A0A077ZIN9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZIN9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 79 aa.

						>A0A077ZIN9_TRITR|A0A077ZIN9
MTLQEELLDSQSNVELKARLSQGYQQFWLQKEVPESLVTKKRSQLQVVRRGDLLLRVTSIENNIGRLVRPHLGEPSSSR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.2	Low	80.8	Confident	198 Å²	198	117.1 Å²	117.1	98%	0.975	60%	0.6	S	S	*	*				0	119	0	-95.3	170.5	179.8	0	0	108.7	E5	M1-E5 WeakPolarHBondContact CA-OE2 3.26Å
2	T	84.4	Confident	80.5	Confident	71 Å²	71	113.6 Å²	113.6	44%	0.436	59%	0.593	S	S	.	*			trans	-89	153.8	170.1	62.3	0	0	0	0	109.5	Q4 E5 E6	T2-Q4 PolarHBondContact O-N 2.98Å; T2-E5 PolarHBondContact N-OE2 2.94Å; T2-E5 WeakPolarHBondContact O-CB 3.08Å; T2-E5 PolarHBondContact O-N 3.13Å; T2-E5 PolarHBondContact OG1-N 3.4Å; T2-E6 PolarHBondContact O-N 3.48Å
3	L	84.8	Confident	80.7	Confident	144 Å²	144	109.5 Å²	109.5	75%	0.754	57%	0.573	S	S	*	*	H	α-helix	trans	-54.4	-25.8	173.2	-72.4	170.5	0	0	0	112.5	L7	L3-L7 WeakPolarHBondContact O-CB 3.45Å; L3-L7 PolarHBondContact O-N 3.31Å; L3-L7 VanDerWaalsContact O-N 3.14Å
4	Q	82.9	Confident	80.8	Confident	163 Å²	163	109.9 Å²	109.9	76%	0.762	58%	0.582	S	S	*	*	H	α-helix	trans	-68.3	-40	174.7	-71.8	178.3	-22.4	0	0	112.5	T2 L7 L8	T2-Q4 PolarHBondContact O-N 2.98Å; Q4-L7 PolarHBondContact O-N 3.36Å; Q4-L8 WeakPolarHBondContact O-CB 3.13Å; Q4-L8 PolarHBondContact O-N 3.48Å
5	E	85.1	Confident	80.8	Confident	104 Å²	104	111 Å²	111	49%	0.486	58%	0.582	S	S	.	*	H	α-helix	trans	-67.4	-42.3	177.2	-70.6	169.4	155.5	0	0	111.4	M1 T2 L7 L8 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.26Å; T2-E5 PolarHBondContact N-OE2 2.94Å; T2-E5 WeakPolarHBondContact O-CB 3.08Å; T2-E5 PolarHBondContact O-N 3.13Å; T2-E5 PolarHBondContact OG1-N 3.4Å; E5-L7 VanDerWaalsContact C-N 3.32Å; E5-L7 PolarHBondContact O-N 2.93Å; E5-L8 PolarHBondContact O-N 2.88Å; E5-D9 PolarHBondContact O-N 3.5Å
6	E	83.4	Confident	80.9	Confident	100 Å²	100	108.4 Å²	108.4	47%	0.467	57%	0.568	S	S	.	*	H	α-helix	trans	-62.8	-38.9	176.3	-69.8	-178.5	-171	0	0	112.3	T2 S10	T2-E6 PolarHBondContact O-N 3.48Å; E6-S10 VanDerWaalsContact O-CB 3.27Å; E6-S10 WeakPolarHBondContact O-CB 3.27Å; E6-S10 PolarHBondContact O-N 2.85Å; E6-S10 PolarHBondContact O-OG 3.49Å
7	L	84.2	Confident	81	Confident	108 Å²	108	109.4 Å²	109.4	57%	0.565	57%	0.567	S	S	*	*	H	α-helix	trans	-66.3	-40.7	176	-175.1	65.1	0	0	0	111.3	L3 Q4 E5 S10 Q11	L3-L7 WeakPolarHBondContact O-CB 3.45Å; L3-L7 PolarHBondContact O-N 3.31Å; L3-L7 VanDerWaalsContact O-N 3.14Å; Q4-L7 PolarHBondContact O-N 3.36Å; E5-L7 VanDerWaalsContact C-N 3.32Å; E5-L7 PolarHBondContact O-N 2.93Å; L7-S10 PolarHBondContact O-N 3.45Å; L7-Q11 WeakPolarHBondContact O-CB 3.45Å; L7-Q11 WeakPolarHBondContact O-CG 3.43Å; L7-Q11 PolarHBondContact O-N 3.16Å
8	L	84.7	Confident	81.2	Confident	117 Å²	117	106.1 Å²	106.1	61%	0.613	56%	0.559	S	S	*	*	H	α-helix	trans	-66.5	-45.5	179.1	-169.6	67.1	0	0	0	111.3	Q4 E5 S10 Q11 S12	Q4-L8 WeakPolarHBondContact O-CB 3.13Å; Q4-L8 PolarHBondContact O-N 3.48Å; E5-L8 PolarHBondContact O-N 2.88Å; L8-S10 VanDerWaalsContact C-N 3.33Å; L8-S10 PolarHBondContact O-N 2.91Å; L8-Q11 WeakPolarHBondContact O-CB 3.42Å; L8-Q11 PolarHBondContact O-N 3.37Å; L8-Q11 VanDerWaalsContact O-N 3.11Å; L8-S12 PolarHBondContact O-N 3.37Å; L8-S12 PolarHBondContact O-OG 3.41Å
9	D	81.6	Confident	81.5	Confident	115 Å²	115	108.9 Å²	108.9	62%	0.615	56%	0.561	S	S	*	*	H	α-helix	trans	-61.5	-42.6	176.8	-168.5	58.4	0	0	0	111.6	E5 Q11 S12 N13	E5-D9 PolarHBondContact O-N 3.5Å; D9-Q11 VanDerWaalsContact C-N 3.3Å; D9-Q11 PolarHBondContact O-N 2.91Å; D9-S12 WeakPolarHBondContact CA-OG 3.43Å; D9-S12 PolarHBondContact O-N 2.86Å; D9-S12 PolarHBondContact O-OG 2.84Å; D9-N13 PolarHBondContact O-N 3.39Å; D9-N13 VanDerWaalsContact O-N 3.12Å
