeakPolarHBondContact O-CB 3.49Å; A11-Q15 PolarHBondContact O-N 3.03Å
12	L	97.5	Very high	95.4	Very high	93 Å²	93	99.2 Å²	99.2	49%	0.487	50%	0.501	S	S	.	.	H	α-helix	trans	-65.5	-35.2	177.1	-74.3	172.3	0	0	0	112.5	Q8 I9 E10 Q15 L16	Q8-L12 HydrophobicContact CG-CD1 4.3Å; Q8-L12 WeakPolarHBondContact O-CB 3.34Å; Q8-L12 WeakPolarHBondContact O-CG 3.49Å; Q8-L12 PolarHBondContact O-N 3.2Å; I9-L12 PolarHBondContact O-N 3.03Å; E10-L12 VanDerWaalsContact C-N 3.35Å; E10-L12 PolarHBondContact O-N 2.93Å; L12-Q15 PolarHBondContact O-N 3.47Å; L12-L16 VanDerWaalsContact O-CB 3.25Å; L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 PolarHBondContact O-N 2.92Å
13	R	97.4	Very high	96.1	Very high	160 Å²	160	99.1 Å²	99.1	60%	0.604	50%	0.504	S	S	*	.	H	α-helix	trans	-64.5	-46.5	174	-76	173.8	177.8	176.2	-0.6	111.4	I9 E10 A11 Q15 L16 E17	I9-R13 WeakPolarHBondContact O-CG 3.48Å; I9-R13 PolarHBondContact O-N 2.99Å; E10-R13 WeakPolarHBondContact O-CB 3.32Å; E10-R13 PolarHBondContact O-N 3.42Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 2.99Å; R13-Q15 VanDerWaalsContact C-N 3.35Å; R13-Q15 PolarHBondContact O-N 2.94Å; R13-L16 PolarHBondContact O-N 3.2Å; R13-E17 WeakPolarHBondContact O-CG 3.25Å; R13-E17 PolarHBondContact O-N 2.92Å
14	H	97.6	Very high	96.6	Very high	126 Å²	126	94.6 Å²	94.6	58%	0.583	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-43.1	174.9	-76.4	-55.8	0	0	0	112.3	E10 A11 L16 E17 Q18	E10-H14 PolarHBondContact O-CD2 3.47Å; E10-H14 VanDerWaalsContact O-CD2 3.29Å; E10-H14 PolarHBondContact O-N 3.42Å; A11-H14 PolarHBondContact O-N 3.44Å; H14-L16 VanDerWaalsContact C-N 3.31Å; H14-L16 PolarHBondContact O-N 2.99Å; H14-E17 IonicContact ND1-OE2 3.84Å; H14-E17 PolarHBondContact O-N 2.92Å; H14-Q18 WeakPolarHBondContact O-CB 3.44Å; H14-Q18 PolarHBondContact O-N 3.38Å
15	Q	98	Very high	96.9	Very high	114 Å²	114	96 Å²	96	53%	0.533	49%	0.492	S	S	.	.	H	α-helix	trans	-62.3	-40.2	175.7	-173.9	179.6	-13.8	0	0	111.7	A11 L12 R13 Q18 L19	A11-Q15 WeakPolarHBondContact O-CB 3.49Å; A11-Q15 PolarHBondContact O-N 3.03Å; L12-Q15 PolarHBondContact O-N 3.47Å; R13-Q15 VanDerWaalsContact C-N 3.35Å; R13-Q15 PolarHBondContact O-N 2.94Å; Q15-Q18 PolarHBondContact O-N 3.34Å; Q15-L19 HydrophobicContact CG-CD1 4.16Å; Q15-L19 HydrophobicContact CG-CG 4.5Å; Q15-L19 WeakPolarHBondContact O-CB 3.26Å; Q15-L19 VanDerWaalsContact O-CG 3.26Å; Q15-L19 WeakPolarHBondContact O-CG 3.46Å; Q15-L19 PolarHBondContact O-N 3.43Å
16	L	98	Very high	97.1	Very high	81 Å²	81	100.7 Å²	100.7	42%	0.424	52%	0.521	S	S	.	.	H	α-helix	trans	-66.5	-41.2	178.1	-176.4	157.3	0	0	0	111.8	L12 R13 H14 L19 R20	L12-L16 VanDerWaalsContact O-CB 3.25Å; L12-L16 WeakPolarHBondContact O-CB 3.47Å; L12-L16 PolarHBondContact O-N 2.92Å; R13-L16 PolarHBondContact O-N 3.2Å; H14-L16 VanDerWaalsContact C-N 3.31Å; H14-L16 PolarHBondContact O-N 2.99Å; L16-L19 PolarHBondContact O-N 3.27Å; L16-R20 HydrophobicContact CD2-CG 4.29Å; L16-R20 VanDerWaalsContact CD2-NE 3.3Å; L16-R20 WeakPolarHBondContact O-CG 3.45Å; L16-R20 PolarHBondContact O-N 2.77Å