10	S	77.3	Confident	81.6	Confident	60 Å²	60	110 Å²	110	42%	0.42	57%	0.567	S	S	.	*	H	α-helix	trans	-62.4	-35.1	174	-62.4	0	0	0	0	112.7	E6 L7 L8 N13	E6-S10 VanDerWaalsContact O-CB 3.27Å; E6-S10 WeakPolarHBondContact O-CB 3.27Å; E6-S10 PolarHBondContact O-N 2.85Å; E6-S10 PolarHBondContact O-OG 3.49Å; L7-S10 PolarHBondContact O-N 3.45Å; L8-S10 VanDerWaalsContact C-N 3.33Å; L8-S10 PolarHBondContact O-N 2.91Å; S10-N13 PolarHBondContact O-N 2.82Å
11	Q	74.9	Confident	81.7	Confident	108 Å²	108	107.5 Å²	107.5	51%	0.505	56%	0.559	S	S	.	*	H	α-helix	trans	-72.5	-30.8	176	-80.2	-173.9	-15.7	0	0	113.1	L7 L8 D9 N13 K17	L7-Q11 WeakPolarHBondContact O-CB 3.45Å; L7-Q11 WeakPolarHBondContact O-CG 3.43Å; L7-Q11 PolarHBondContact O-N 3.16Å; L8-Q11 WeakPolarHBondContact O-CB 3.42Å; L8-Q11 PolarHBondContact O-N 3.37Å; L8-Q11 VanDerWaalsContact O-N 3.11Å; D9-Q11 VanDerWaalsContact C-N 3.3Å; D9-Q11 PolarHBondContact O-N 2.91Å; Q11-N13 VanDerWaalsContact C-N 3.31Å; Q11-K17 WeakPolarHBondContact O-CE 3.29Å; Q11-K17 PolarHBondContact O-NZ 2.87Å
12	S	77.2	Confident	82.6	Confident	75 Å²	75	103 Å²	103	52%	0.524	54%	0.536	S	S	.	.	H	α-helix	trans	-77.9	-15.3	173.9	44.8	0	0	0	0	113.6	L8 D9 V14	L8-S12 PolarHBondContact O-N 3.37Å; L8-S12 PolarHBondContact O-OG 3.41Å; D9-S12 WeakPolarHBondContact CA-OG 3.43Å; D9-S12 PolarHBondContact O-N 2.86Å; D9-S12 PolarHBondContact O-OG 2.84Å; S12-V14 PolarHBondContact O-N 2.86Å
13	N	83.5	Confident	82.7	Confident	61 Å²	61	101.3 Å²	101.3	33%	0.326	53%	0.532	S	S	.	.			trans	-69.1	99.1	179.5	-168.5	-41.3	0	0	0	111.3	D9 S10 Q11 E15 L16 K17	D9-N13 PolarHBondContact O-N 3.39Å; D9-N13 VanDerWaalsContact O-N 3.12Å; S10-N13 PolarHBondContact O-N 2.82Å; Q11-N13 VanDerWaalsContact C-N 3.31Å; N13-E15 VanDerWaalsContact C-N 3.28Å; N13-E15 PolarHBondContact O-N 3.47Å; N13-E15 WeakPolarHBondContact OD1-CB 3.38Å; N13-E15 PolarHBondContact OD1-N 3.14Å; N13-E15 VanDerWaalsContact OD1-N 3.13Å; N13-L16 HydrophobicContact CB-CB 4.02Å; N13-L16 HydrophobicContact CB-CD1 3.81Å; N13-L16 HydrophobicContact CB-CG 3.96Å; N13-L16 VanDerWaalsContact CG-CG 3.48Å; N13-L16 PolarHBondContact O-N 3.42Å; N13-L16 PolarHBondContact OD1-N 3.45Å; N13-K17 PolarHBondContact O-N 2.94Å; N13-K17 VanDerWaalsContact O-N 3.08Å
14	V	81.7	Confident	82.5	Confident	115 Å²	115	101.6 Å²	101.6	70%	0.697	52%	0.524	S	S	*	.	H	α-helix	trans	-61.1	-37.1	-179.4	178.6	0	0	0	0	111.6	S12 K17 A18	S12-V14 PolarHBondContact O-N 2.86Å; V14-K17 PolarHBondContact O-N 3.23Å; V14-A18 WeakPolarHBondContact O-CB 3.47Å; V14-A18 PolarHBondContact O-N 2.82Å
15	E	81.8	Confident	82.4	Confident	126 Å²	126	99.4 Å²	99.4	59%	0.589	51%	0.514	S	S	*	.	H	α-helix	trans	-65.5	-43.5	178.5	-167.1	-170	150	0	0	111	N13 K17 A18 R19	N13-E15 VanDerWaalsContact C-N 3.28Å; N13-E15 PolarHBondContact O-N 3.47Å; N13-E15 WeakPolarHBondContact OD1-CB 3.38Å; N13-E15 PolarHBondContact OD1-N 3.14Å; N13-E15 VanDerWaalsContact OD1-N 3.13Å; E15-K17 PolarHBondContact O-N 3.41Å; E15-A18 PolarHBondContact O-N 3.39Å; E15-R19 WeakPolarHBondContact O-CB 3.28Å; E15-R19 VanDerWaalsContact O-CG 3.27Å; E15-R19 WeakPolarHBondContact O-CG 3.08Å; E15-R19 PolarHBondContact O-N 3.43Å
16	L	81.3	Confident	82.3	Confident	69 Å²	69	99.9 Å²	99.9	36%	0.361	52%	0.516	S	S	.	.	H	α-helix	trans	-62	-43.6	175.2	-71.3	-179.4	0	0	0	111.5	N13 A18 R19 L20	N13-L16 HydrophobicContact CB-CB 4.02Å; N13-L16 HydrophobicContact CB-CD1 3.81Å; N13-L16 HydrophobicContact CB-CG 3.96Å; N13-L16 VanDerWaalsContact CG-CG 3.48Å; N13-L16 PolarHBondContact O-N 3.42Å; N13-L16 PolarHBondContact OD1-N 3.45Å; L16-A18 PolarHBondContact O-N 3.07Å; L16-R19 PolarHBondContact O-N 3.12Å; L16-L20 WeakPolarHBondContact O-CB 3.38Å; L16-L20 VanDerWaalsContact O-CG 3.26Å; L16-L20 WeakPolarHBondContact O-CG 3.42Å; L16-L20 PolarHBondContact O-N 3.37Å
17	K	83.4	Confident	82.2	Confident	126 Å²	126	100.4 Å²	100.4	55%	0.548	52%	0.517	S	S	.	.	H	α-helix	trans	-59.4	-46.7	175.3	-82.4	-179.8	168.6	159.9	0	112	Q11 N13 V14 E15 R19 L20 S21	Q11-K17 WeakPolarHBondContact O-CE 3.29Å; Q11-K17 PolarHBondContact O-NZ 2.87Å; N13-K17 PolarHBondContact O-N 2.94Å; N13-K17 VanDerWaalsContact O-N 3.08Å; V14-K17 PolarHBondContact O-N 3.23Å; E15-K17 PolarHBondContact O-N 3.41Å; K17-R19 PolarHBondContact O-N 3.19Å; K17-L20 PolarHBondContact O-N 3.08Å; K17-S21 WeakPolarHBondContact O-CB 3.36Å; K17-S21 PolarHBondContact O-N 3.28Å; K17-S21 PolarHBondContact O-OG 2.88Å
18	A	83.8	Confident	81.8	Confident	50 Å²	50	103 Å²	103	41%	0.413	52%	0.52	S	S	.	.	H	α-helix	trans	-62.7	-42.9	179.2	0	0	0	0	0	112	V14 E15 L16 S21 Q22	V14-A18 WeakPolarHBondContact O-CB 3.47Å; V14-A18 PolarHBondContact O-N 2.82Å; E15-A18 PolarHBondContact O-N 3.39Å; L16-A18 PolarHBondContact O-N 3.07Å; A18-S21 WeakPolarHBondContact CA-OG 3.5Å; A18-S21 PolarHBondContact O-N 2.94Å; A18-S21 PolarHBondContact O-OG 3.22Å; A18-Q22 VanDerWaalsContact O-CB 3.29Å; A18-Q22 WeakPolarHBondContact O-CB 3.36Å; A18-Q22 PolarHBondContact O-N 2.81Å
19	R	86.7	Confident	81.3	Confident	160 Å²	160	104 Å²	104	60%	0.604	53%	0.525	S	S	*	.	H	α-helix	trans	-66.4	-41.4	177.3	-71.4	177.4	66	-179.9	-1.1	112.2	E15 L16 K17 Q22 G23	E15-R19 WeakPolarHBondContact O-CB 3.28Å; E15-R19 VanDerWaalsContact O-CG 3.27Å; E15-R19 WeakPolarHBondContact O-CG 3.08Å; E15-R19 PolarHBondContact O-N 3.43Å; L16-R19 PolarHBondContact O-N 3.12Å; K17-R19 PolarHBondContact O-N 3.19Å; R19-Q22 PolarHBondContact O-N 3.01Å; R19-G23 PolarHBondContact O-N 2.79Å
20	L	83.8	Confident	80.8	Confident	129 Å²	129	103.6 Å²	103.6	68%	0.675	52%	0.519	S	S	*	.	H	α-helix	trans	-66.1	-42.5	175.8	-73.2	173.3	0	0	0	111.5	L16 K17 G23 Y24	L16-L20 WeakPolarHBondContact O-CB 3.38Å; L16-L20 VanDerWaalsContact O-CG 3.26Å; L16-L20 WeakPolarHBondContact O-CG 3.42Å; L16-L20 PolarHBondContact O-N 3.37Å; K17-L20 PolarHBondContact O-N 3.08Å; L20-G23 PolarHBondContact O-N 3.35Å; L20-Y24 VanDerWaalsContact O-CB 3.28Å; L20-Y24 WeakPolarHBondContact O-CB 3.26Å; L20-Y24 PolarHBondContact O-N 3.16Å
21	S	83.6	Confident	80.2	Confident	59 Å²	59	110.7 Å²	110.7	41%	0.413	54%	0.542	S	S	.	.	H	α-helix	trans	-64.6	-42	176.4	60.2	0	0	0	0	111.6	K17 A18 Y24 Q25	K17-S21 WeakPolarHBondContact O-CB 3.36Å; K17-S21 PolarHBondContact O-N 3.28Å; K17-S21 PolarHBondContact O-OG 2.88Å; A18-S21 WeakPolarHBondContact CA-OG 3.5Å; A18-S21 PolarHBondContact O-N 2.94Å; A18-S21 PolarHBondContact O-OG 3.22Å; S21-Y24 PolarHBondContact O-N 2.94Å; S21-Q25 WeakPolarHBondContact O-CB 3.35Å; S21-Q25 VanDerWaalsContact O-CG 3.26Å; S21-Q25 WeakPolarHBondContact O-CG 3.46Å; S21-Q25 PolarHBondContact O-N 3.46Å
22	Q	85.8	Confident	79.8	Confident	104 Å²	104	113.5 Å²	113.5	49%	0.486	56%	0.556	S	S	.	*	H	α-helix	trans	-63.1	-45.5	175.8	-176.3	-179.1	6	0	0	111.2	A18 R19 Q25 Q26	A18-Q22 VanDerWaalsContact O-CB 3.29Å; A18-Q22 WeakPolarHBondContact O-CB 3.36Å; A18-Q22 PolarHBondContact O-N 2.81Å; R19-Q22 PolarHBondContact O-N 3.01Å; Q22-Q25 PolarHBondContact O-N 3.23Å; Q22-Q26 WeakPolarHBondContact O-CB 3.47Å; Q22-Q26 VanDerWaalsContact O-CG 3.28Å; Q22-Q26 WeakPolarHBondContact O-CG 3.28Å; Q22-Q26 PolarHBondContact O-N 3.37Å
23	G	85.2	Confident	79.3	Confident	34 Å²	34	113.7 Å²	113.7	35%	0.351	55%	0.553	S	S	.	*	H	α-helix	trans	-63.7	-41	177.2	0	0	0	0	0	112.6	R19 L20 Q26 F27	R19-G23 PolarHBondContact O-N 2.79Å; L20-G23 PolarHBondContact O-N 3.35Å; G23-Q26 PolarHBondContact O-N 3.04Å; G23-F27 VanDerWaalsContact O-CB 3.29Å; G23-F27 WeakPolarHBondContact O-CB 3.29Å; G23-F27 PolarHBondContact O-N 2.99Å