17	E	98	Very high	97.4	Very high	106 Å²	106	104.9 Å²	104.9	50%	0.495	53%	0.532	S	S	.	.	H	α-helix	trans	-60.6	-46.2	172.7	-73.3	171.9	-178.4	0	0	111.4	R13 H14 L19 R20 M21	R13-E17 WeakPolarHBondContact O-CG 3.25Å; R13-E17 PolarHBondContact O-N 2.92Å; H14-E17 IonicContact ND1-OE2 3.84Å; H14-E17 PolarHBondContact O-N 2.92Å; E17-L19 PolarHBondContact O-N 3.04Å; E17-R20 PolarHBondContact O-N 3.14Å; E17-M21 WeakPolarHBondContact O-CG 3.46Å; E17-M21 PolarHBondContact O-N 3.46Å
18	Q	98.3	Very high	97.5	Very high	90 Å²	90	109.2 Å²	109.2	42%	0.421	54%	0.541	S	S	.	.	H	α-helix	trans	-57.8	-49.6	175.7	-178.1	62.2	24.9	0	0	112	H14 Q15 R20 M21 E22	H14-Q18 WeakPolarHBondContact O-CB 3.44Å; H14-Q18 PolarHBondContact O-N 3.38Å; Q15-Q18 PolarHBondContact O-N 3.34Å; Q18-R20 VanDerWaalsContact C-N 3.31Å; Q18-R20 PolarHBondContact O-N 3.48Å; Q18-M21 WeakPolarHBondContact O-CB 3.35Å; Q18-M21 PolarHBondContact O-N 3.37Å; Q18-M21 VanDerWaalsContact O-N 3.14Å; Q18-E22 WeakPolarHBondContact CG-OE1 3.49Å; Q18-E22 PolarHBondContact NE2-OE1 3.16Å; Q18-E22 WeakPolarHBondContact O-CG 3.43Å; Q18-E22 PolarHBondContact O-N 3.47Å
19	L	98.5	Very high	97.6	Very high	90 Å²	90	110.7 Å²	110.7	47%	0.471	55%	0.545	S	S	.	.	H	α-helix	trans	-63.5	-35.8	179.8	-71.6	172.8	0	0	0	112.3	Q15 L16 E17 E22 A23	Q15-L19 HydrophobicContact CG-CD1 4.16Å; Q15-L19 HydrophobicContact CG-CG 4.5Å; Q15-L19 WeakPolarHBondContact O-CB 3.26Å; Q15-L19 VanDerWaalsContact O-CG 3.26Å; Q15-L19 WeakPolarHBondContact O-CG 3.46Å; Q15-L19 PolarHBondContact O-N 3.43Å; L16-L19 PolarHBondContact O-N 3.27Å; E17-L19 PolarHBondContact O-N 3.04Å; L19-E22 PolarHBondContact O-N 3.47Å; L19-A23 WeakPolarHBondContact O-CB 3.22Å; L19-A23 PolarHBondContact O-N 3.15Å
20	R	98.3	Very high	97.7	Very high	173 Å²	173	115 Å²	115	65%	0.653	57%	0.567	S	S	*	*	H	α-helix	trans	-63.6	-42.5	173.6	-77.7	178.3	176.3	168.2	-0.4	111.6	L16 E17 Q18 S24	L16-R20 HydrophobicContact CD2-CG 4.29Å; L16-R20 VanDerWaalsContact CD2-NE 3.3Å; L16-R20 WeakPolarHBondContact O-CG 3.45Å; L16-R20 PolarHBondContact O-N 2.77Å; E17-R20 PolarHBondContact O-N 3.14Å; Q18-R20 VanDerWaalsContact C-N 3.31Å; Q18-R20 PolarHBondContact O-N 3.48Å; R20-S24 PolarHBondContact O-N 3.07Å; R20-S24 VanDerWaalsContact O-N 3.15Å
21	M	97.9	Very high	97.8	Very high	108 Å²	108	113.1 Å²	113.1	53%	0.532	57%	0.567	S	S	.	*	H	α-helix	trans	-62	-49.4	175.4	-67.4	-170.5	-65.4	0	0	111	E17 Q18 A23 S24 L25	E17-M21 WeakPolarHBondContact O-CG 3.46Å; E17-M21 PolarHBondContact O-N 3.46Å; Q18-M21 WeakPolarHBondContact O-CB 3.35Å; Q18-M21 PolarHBondContact O-N 3.37Å; Q18-M21 VanDerWaalsContact O-N 3.14Å; M21-A23 VanDerWaalsContact C-N 3.34Å; M21-A23 PolarHBondContact O-N 3Å; M21-S24 PolarHBondContact O-N 2.68Å; M21-S24 VanDerWaalsContact O-N 3.16Å; M21-S24 PolarHBondContact O-OG 3.44Å; M21-L25 PolarHBondContact O-N 2.94Å
22	E	97.9	Very high	97.9	Very high	84 Å²	84	113.9 Å²	113.9	39%	0.393	56%	0.561	S	S	.	*	H	α-helix	trans	-64.3	-34.8	179.4	-70.2	176.7	-168	0	0	113.6	Q18 L19 S24 L25 R27	Q18-E22 WeakPolarHBondContact CG-OE1 3.49Å; Q18-E22 PolarHBondContact NE2-OE1 3.16Å; Q18-E22 WeakPolarHBondContact O-CG 3.43Å; Q18-E22 PolarHBondContact O-N 3.47Å; L19-E22 PolarHBondContact O-N 3.47Å; E22-S24 VanDerWaalsContact C-N 3.32Å; E22-L25 PolarHBondContact O-N 3.13Å; E22-R27 PolarHBondContact O-NH2 3.4Å