24	Y	80.3	Confident	78.6	Confident	151 Å²	151	113.7 Å²	113.7	59%	0.592	56%	0.557	S	S	*	*	H	α-helix	trans	-62.3	-49.7	174.2	-174.3	-93.3	0	0	0	110.6	L20 S21 Q26 F27 W28	L20-Y24 VanDerWaalsContact O-CB 3.28Å; L20-Y24 WeakPolarHBondContact O-CB 3.26Å; L20-Y24 PolarHBondContact O-N 3.16Å; S21-Y24 PolarHBondContact O-N 2.94Å; Y24-Q26 PolarHBondContact O-N 3.44Å; Y24-F27 PolarHBondContact O-N 3.49Å; Y24-W28 AromaticContact CD1-CD1 3.44Å; Y24-W28 VanDerWaalsContact CD1-CD1 3.44Å; Y24-W28 AromaticContact CD1-NE1 3.87Å; Y24-W28 AromaticContact CD2-CD1 3.69Å; Y24-W28 AromaticContact CD2-NE1 3.33Å; Y24-W28 VanDerWaalsContact CD2-NE1 3.33Å; Y24-W28 AromaticContact CE1-CD1 3.27Å; Y24-W28 HydrophobicContact CE1-CG 4.3Å; Y24-W28 AromaticContact CE1-NE1 3.47Å; Y24-W28 AromaticContact CE2-CD1 3.57Å; Y24-W28 AromaticContact CE2-CE2 3.92Å; Y24-W28 HydrophobicContact CE2-CZ2 4.44Å; Y24-W28 AromaticContact CE2-NE1 2.89Å; Y24-W28 AromaticContact CG-CD1 3.63Å; Y24-W28 AromaticContact CG-NE1 3.8Å; Y24-W28 AromaticContact CZ-CD1 3.34Å; Y24-W28 AromaticContact CZ-CE2 3.85Å; Y24-W28 AromaticContact CZ-NE1 2.95Å; Y24-W28 PolarHBondContact O-N 3.11Å; Y24-W28 PolarHBondContact OH-NE1 2.97Å
25	Q	81.7	Confident	77.8	Confident	116 Å²	116	115.9 Å²	115.9	54%	0.542	56%	0.559	S	S	.	*	H	α-helix	trans	-57.7	-47.2	175.5	-74.9	174	-43	0	0	111.4	S21 Q22 F27 W28 L29	S21-Q25 WeakPolarHBondContact O-CB 3.35Å; S21-Q25 VanDerWaalsContact O-CG 3.26Å; S21-Q25 WeakPolarHBondContact O-CG 3.46Å; S21-Q25 PolarHBondContact O-N 3.46Å; Q22-Q25 PolarHBondContact O-N 3.23Å; Q25-F27 PolarHBondContact O-N 2.8Å; Q25-W28 PolarHBondContact O-N 3.31Å; Q25-L29 HydrophobicContact CB-CD1 4.39Å; Q25-L29 WeakPolarHBondContact O-CB 3.35Å; Q25-L29 WeakPolarHBondContact O-CD1 3.46Å; Q25-L29 WeakPolarHBondContact O-CG 3.43Å; Q25-L29 PolarHBondContact O-N 3.08Å
26	Q	82	Confident	77.1	Confident	115 Å²	115	113 Å²	113	54%	0.537	55%	0.553	S	S	.	*	H	α-helix	trans	-60.7	-43.2	177.2	-76.2	177.7	-23.2	0	0	112.3	Q22 G23 Y24 L29 Q30	Q22-Q26 WeakPolarHBondContact O-CB 3.47Å; Q22-Q26 VanDerWaalsContact O-CG 3.28Å; Q22-Q26 WeakPolarHBondContact O-CG 3.28Å; Q22-Q26 PolarHBondContact O-N 3.37Å; G23-Q26 PolarHBondContact O-N 3.04Å; Y24-Q26 PolarHBondContact O-N 3.44Å; Q26-L29 PolarHBondContact O-N 2.95Å; Q26-Q30 WeakPolarHBondContact O-CG 3.5Å; Q26-Q30 PolarHBondContact O-N 2.78Å; Q26-Q30 VanDerWaalsContact O-N 3.14Å
27	F	81.2	Confident	76.3	Confident	110 Å²	110	114.9 Å²	114.9	48%	0.482	56%	0.563	S	S	.	*	H	α-helix	trans	-63.6	-43.9	178.4	179.5	-97.2	0	0	0	112.2	G23 Y24 Q25 Q30	G23-F27 VanDerWaalsContact O-CB 3.29Å; G23-F27 WeakPolarHBondContact O-CB 3.29Å; G23-F27 PolarHBondContact O-N 2.99Å; Y24-F27 PolarHBondContact O-N 3.49Å; Q25-F27 PolarHBondContact O-N 2.8Å; F27-Q30 WeakPolarHBondContact O-CB 3.27Å
28	W	75.6	Confident	75.3	Confident	164 Å²	164	112.1 Å²	112.1	62%	0.621	56%	0.556	S	S	*	*	H	α-helix	trans	-79.5	-23.3	178.8	-68	106.3	0	0	0	113.9	Y24 Q25 Q30	Y24-W28 AromaticContact CD1-CD1 3.44Å; Y24-W28 VanDerWaalsContact CD1-CD1 3.44Å; Y24-W28 AromaticContact CD1-NE1 3.87Å; Y24-W28 AromaticContact CD2-CD1 3.69Å; Y24-W28 AromaticContact CD2-NE1 3.33Å; Y24-W28 VanDerWaalsContact CD2-NE1 3.33Å; Y24-W28 AromaticContact CE1-CD1 3.27Å; Y24-W28 HydrophobicContact CE1-CG 4.3Å; Y24-W28 AromaticContact CE1-NE1 3.47Å; Y24-W28 AromaticContact CE2-CD1 3.57Å; Y24-W28 AromaticContact CE2-CE2 3.92Å; Y24-W28 HydrophobicContact CE2-CZ2 4.44Å; Y24-W28 AromaticContact CE2-NE1 2.89Å; Y24-W28 AromaticContact CG-CD1 3.63Å; Y24-W28 AromaticContact CG-NE1 3.8Å; Y24-W28 AromaticContact CZ-CD1 3.34Å; Y24-W28 AromaticContact CZ-CE2 3.85Å; Y24-W28 AromaticContact CZ-NE1 2.95Å; Y24-W28 PolarHBondContact O-N 3.11Å; Y24-W28 PolarHBondContact OH-NE1 2.97Å; Q25-W28 PolarHBondContact O-N 3.31Å; W28-Q30 VanDerWaalsContact C-N 3.31Å