23	A	98.1	Very high	97.9	Very high	68 Å²	68	112.1 Å²	112.1	56%	0.562	55%	0.554	S	S	*	*	H	α-helix	trans	-65.7	-37.5	175.1	0	0	0	0	0	111.6	L19 M21 L25 R27	L19-A23 WeakPolarHBondContact O-CB 3.22Å; L19-A23 PolarHBondContact O-N 3.15Å; M21-A23 VanDerWaalsContact C-N 3.34Å; M21-A23 PolarHBondContact O-N 3Å; A23-L25 PolarHBondContact O-N 3.43Å; A23-R27 PolarHBondContact O-NH1 2.88Å
24	S	97.8	Very high	98	Very high	92 Å²	92	106.5 Å²	106.5	64%	0.643	54%	0.542	S	S	*	.	H	α-helix	trans	-72.2	-11.5	-179.7	75.4	0	0	0	0	114.6	R20 M21 E22	R20-S24 PolarHBondContact O-N 3.07Å; R20-S24 VanDerWaalsContact O-N 3.15Å; M21-S24 PolarHBondContact O-N 2.68Å; M21-S24 VanDerWaalsContact O-N 3.16Å; M21-S24 PolarHBondContact O-OG 3.44Å; E22-S24 VanDerWaalsContact C-N 3.32Å
25	L	97.4	Very high	98	Very high	105 Å²	105	107 Å²	107	55%	0.55	54%	0.539	S	S	.	.	S	Bend	trans	-64.8	125.2	179.7	-65.6	176.3	0	0	0	111	M21 E22 A23 R27	M21-L25 PolarHBondContact O-N 2.94Å; E22-L25 PolarHBondContact O-N 3.13Å; A23-L25 PolarHBondContact O-N 3.43Å; L25-R27 PolarHBondContact O-N 3.32Å; L25-R27 PolarHBondContact O-NH1 3.43Å; L25-R27 VanDerWaalsContact O-NH1 3.13Å
26	P	97.2	Very high	98	Very high	129 Å²	129	105.1 Å²	105.1	84%	0.838	53%	0.532	S	S	*	.			trans	-66.7	131.9	175.7	27.8	-33.5	0	0	0	110
27	R	97.4	Very high	98	Very high	188 Å²	188	106.4 Å²	106.4	71%	0.709	54%	0.539	S	S	*	.			trans	-108.3	137.1	178.6	-65.8	174.4	-175.3	72.6	2.7	109.8	E22 A23 L25	E22-R27 PolarHBondContact O-NH2 3.4Å; A23-R27 PolarHBondContact O-NH1 2.88Å; L25-R27 PolarHBondContact O-N 3.32Å; L25-R27 PolarHBondContact O-NH1 3.43Å; L25-R27 VanDerWaalsContact O-NH1 3.13Å
28	K	97.4	Very high	98	Very high	126 Å²	126	106.9 Å²	106.9	55%	0.548	54%	0.543	S	S	.	.			trans	-80.2	161.2	171.7	-69.5	-178.4	164.9	-140	0	111	E32 V33 D36	K28-E32 WeakPolarHBondContact CD-OE1 3.4Å; K28-E32 WeakPolarHBondContact CE-OE1 3.41Å; K28-E32 IonicContact NZ-OE1 3.86Å; K28-E32 PolarHBondContact NZ-OE1 2.96Å; K28-V33 HydrophobicContact CB-CG2 3.65Å; K28-V33 HydrophobicContact CD-CG2 4.15Å; K28-D36 IonicContact NZ-OD2 2.8Å
29	K	98.2	Very high	98	Very high	158 Å²	158	106 Å²	106	69%	0.687	54%	0.541	S	S	*	.			trans	-66.7	138.2	172.1	-69.7	-176.6	-179.8	177.8	0	109.7	S31 E32 V33	K29-S31 PolarHBondContact O-N 3.06Å; K29-E32 HydrophobicContact CB-CB 4.37Å; K29-E32 WeakPolarHBondContact O-CB 3.48Å; K29-E32 PolarHBondContact O-N 3.31Å; K29-V33 PolarHBondContact O-N 3.33Å; K29-V33 VanDerWaalsContact O-N 3.12Å
30	I	98.2	Very high	98	Very high	151 Å²	151	109 Å²	109	77%	0.774	55%	0.547	S	S	*	.	H	α-helix	trans	-56.2	-38.1	177.4	-62.7	174.9	0	0	0	111	E32 V33 A34	I30-E32 VanDerWaalsContact C-N 3.31Å; I30-E32 PolarHBondContact O-N 2.8Å; I30-V33 PolarHBondContact O-N 3.44Å; I30-A34 WeakPolarHBondContact O-CB 3.45Å; I30-A34 PolarHBondContact O-N 3Å
31	S	98.3	Very high	98	Very high	77 Å²	77	104.5 Å²	104.5	54%	0.538	54%	0.541	S	S	.	.	H	α-helix	trans	-65.8	-29.1	177.9	54	0	0	0	0	114.3	K29 R35	K29-S31 PolarHBondContact O-N 3.06Å; S31-R35 PolarHBondContact O-N 2.94Å