29	L	75.6	Confident	73.9	Confident	137 Å²	137	113.6 Å²	113.6	72%	0.717	56%	0.56	S	S	*	*	H	α-helix	trans	-82.4	-6.3	173.6	-69.6	171.5	0	0	0	113	Q25 Q26 K31	Q25-L29 HydrophobicContact CB-CD1 4.39Å; Q25-L29 WeakPolarHBondContact O-CB 3.35Å; Q25-L29 WeakPolarHBondContact O-CD1 3.46Å; Q25-L29 WeakPolarHBondContact O-CG 3.43Å; Q25-L29 PolarHBondContact O-N 3.08Å; Q26-L29 PolarHBondContact O-N 2.95Å; L29-K31 PolarHBondContact O-N 2.83Å
30	Q	69.9	Low	72.6	Confident	107 Å²	107	113.8 Å²	113.8	50%	0.5	57%	0.566	S	S	.	*			trans	-62.5	106.6	168.4	-81.3	173	-10.6	0	0	108.7	Q26 F27 W28 E32	Q26-Q30 WeakPolarHBondContact O-CG 3.5Å; Q26-Q30 PolarHBondContact O-N 2.78Å; Q26-Q30 VanDerWaalsContact O-N 3.14Å; F27-Q30 WeakPolarHBondContact O-CB 3.27Å; W28-Q30 VanDerWaalsContact C-N 3.31Å; Q30-E32 PolarHBondContact O-N 2.68Å
31	K	65.7	Low	71.4	Confident	208 Å²	208	114.3 Å²	114.3	90%	0.904	56%	0.563	S	S	*	*	S	Bend	trans	-55.7	-23.7	179.8	-82.6	-167.3	173.6	-175.3	0	113.4	L29	L29-K31 PolarHBondContact O-N 2.83Å
32	E	67	Low	70	Confident	168 Å²	168	120.3 Å²	120.3	79%	0.785	58%	0.576	S	S	*	*			trans	-140.3	115.2	-179.9	-67.6	179.7	108.7	0	0	108.7	Q30 P34	Q30-E32 PolarHBondContact O-N 2.68Å; E32-P34 WeakPolarHBondContact O-CD 3.45Å
33	V	66.7	Low	68.6	Low	79 Å²	79	120.2 Å²	120.2	48%	0.479	59%	0.587	S	S	.	*			trans	-67.7	120	160.6	176.8	0	0	0	0	105.6	E35 L37 V38	V33-E35 PolarHBondContact O-N 2.91Å; V33-E35 VanDerWaalsContact O-N 3.16Å; V33-L37 HydrophobicContact CG1-CB 4.17Å; V33-L37 HydrophobicContact CG1-CD1 4.16Å; V33-V38 HydrophobicContact CG1-CG2 4.11Å
34	P	67.8	Low	67.5	Low	61 Å²	61	125.6 Å²	125.6	40%	0.396	60%	0.603	S	S	.	*			trans	-51.2	127.2	-179.5	-26.1	31.7	0	0	0	110.3	E32 S36 L37	E32-P34 WeakPolarHBondContact O-CD 3.45Å; P34-S36 WeakPolarHBondContact CB-OG 3.45Å; P34-S36 PolarHBondContact O-N 3.4Å; P34-L37 HydrophobicContact CB-CG 4.31Å; P34-L37 HydrophobicContact CG-CD1 4.29Å; P34-L37 HydrophobicContact CG-CG 4.5Å; P34-L37 WeakPolarHBondContact O-CB 2.92Å; P34-L37 PolarHBondContact O-N 3.47Å
35	E	65.3	Low	66.6	Low	161 Å²	161	124.7 Å²	124.7	75%	0.752	61%	0.607	S	S	*	*	H	α-helix	trans	-51.7	-29.5	178.2	-80.4	-172.5	156.1	0	0	111.9	V33 L37 V38 T39	V33-E35 PolarHBondContact O-N 2.91Å; V33-E35 VanDerWaalsContact O-N 3.16Å; E35-L37 VanDerWaalsContact C-N 3.26Å; E35-L37 PolarHBondContact O-N 3.14Å; E35-V38 PolarHBondContact O-N 3Å; E35-V38 VanDerWaalsContact O-N 3.08Å; E35-T39 WeakPolarHBondContact O-CB 3.36Å; E35-T39 WeakPolarHBondContact O-CG2 3.34Å; E35-T39 PolarHBondContact O-N 3.28Å; E35-T39 PolarHBondContact O-OG1 2.93Å
36	S	66.7	Low	65.6	Low	66 Å²	66	127.2 Å²	127.2	46%	0.462	62%	0.62	S	S	.	*	H	α-helix	trans	-56.8	-34	173.6	64	0	0	0	0	113.5	P34 T39 K40	P34-S36 WeakPolarHBondContact CB-OG 3.45Å; P34-S36 PolarHBondContact O-N 3.4Å; S36-T39 WeakPolarHBondContact CA-OG1 3.49Å; S36-K40 WeakPolarHBondContact O-CB 3.06Å; S36-K40 PolarHBondContact O-N 3.04Å
37	L	64.6	Low	64.7	Low	108 Å²	108	128.2 Å²	128.2	57%	0.565	63%	0.633	S	S	*	*	H	α-helix	trans	-72.8	-34.5	175.7	-61.4	-177.9	0	0	0	111.8	V33 P34 E35	V33-L37 HydrophobicContact CG1-CB 4.17Å; V33-L37 HydrophobicContact CG1-CD1 4.16Å; P34-L37 HydrophobicContact CB-CG 4.31Å; P34-L37 HydrophobicContact CG-CD1 4.29Å; P34-L37 HydrophobicContact CG-CG 4.5Å; P34-L37 WeakPolarHBondContact O-CB 2.92Å; P34-L37 PolarHBondContact O-N 3.47Å; E35-L37 VanDerWaalsContact C-N 3.26Å; E35-L37 PolarHBondContact O-N 3.14Å
38	V	62.6	Low	63.9	Low	67 Å²	67	125.3 Å²	125.3	41%	0.406	62%	0.624	S	S	.	*	H	α-helix	trans	-81	-28.1	-178.5	-143.3	0	0	0	0	111.9	V33 E35	V33-V38 HydrophobicContact CG1-CG2 4.11Å; E35-V38 PolarHBondContact O-N 3Å; E35-V38 VanDerWaalsContact O-N 3.08Å