32	E	98.2	Very high	97.9	Very high	72 Å²	72	105.3 Å²	105.3	34%	0.336	54%	0.543	S	S	.	.	H	α-helix	trans	-73.8	-52	173.5	-177.2	-170.3	147.5	0	0	109.9	K28 K29 I30 A34 R35 D36	K28-E32 WeakPolarHBondContact CD-OE1 3.4Å; K28-E32 WeakPolarHBondContact CE-OE1 3.41Å; K28-E32 IonicContact NZ-OE1 3.86Å; K28-E32 PolarHBondContact NZ-OE1 2.96Å; K29-E32 HydrophobicContact CB-CB 4.37Å; K29-E32 WeakPolarHBondContact O-CB 3.48Å; K29-E32 PolarHBondContact O-N 3.31Å; I30-E32 VanDerWaalsContact C-N 3.31Å; I30-E32 PolarHBondContact O-N 2.8Å; E32-A34 VanDerWaalsContact C-N 3.3Å; E32-A34 PolarHBondContact O-N 3.21Å; E32-R35 WeakPolarHBondContact O-CB 3.44Å; E32-R35 PolarHBondContact O-N 3.01Å; E32-D36 PolarHBondContact O-N 3.36Å
33	V	98.2	Very high	97.9	Very high	57 Å²	57	108.8 Å²	108.8	35%	0.345	56%	0.557	S	S	.	*	H	α-helix	trans	-60.3	-40.7	-179.7	178.9	0	0	0	0	111.5	K28 K29 I30 R35 D36 L37	K28-V33 HydrophobicContact CB-CG2 3.65Å; K28-V33 HydrophobicContact CD-CG2 4.15Å; K29-V33 PolarHBondContact O-N 3.33Å; K29-V33 VanDerWaalsContact O-N 3.12Å; I30-V33 PolarHBondContact O-N 3.44Å; V33-R35 VanDerWaalsContact C-N 3.31Å; V33-R35 PolarHBondContact O-N 2.99Å; V33-D36 PolarHBondContact O-N 3.12Å; V33-L37 HydrophobicContact CG1-CD1 4.26Å; V33-L37 WeakPolarHBondContact O-CG 3.42Å; V33-L37 PolarHBondContact O-N 3.4Å
34	A	98.4	Very high	97.9	Very high	41 Å²	41	108.3 Å²	108.3	34%	0.339	55%	0.545	S	S	.	.	H	α-helix	trans	-62	-39.6	176.2	0	0	0	0	0	111.9	I30 E32 L37 M38	I30-A34 WeakPolarHBondContact O-CB 3.45Å; I30-A34 PolarHBondContact O-N 3Å; E32-A34 VanDerWaalsContact C-N 3.3Å; E32-A34 PolarHBondContact O-N 3.21Å; A34-L37 PolarHBondContact O-N 2.92Å; A34-M38 VanDerWaalsContact O-CG 3.31Å; A34-M38 WeakPolarHBondContact O-CG 3.41Å; A34-M38 PolarHBondContact O-N 3.03Å
35	R	98.4	Very high	97.8	Very high	137 Å²	137	108.6 Å²	108.6	52%	0.517	54%	0.535	S	S	.	.	H	α-helix	trans	-65.3	-46.4	175.6	-168.6	-174.3	-57.9	124.3	1.7	111.3	S31 E32 V33 L37 M38 D39	S31-R35 PolarHBondContact O-N 2.94Å; E32-R35 WeakPolarHBondContact O-CB 3.44Å; E32-R35 PolarHBondContact O-N 3.01Å; V33-R35 VanDerWaalsContact C-N 3.31Å; V33-R35 PolarHBondContact O-N 2.99Å; R35-L37 VanDerWaalsContact C-N 3.27Å; R35-L37 PolarHBondContact O-N 3.1Å; R35-M38 HydrophobicContact CB-CE 4.47Å; R35-M38 PolarHBondContact O-N 3.22Å; R35-D39 WeakPolarHBondContact O-CB 3.22Å; R35-D39 VanDerWaalsContact O-CG 3.32Å; R35-D39 PolarHBondContact O-N 3.36Å
36	D	98.1	Very high	97.5	Very high	75 Å²	75	107.6 Å²	107.6	40%	0.401	54%	0.541	S	S	.	.	H	α-helix	trans	-57.7	-41.9	178	-66.4	-11.8	0	0	0	111.4	K28 E32 V33 Y40	K28-D36 IonicContact NZ-OD2 2.8Å; E32-D36 PolarHBondContact O-N 3.36Å; V33-D36 PolarHBondContact O-N 3.12Å; D36-Y40 WeakPolarHBondContact O-CB 3.32Å; D36-Y40 PolarHBondContact O-N 3.37Å
37	L	98.4	Very high	97.3	Very high	108 Å²	108	108.9 Å²	108.9	57%	0.565	54%	0.536	S	S	*	.	H	α-helix	trans	-66.3	-44.7	176.2	-71.7	174.8	0	0	0	112.4	V33 A34 R35 Y40 C41	V33-L37 HydrophobicContact CG1-CD1 4.26Å; V33-L37 WeakPolarHBondContact O-CG 3.42Å; V33-L37 PolarHBondContact O-N 3.4Å; A34-L37 PolarHBondContact O-N 2.92Å; R35-L37 VanDerWaalsContact C-N 3.27Å; R35-L37 PolarHBondContact O-N 3.1Å; L37-Y40 PolarHBondContact O-N 3.19Å; L37-C41 PolarHBondContact O-N 3.27Å; L37-C41 PolarHBondContact O-SG 3.14Å; L37-C41 VanDerWaalsContact O-SG 3.35Å
38	M	97.9	Very high	97.2	Very high	116 Å²	116	103.2 Å²	103.2	57%	0.571	52%	0.52	S	S	*	.	H	α-helix	trans	-61.8	-46.1	176.5	-73.1	-176.4	-62.1	0	0	111.3	A34 R35 Y40 C41 E42	A34-M38 VanDerWaalsContact O-CG 3.31Å; A34-M38 WeakPolarHBondContact O-CG 3.41Å; A34-M38 PolarHBondContact O-N 3.03Å; R35-M38 HydrophobicContact CB-CE 4.47Å; R35-M38 PolarHBondContact O-N 3.22Å; M38-Y40 VanDerWaalsContact C-N 3.28Å; M38-Y40 PolarHBondContact O-N 3.18Å; M38-C41 PolarHBondContact O-N 2.94Å; M38-E42 WeakPolarHBondContact O-CG 3.35Å; M38-E42 PolarHBondContact O-N 2.83Å
39	D	98.2	Very high	97	Very high	72 Å²	72	100.8 Å²	100.8	39%	0.385	52%	0.516	S	S	.	.	H	α-helix	trans	-61.3	-38.9	178.1	-73	-6.5	0	0	0	111.4	R35 K43	R35-D39 WeakPolarHBondContact O-CB 3.22Å; R35-D39 VanDerWaalsContact O-CG 3.32Å; R35-D39 PolarHBondContact O-N 3.36Å; D39-K43 WeakPolarHBondContact O-CB 3.32Å; D39-K43 WeakPolarHBondContact O-CD 3.33Å; D39-K43 WeakPolarHBondContact O-CG 3.4Å; D39-K43 PolarHBondContact O-N 3.12Å
40	Y	98.4	Very high	96.8	Very high	152 Å²	152	101 Å²	101	60%	0.596	52%	0.523	S	S	*	.	H	α-helix	trans	-62.8	-49	174.1	179.6	-91.8	0	0	0	111.4	D36 L37 M38 K43 N44	D36-Y40 WeakPolarHBondContact O-CB 3.32Å; D36-Y40 PolarHBondContact O-N 3.37Å; L37-Y40 PolarHBondContact O-N 3.19Å; M38-Y40 VanDerWaalsContact C-N 3.28Å; M38-Y40 PolarHBondContact O-N 3.18Å; Y40-K43 PolarHBondContact O-N 3.34Å; Y40-N44 WeakPolarHBondContact CE2-ND2 3.42Å; Y40-N44 PolarHBondContact O-N 3.24Å; Y40-N44 PolarHBondContact O-ND2 3.05Å
41	C	97.9	Very high	96.6	Very high	78 Å²	78	97.7 Å²	97.7	53%	0.527	51%	0.51	S	S	.	.	H	α-helix	trans	-60.7	-48.2	178.9	-70.3	0	0	0	0	111.4	L37 M38 K43 N44 K45	L37-C41 PolarHBondContact O-N 3.27Å; L37-C41 PolarHBondContact O-SG 3.14Å; L37-C41 VanDerWaalsContact O-SG 3.35Å; M38-C41 PolarHBondContact O-N 2.94Å; C41-K43 PolarHBondContact O-N 3.42Å; C41-N44 PolarHBondContact O-N 3.17Å; C41-K45 WeakPolarHBondContact O-CA 3.36Å; C41-K45 VanDerWaalsContact O-CB 3.31Å; C41-K45 WeakPolarHBondContact O-CB 3.44Å; C41-K45 PolarHBondContact O-N 2.87Å
42	E	96.8	Very high	96.3	Very high	125 Å²	125	97.8 Å²	97.8	58%	0.584	51%	0.508	S	S	*	.	H	α-helix	trans	-63.4	-39.8	-179.5	-72.6	-60.6	155.6	0	0	112.6	M38 N44	M38-E42 WeakPolarHBondContact O-CG 3.35Å; M38-E42 PolarHBondContact O-N 2.83Å; E42-N44 VanDerWaalsContact C-N 3.32Å; E42-N44 PolarHBondContact O-N 2.78Å
43	K	97.3	Very high	95.9	Very high	158 Å²	158	96.4 Å²	96.4	69%	0.687	51%	0.513	S	S	*	.	H	α-helix	trans	-63	-36.9	176.3	-76.6	170.2	-175.1	169.3	0	113	D39 Y40 C41	D39-K43 WeakPolarHBondContact O-CB 3.32Å; D39-K43 WeakPolarHBondContact O-CD 3.33Å; D39-K43 WeakPolarHBondContact O-CG 3.4Å; D39-K43 PolarHBondContact O-N 3.12Å; Y40-K43 PolarHBondContact O-N 3.34Å; C41-K43 PolarHBondContact O-N 3.42Å