39	T	54.9	Low	63.7	Low	81 Å²	81	125.6 Å²	125.6	50%	0.497	63%	0.625	S	S	.	*	H	α-helix	trans	-96.8	-32.4	-176.3	54.2	0	0	0	0	113.3	E35 S36 K41 R42	E35-T39 WeakPolarHBondContact O-CB 3.36Å; E35-T39 WeakPolarHBondContact O-CG2 3.34Å; E35-T39 PolarHBondContact O-N 3.28Å; E35-T39 PolarHBondContact O-OG1 2.93Å; S36-T39 WeakPolarHBondContact CA-OG1 3.49Å; T39-K41 VanDerWaalsContact C-N 3.28Å; T39-K41 PolarHBondContact O-N 3.41Å; T39-R42 PolarHBondContact O-N 3.27Å
40	K	58.8	Low	63.4	Low	165 Å²	165	129.9 Å²	129.9	72%	0.717	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.6	-15.3	-175.5	-169.6	165.3	178	173	0	114.6	S36	S36-K40 WeakPolarHBondContact O-CB 3.06Å; S36-K40 PolarHBondContact O-N 3.04Å
41	K	59.1	Low	63.6	Low	140 Å²	140	126.9 Å²	126.9	61%	0.609	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.8	-14.9	177.1	-80.1	-81.2	-176.4	175.8	0	114.3	T39 S43 Q44	T39-K41 VanDerWaalsContact C-N 3.28Å; T39-K41 PolarHBondContact O-N 3.41Å; K41-S43 VanDerWaalsContact C-N 3.27Å; K41-S43 PolarHBondContact O-N 3.32Å; K41-Q44 PolarHBondContact O-N 3.38Å
42	R	54.8	Low	64.2	Low	185 Å²	185	119.4 Å²	119.4	70%	0.698	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70	-21.8	178	-83	-178.1	174.4	170.3	0.5	113.5	T39	T39-R42 PolarHBondContact O-N 3.27Å
43	S	56.4	Low	64.7	Low	102 Å²	102	115.8 Å²	115.8	71%	0.713	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-18.2	175.4	58.1	0	0	0	0	114.3	K41	K41-S43 VanDerWaalsContact C-N 3.27Å; K41-S43 PolarHBondContact O-N 3.32Å
44	Q	61	Low	65.4	Low	147 Å²	147	117.5 Å²	117.5	69%	0.687	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.3	-22.1	179.2	-73	-142.2	19.6	0	0	113.7	K41 Q46	K41-Q44 PolarHBondContact O-N 3.38Å; Q44-Q46 PolarHBondContact O-N 3.5Å
45	L	60.5	Low	66	Low	131 Å²	131	120.6 Å²	120.6	69%	0.686	60%	0.604	S	S	*	*	S	Bend	trans	-91.5	103.3	171	-60	177.9	0	0	0	106.5	V47	L45-V47 PolarHBondContact O-N 2.76Å
46	Q	62.7	Low	66.8	Low	170 Å²	170	120.3 Å²	120.3	79%	0.794	60%	0.596	S	S	*	*			trans	-48.4	117.3	167.8	-71.4	179.6	12.5	0	0	107	Q44 V48	Q44-Q46 PolarHBondContact O-N 3.5Å; Q46-V48 WeakPolarHBondContact O-CG2 3.44Å; Q46-V48 PolarHBondContact O-N 2.96Å
47	V	61.4	Low	67.7	Low	135 Å²	135	120.1 Å²	120.1	82%	0.818	59%	0.591	S	S	*	*			trans	-67.1	90	173.7	178.2	0	0	0	0	105.8	L45 R49	L45-V47 PolarHBondContact O-N 2.76Å; V47-R49 PolarHBondContact O-N 3.18Å
48	V	64.9	Low	68.5	Low	49 Å²	49	118.8 Å²	118.8	30%	0.297	59%	0.588	S	S	.	*			trans	-62.7	116.3	175.2	179.1	0	0	0	0	105.6	Q46 D52 L53	Q46-V48 WeakPolarHBondContact O-CG2 3.44Å; Q46-V48 PolarHBondContact O-N 2.96Å; V48-D52 VanDerWaalsContact CG1-C 3.4Å; V48-D52 HydrophobicContact CG1-CB 3.39Å; V48-L53 HydrophobicContact CG1-CB 3.82Å
49	R	70.7	Confident	69.4	Low	171 Å²	171	118.7 Å²	118.7	65%	0.645	59%	0.59	S	S	*	*			trans	-56.8	146.3	175.2	-61.8	-178.4	-61.8	-93.4	-10.3	107.4	V47 G51 D52 L53	V47-R49 PolarHBondContact O-N 3.18Å; R49-G51 CarbonylContact O-C 3.59Å; R49-G51 PolarHBondContact O-N 3.41Å; R49-D52 WeakPolarHBondContact CB-OD2 3.33Å; R49-D52 IonicContact CZ-OD1 3.66Å; R49-D52 IonicContact CZ-OD2 3.16Å; R49-D52 PolarHBondContact N-OD2 3.44Å; R49-D52 IonicContact NE-OD1 3.73Å; R49-D52 IonicContact NE-OD2 3.3Å; R49-D52 PolarHBondContact NE-OD2 2.85Å; R49-D52 IonicContact NH1-OD2 3.9Å; R49-D52 VanDerWaalsContact NH2-CG 3.32Å; R49-D52 IonicContact NH2-OD1 2.88Å; R49-D52 PolarHBondContact NH2-OD1 3.46Å; R49-D52 IonicContact NH2-OD2 2.98Å; R49-D52 PolarHBondContact NH2-OD2 3.5Å; R49-D52 WeakPolarHBondContact O-CA 3.38Å; R49-D52 WeakPolarHBondContact O-CB 3.43Å; R49-D52 PolarHBondContact O-N 3.17Å; R49-L53 PolarHBondContact O-N 3.39Å; R49-L53 VanDerWaalsContact O-N 3.14Å