44	N	97	Very high	95.5	Very high	57 Å²	57	97.1 Å²	97.1	31%	0.305	51%	0.514	S	S	.	.	H	α-helix	trans	-96.2	-14.1	-174.5	-67.5	-76.5	0	0	0	113.4	Y40 C41 E42 A46 Q47 D48	Y40-N44 WeakPolarHBondContact CE2-ND2 3.42Å; Y40-N44 PolarHBondContact O-N 3.24Å; Y40-N44 PolarHBondContact O-ND2 3.05Å; C41-N44 PolarHBondContact O-N 3.17Å; E42-N44 VanDerWaalsContact C-N 3.32Å; E42-N44 PolarHBondContact O-N 2.78Å; N44-A46 PolarHBondContact O-N 3.43Å; N44-A46 VanDerWaalsContact O-N 3.12Å; N44-Q47 PolarHBondContact O-N 3.18Å; N44-D48 PolarHBondContact O-N 3.45Å
45	K	95.5	Very high	95	Very high	99 Å²	99	97.9 Å²	97.9	43%	0.43	52%	0.521	S	S	.	.	G	3₁₀ helix	trans	-49.9	-41.6	-177.5	-177.8	177.4	179.8	179.9	0	113.4	C41 Q47 D48 V51 T52	C41-K45 WeakPolarHBondContact O-CA 3.36Å; C41-K45 VanDerWaalsContact O-CB 3.31Å; C41-K45 WeakPolarHBondContact O-CB 3.44Å; C41-K45 PolarHBondContact O-N 2.87Å; K45-Q47 PolarHBondContact O-N 2.98Å; K45-D48 PolarHBondContact O-N 3.34Å; K45-V51 HydrophobicContact CD-CG1 4.35Å; K45-V51 HydrophobicContact CG-CG1 3.74Å; K45-T52 VanDerWaalsContact O-CG2 3.24Å; K45-T52 WeakPolarHBondContact O-CG2 3.31Å
46	A	93.1	Very high	94.3	Very high	83 Å²	83	96.4 Å²	96.4	69%	0.686	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-67.8	-18.5	-178.1	0	0	0	0	0	114.2	N44	N44-A46 PolarHBondContact O-N 3.43Å; N44-A46 VanDerWaalsContact O-N 3.12Å
47	Q	92.8	Very high	93.7	Very high	156 Å²	156	97.4 Å²	97.4	73%	0.729	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	-97.5	-14.1	178.2	-60.5	178.6	31	0	0	112.2	N44 K45 V49	N44-Q47 PolarHBondContact O-N 3.18Å; K45-Q47 PolarHBondContact O-N 2.98Å; Q47-V49 PolarHBondContact O-N 3.38Å
48	D	95.1	Very high	93.1	Very high	70 Å²	70	98.9 Å²	98.9	37%	0.374	54%	0.54	S	S	.	.			trans	-80.8	98.6	177.7	-170.2	-17.9	0	0	0	109.9	N44 K45 L50 V51 T52	N44-D48 PolarHBondContact O-N 3.45Å; K45-D48 PolarHBondContact O-N 3.34Å; D48-L50 PolarHBondContact O-N 2.99Å; D48-L50 VanDerWaalsContact O-N 3.13Å; D48-L50 VanDerWaalsContact OD1-CB 3.32Å; D48-L50 WeakPolarHBondContact OD1-CB 3.5Å; D48-L50 PolarHBondContact OD1-N 2.99Å; D48-V51 HydrophobicContact CB-CB 4.15Å; D48-V51 HydrophobicContact CB-CG2 4.04Å; D48-V51 PolarHBondContact O-N 2.85Å; D48-V51 WeakPolarHBondContact OD2-CG2 3.43Å; D48-T52 PolarHBondContact O-N 3.18Å; D48-T52 PolarHBondContact O-OG1 3.33Å
49	V	93	Very high	92.8	Very high	74 Å²	74	96 Å²	96	45%	0.448	53%	0.526	S	S	.	.	H	α-helix	trans	-57.7	-24.3	178.4	-64	0	0	0	0	113.4	Q47 V51 G53 I54	Q47-V49 PolarHBondContact O-N 3.38Å; V49-V51 VanDerWaalsContact C-N 3.33Å; V49-G53 CarbonylContact O-C 3.56Å; V49-G53 VanDerWaalsContact O-CA 3.24Å; V49-G53 WeakPolarHBondContact O-CA 3.5Å; V49-G53 PolarHBondContact O-N 3.35Å; V49-G53 VanDerWaalsContact O-N 3.08Å; V49-I54 HydrophobicContact CB-CG2 3.61Å; V49-I54 HydrophobicContact CG1-CG2 3.47Å; V49-I54 VanDerWaalsContact CG1-CG2 3.47Å
50	L	93.3	Very high	92.3	Very high	162 Å²	162	98.1 Å²	98.1	85%	0.848	54%	0.544	S	S	*	.	H	α-helix	trans	-78.3	-21.8	176.9	-57.5	178.9	0	0	0	111.9	D48	D48-L50 PolarHBondContact O-N 2.99Å; D48-L50 VanDerWaalsContact O-N 3.13Å; D48-L50 VanDerWaalsContact OD1-CB 3.32Å; D48-L50 WeakPolarHBondContact OD1-CB 3.5Å; D48-L50 PolarHBondContact OD1-N 2.99Å
51	V	94	Very high	91.9	Very high	82 Å²	82	99.4 Å²	99.4	50%	0.497	55%	0.553	S	S	.	*	H	α-helix	trans	-96.8	-43.9	177.7	-178.6	0	0	0	0	111.8	K45 D48 V49	K45-V51 HydrophobicContact CD-CG1 4.35Å; K45-V51 HydrophobicContact CG-CG1 3.74Å; D48-V51 HydrophobicContact CB-CB 4.15Å; D48-V51 HydrophobicContact CB-CG2 4.04Å; D48-V51 PolarHBondContact O-N 2.85Å; D48-V51 WeakPolarHBondContact OD2-CG2 3.43Å; V49-V51 VanDerWaalsContact C-N 3.33Å
52	T	92.7	Very high	91.2	Very high	79 Å²	79	99.4 Å²	99.4	49%	0.485	55%	0.545	S	S	.	.	H	α-helix	trans	-78.2	-23.3	179.2	60.5	0	0	0	0	113.2	K45 D48	K45-T52 VanDerWaalsContact O-CG2 3.24Å; K45-T52 WeakPolarHBondContact O-CG2 3.31Å; D48-T52 PolarHBondContact O-N 3.18Å; D48-T52 PolarHBondContact O-OG1 3.33Å
53	G	90.4	Very high	90.4	Very high	44 Å²	44	101.9 Å²	101.9	45%	0.454	56%	0.557	S	S	.	*			trans	73.4	161.6	-162.3	0	0	0	0	0	111.9	V49	V49-G53 CarbonylContact O-C 3.56Å; V49-G53 VanDerWaalsContact O-CA 3.24Å; V49-G53 WeakPolarHBondContact O-CA 3.5Å; V49-G53 PolarHBondContact O-N 3.35Å; V49-G53 VanDerWaalsContact O-N 3.08Å
54	I	89.9	Confident	89.4	Confident	71 Å²	71	104 Å²	104	36%	0.364	57%	0.566	S	S	.	*			trans	-134.6	151.4	172.7	54	174.9	0	0	0	108.6	V49 H58 N59	V49-I54 HydrophobicContact CB-CG2 3.61Å; V49-I54 HydrophobicContact CG1-CG2 3.47Å; V49-I54 VanDerWaalsContact CG1-CG2 3.47Å; I54-H58 HydrophobicContact CB-CB 4.41Å; I54-N59 HydrophobicContact CD1-CB 3.83Å; I54-N59 HydrophobicContact CG1-CB 4.35Å
55	A	87	Confident	88.2	Confident	58 Å²	58	110.2 Å²	110.2	48%	0.479	59%	0.59	S	S	.	*			trans	-63.3	145.5	170.7	0	0	0	0	0	109.7	S57 H58 N59	A55-S57 PolarHBondContact O-N 3.47Å; A55-H58 PolarHBondContact O-N 2.96Å; A55-N59 PolarHBondContact O-N 3.4Å
56	D	84	Confident	87	Confident	106 Å²	106	110.9 Å²	110.9	57%	0.567	61%	0.607	S	S	*	*	G	3₁₀ helix	trans	-55.2	-34.3	-176.6	-58.3	-26.2	0	0	0	112.5	H58 N59 Q62	D56-H58 PolarHBondContact O-N 3.04Å; D56-N59 WeakPolarHBondContact O-CB 3.41Å; D56-N59 PolarHBondContact O-N 3.33Å; D56-Q62 HydrophobicContact CB-CG 3.95Å; D56-Q62 WeakPolarHBondContact O-CB 3.24Å; D56-Q62 PolarHBondContact O-OE1 3.28Å
57	S	85.4	Confident	85.7	Confident	95 Å²	95	112.6 Å²	112.6	66%	0.664	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-60.3	-25.8	176.8	61.6	0	0	0	0	114.3	A55	A55-S57 PolarHBondContact O-N 3.47Å
58	H	86.5	Confident	84.6	Confident	140 Å²	140	109.7 Å²	109.7	65%	0.648	61%	0.61	S	S	*	*	G	3₁₀ helix	trans	-92.7	-10.5	175.7	-63.3	108.9	0	0	0	112.3	I54 A55 D56 P60	I54-H58 HydrophobicContact CB-CB 4.41Å; A55-H58 PolarHBondContact O-N 2.96Å; D56-H58 PolarHBondContact O-N 3.04Å; H58-P60 VanDerWaalsContact O-CD 3.22Å; H58-P60 WeakPolarHBondContact O-CD 3.24Å
59	N	89.8	Confident	83.2	Confident	55 Å²	55	114.1 Å²	114.1	29%	0.294	63%	0.632	S	S	.	*			trans	-80.5	111.2	177	-178.6	3.3	0	0	0	109.5	I54 A55 D56 F61 Q62	I54-N59 HydrophobicContact CD1-CB 3.83Å; I54-N59 HydrophobicContact CG1-CB 4.35Å; A55-N59 PolarHBondContact O-N 3.4Å; D56-N59 WeakPolarHBondContact O-CB 3.41Å; D56-N59 PolarHBondContact O-N 3.33Å; N59-F61 PolarHBondContact O-N 2.85Å; N59-F61 WeakPolarHBondContact OD1-CB 3.31Å; N59-F61 WeakPolarHBondContact OD1-CD2 3.22Å; N59-F61 PolarHBondContact OD1-N 3.4Å; N59-Q62 HydrophobicContact CB-CB 4.38Å; N59-Q62 WeakPolarHBondContact O-CB 3.17Å; N59-Q62 PolarHBondContact O-N 2.86Å