50	R	70.9	Confident	71	Confident	226 Å²	226	119.1 Å²	119.1	85%	0.853	59%	0.589	S	S	*	*	H	α-helix	trans	-47.8	-35.2	-176.4	-173.8	179	173.7	-167.7	-1.8	113.4	L53 L54	R50-L53 PolarHBondContact O-N 3.14Å; R50-L54 PolarHBondContact O-N 3.39Å
51	G	72.8	Confident	72.4	Confident	45 Å²	45	117 Å²	117	46%	0.464	58%	0.581	S	S	.	*	H	α-helix	trans	-69.4	-37.8	174.2	0	0	0	0	0	114.8	R49 L53 L54 L55	R49-G51 CarbonylContact O-C 3.59Å; R49-G51 PolarHBondContact O-N 3.41Å; G51-L53 PolarHBondContact O-N 2.77Å; G51-L54 PolarHBondContact O-N 2.88Å; G51-L55 PolarHBondContact O-N 3.36Å
52	D	79.2	Confident	73.7	Confident	50 Å²	50	115.3 Å²	115.3	27%	0.267	58%	0.579	S	S	.	*	H	α-helix	trans	-68.3	-28.2	176.7	-55.3	-22.7	0	0	0	110.9	V48 R49 R56	V48-D52 VanDerWaalsContact CG1-C 3.4Å; V48-D52 HydrophobicContact CG1-CB 3.39Å; R49-D52 WeakPolarHBondContact CB-OD2 3.33Å; R49-D52 IonicContact CZ-OD1 3.66Å; R49-D52 IonicContact CZ-OD2 3.16Å; R49-D52 PolarHBondContact N-OD2 3.44Å; R49-D52 IonicContact NE-OD1 3.73Å; R49-D52 IonicContact NE-OD2 3.3Å; R49-D52 PolarHBondContact NE-OD2 2.85Å; R49-D52 IonicContact NH1-OD2 3.9Å; R49-D52 VanDerWaalsContact NH2-CG 3.32Å; R49-D52 IonicContact NH2-OD1 2.88Å; R49-D52 PolarHBondContact NH2-OD1 3.46Å; R49-D52 IonicContact NH2-OD2 2.98Å; R49-D52 PolarHBondContact NH2-OD2 3.5Å; R49-D52 WeakPolarHBondContact O-CA 3.38Å; R49-D52 WeakPolarHBondContact O-CB 3.43Å; R49-D52 PolarHBondContact O-N 3.17Å; D52-R56 PolarHBondContact O-N 2.88Å
53	L	78	Confident	75.3	Confident	92 Å²	92	110.1 Å²	110.1	48%	0.482	57%	0.565	S	S	.	*	H	α-helix	trans	-70.2	-43.2	178.1	-176.3	63.1	0	0	0	110.9	V48 R49 R50 G51 L55 R56 V57	V48-L53 HydrophobicContact CG1-CB 3.82Å; R49-L53 PolarHBondContact O-N 3.39Å; R49-L53 VanDerWaalsContact O-N 3.14Å; R50-L53 PolarHBondContact O-N 3.14Å; G51-L53 PolarHBondContact O-N 2.77Å; L53-L55 VanDerWaalsContact C-N 3.33Å; L53-L55 PolarHBondContact O-N 2.93Å; L53-R56 WeakPolarHBondContact O-CB 3.32Å; L53-R56 PolarHBondContact O-N 3.35Å; L53-V57 HydrophobicContact CD1-CG2 4.46Å; L53-V57 HydrophobicContact CG-CG2 4.43Å; L53-V57 WeakPolarHBondContact O-CG2 3.46Å; L53-V57 PolarHBondContact O-N 3.15Å
54	L	79.9	Confident	76.6	Confident	115 Å²	115	109.7 Å²	109.7	60%	0.602	55%	0.554	S	S	*	*	H	α-helix	trans	-57.8	-46.7	174.6	-77.6	170.6	0	0	0	111	R50 G51 R56 V57 T58	R50-L54 PolarHBondContact O-N 3.39Å; G51-L54 PolarHBondContact O-N 2.88Å; L54-R56 VanDerWaalsContact C-N 3.3Å; L54-R56 PolarHBondContact O-N 2.98Å; L54-V57 PolarHBondContact O-N 3.33Å; L54-T58 PolarHBondContact O-N 2.91Å; L54-T58 PolarHBondContact O-OG1 3.08Å; L54-T58 VanDerWaalsContact O-OG1 3.12Å
55	L	80.2	Confident	77.8	Confident	126 Å²	126	104.1 Å²	104.1	66%	0.66	54%	0.536	S	S	*	.	H	α-helix	trans	-59.5	-40.6	176.5	-68.1	174.8	0	0	0	112.1	G51 L53 S59	G51-L55 PolarHBondContact O-N 3.36Å; L53-L55 VanDerWaalsContact C-N 3.33Å; L53-L55 PolarHBondContact O-N 2.93Å; L55-S59 WeakPolarHBondContact O-CB 3.45Å; L55-S59 PolarHBondContact O-N 3.18Å
56	R	83.5	Confident	79	Confident	156 Å²	156	106.1 Å²	106.1	59%	0.589	53%	0.534	S	S	*	.	H	α-helix	trans	-64.4	-44.6	174.6	-102.8	175.1	167	-106.7	0.2	112.5	D52 L53 L54 S59 I60	D52-R56 PolarHBondContact O-N 2.88Å; L53-R56 WeakPolarHBondContact O-CB 3.32Å; L53-R56 PolarHBondContact O-N 3.35Å; L54-R56 VanDerWaalsContact C-N 3.3Å; L54-R56 PolarHBondContact O-N 2.98Å; R56-S59 PolarHBondContact O-N 3.45Å; R56-I60 WeakPolarHBondContact O-CD1 3.46Å; R56-I60 VanDerWaalsContact O-CG1 3.25Å; R56-I60 WeakPolarHBondContact O-CG1 3.25Å; R56-I60 PolarHBondContact O-N 3.36Å