60	P	88.9	Confident	81.9	Confident	116 Å²	116	121.5 Å²	121.5	75%	0.753	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	-16.9	178.9	-19.3	34.1	0	0	0	113.3	H58	H58-P60 VanDerWaalsContact O-CD 3.22Å; H58-P60 WeakPolarHBondContact O-CD 3.24Å
61	F	89.5	Confident	81.4	Confident	179 Å²	179	119.5 Å²	119.5	79%	0.785	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.8	6.7	178.7	-52.7	-77.8	0	0	0	113	N59 E63	N59-F61 PolarHBondContact O-N 2.85Å; N59-F61 WeakPolarHBondContact OD1-CB 3.31Å; N59-F61 WeakPolarHBondContact OD1-CD2 3.22Å; N59-F61 PolarHBondContact OD1-N 3.4Å; F61-E63 PolarHBondContact O-N 3.18Å
62	Q	82.8	Confident	80.7	Confident	79 Å²	79	121.5 Å²	121.5	37%	0.369	67%	0.667	S	S	.	*	P	Polyproline II helix	trans	-60.5	128.2	173.2	-172.1	-174	16	0	0	109.7	D56 N59 K64	D56-Q62 HydrophobicContact CB-CG 3.95Å; D56-Q62 WeakPolarHBondContact O-CB 3.24Å; D56-Q62 PolarHBondContact O-OE1 3.28Å; N59-Q62 HydrophobicContact CB-CB 4.38Å; N59-Q62 WeakPolarHBondContact O-CB 3.17Å; N59-Q62 PolarHBondContact O-N 2.86Å; Q62-K64 PolarHBondContact O-N 2.89Å
63	E	80.9	Confident	80	Confident	177 Å²	177	123.8 Å²	123.8	83%	0.827	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-58.9	124.4	172.4	-68.4	-174.4	-178.4	0	0	109.8	F61 K65	F61-E63 PolarHBondContact O-N 3.18Å; E63-K65 PolarHBondContact O-N 3.13Å; E63-K65 VanDerWaalsContact O-N 3.14Å
64	K	76.6	Confident	79.4	Confident	201 Å²	201	128.5 Å²	128.5	87%	0.874	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-64.1	118.2	174	-65.7	-176.7	-178.6	179.6	0	107.6	Q62 S66	Q62-K64 PolarHBondContact O-N 2.89Å; K64-S66 PolarHBondContact O-N 2.91Å
65	K	71.2	Confident	78.8	Confident	188 Å²	188	132.1 Å²	132.1	82%	0.817	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-54.5	117.3	168.1	-66.4	-173	180	-177.7	0	107.4	E63 C67	E63-K65 PolarHBondContact O-N 3.13Å; E63-K65 VanDerWaalsContact O-N 3.14Å; K65-C67 PolarHBondContact O-N 3.23Å; K65-C67 VanDerWaalsContact O-N 3.1Å
66	S	69.4	Low	78.2	Confident	113 Å²	113	137.1 Å²	137.1	79%	0.79	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-58.8	116.9	170.5	45.4	0	0	0	0	107.2	K64 S68	K64-S66 PolarHBondContact O-N 2.91Å; S66-S68 PolarHBondContact O-N 2.94Å
67	C	66.2	Low	77.8	Confident	119 Å²	119	139.3 Å²	139.3	80%	0.804	74%	0.738	S	S	*	*			trans	-76.4	104.3	171.3	-166	0	0	0	0	106.6	K65 I69	K65-C67 PolarHBondContact O-N 3.23Å; K65-C67 VanDerWaalsContact O-N 3.1Å; C67-I69 PolarHBondContact O-N 3.06Å
68	S	69.7	Low	77.2	Confident	96 Å²	96	142.7 Å²	142.7	67%	0.671	74%	0.744	S	S	*	*			trans	-74	111.2	163.3	43.6	0	0	0	0	107.9	S66 L70	S66-S68 PolarHBondContact O-N 2.94Å; S68-L70 PolarHBondContact O-N 3.08Å
69	I	67.1	Low	76.4	Confident	162 Å²	162	142.9 Å²	142.9	83%	0.831	75%	0.752	S	S	*	*			trans	-74	110.8	163.6	-55.4	173.6	0	0	0	105.6	C67	C67-I69 PolarHBondContact O-N 3.06Å
70	L	65.1	Low	75.2	Confident	230 Å²	230	150.9 Å²	150.9	100%	1.204	79%	0.793	S	S	*	*			trans	-100.9	0	164.3	-83.1	162.8	0	0	0	108.3	S68	S68-L70 PolarHBondContact O-N 3.08Å

Retrieved 70 of 70 residues in 70.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).