57	V	84	Confident	80.1	Confident	61 Å²	61	103.8 Å²	103.8	37%	0.37	53%	0.527	S	S	.	.	H	α-helix	trans	-62.4	-49.8	179	170.6	0	0	0	0	110.2	L53 L54 S59 I60 E61	L53-V57 HydrophobicContact CD1-CG2 4.46Å; L53-V57 HydrophobicContact CG-CG2 4.43Å; L53-V57 WeakPolarHBondContact O-CG2 3.46Å; L53-V57 PolarHBondContact O-N 3.15Å; L54-V57 PolarHBondContact O-N 3.33Å; V57-S59 VanDerWaalsContact C-N 3.3Å; V57-S59 PolarHBondContact O-N 3Å; V57-I60 WeakPolarHBondContact O-CB 3.47Å; V57-I60 PolarHBondContact O-N 3.06Å; V57-I60 VanDerWaalsContact O-N 3.08Å; V57-E61 HydrophobicContact CG1-CG 4.41Å; V57-E61 WeakPolarHBondContact O-CG 3.42Å; V57-E61 PolarHBondContact O-N 2.88Å
58	T	82.3	Confident	81.3	Confident	81 Å²	81	100.2 Å²	100.2	50%	0.497	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-38.4	177.5	-58	0	0	0	0	112.3	L54 E61 N62	L54-T58 PolarHBondContact O-N 2.91Å; L54-T58 PolarHBondContact O-OG1 3.08Å; L54-T58 VanDerWaalsContact O-OG1 3.12Å; T58-E61 PolarHBondContact O-N 3.35Å; T58-N62 WeakPolarHBondContact O-CB 3.34Å; T58-N62 PolarHBondContact O-N 2.94Å
59	S	82	Confident	81.9	Confident	64 Å²	64	107.3 Å²	107.3	45%	0.448	53%	0.526	S	S	.	.	H	α-helix	trans	-63.6	-41.9	174.6	179.7	0	0	0	0	112	L55 R56 V57 N62 N63	L55-S59 WeakPolarHBondContact O-CB 3.45Å; L55-S59 PolarHBondContact O-N 3.18Å; R56-S59 PolarHBondContact O-N 3.45Å; V57-S59 VanDerWaalsContact C-N 3.3Å; V57-S59 PolarHBondContact O-N 3Å; S59-N62 PolarHBondContact O-N 3.12Å; S59-N63 VanDerWaalsContact O-CG 3.23Å; S59-N63 PolarHBondContact O-N 3.23Å; S59-N63 PolarHBondContact O-ND2 2.92Å
60	I	88.4	Confident	82.4	Confident	91 Å²	91	103.8 Å²	103.8	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-64.3	-46.5	176.2	-69.1	163.6	0	0	0	110.6	R56 V57 N62 N63 I64	R56-I60 WeakPolarHBondContact O-CD1 3.46Å; R56-I60 VanDerWaalsContact O-CG1 3.25Å; R56-I60 WeakPolarHBondContact O-CG1 3.25Å; R56-I60 PolarHBondContact O-N 3.36Å; V57-I60 WeakPolarHBondContact O-CB 3.47Å; V57-I60 PolarHBondContact O-N 3.06Å; V57-I60 VanDerWaalsContact O-N 3.08Å; I60-N62 VanDerWaalsContact C-N 3.32Å; I60-N62 PolarHBondContact O-N 3.32Å; I60-N63 PolarHBondContact O-N 2.98Å; I60-N63 VanDerWaalsContact O-N 3.15Å; I60-I64 HydrophobicContact CG2-CD1 3.74Å; I60-I64 HydrophobicContact CG2-CG1 4.32Å; I60-I64 WeakPolarHBondContact O-CG1 3.49Å; I60-I64 PolarHBondContact O-N 3.3Å
61	E	87.5	Confident	82.7	Confident	120 Å²	120	100.5 Å²	100.5	56%	0.561	52%	0.519	S	S	*	.	H	α-helix	trans	-57.8	-43.8	177.5	-71.6	173.9	152.3	0	0	111.8	V57 T58 I64 G65	V57-E61 HydrophobicContact CG1-CG 4.41Å; V57-E61 WeakPolarHBondContact O-CG 3.42Å; V57-E61 PolarHBondContact O-N 2.88Å; T58-E61 PolarHBondContact O-N 3.35Å; E61-I64 PolarHBondContact O-N 2.91Å; E61-G65 PolarHBondContact O-N 2.88Å
62	N	86	Confident	82.4	Confident	104 Å²	104	104 Å²	104	56%	0.556	53%	0.527	S	S	*	.	H	α-helix	trans	-63	-44.3	176.1	-167.3	-40.1	0	0	0	111.4	T58 S59 I60 I64 G65 R66	T58-N62 WeakPolarHBondContact O-CB 3.34Å; T58-N62 PolarHBondContact O-N 2.94Å; S59-N62 PolarHBondContact O-N 3.12Å; I60-N62 VanDerWaalsContact C-N 3.32Å; I60-N62 PolarHBondContact O-N 3.32Å; N62-I64 PolarHBondContact O-N 3.48Å; N62-G65 PolarHBondContact O-N 3.11Å; N62-R66 WeakPolarHBondContact O-CG 3.33Å; N62-R66 PolarHBondContact O-N 3.31Å
63	N	88.8	Confident	81.7	Confident	76 Å²	76	104.8 Å²	104.8	41%	0.406	55%	0.547	S	S	.	.	H	α-helix	trans	-61.9	-43.3	177.2	-71.9	-25.4	0	0	0	112.1	S59 I60 G65 R66 L67	S59-N63 VanDerWaalsContact O-CG 3.23Å; S59-N63 PolarHBondContact O-N 3.23Å; S59-N63 PolarHBondContact O-ND2 2.92Å; I60-N63 PolarHBondContact O-N 2.98Å; I60-N63 VanDerWaalsContact O-N 3.15Å; N63-G65 VanDerWaalsContact C-N 3.34Å; N63-G65 PolarHBondContact O-N 2.99Å; N63-R66 PolarHBondContact O-N 3.23Å; N63-L67 WeakPolarHBondContact O-CG 3.21Å; N63-L67 PolarHBondContact O-N 3.49Å
64	I	84.5	Confident	80.9	Confident	93 Å²	93	108.8 Å²	108.8	48%	0.477	56%	0.563	S	S	.	*	H	α-helix	trans	-59.4	-47.5	174.3	-66.4	166.5	0	0	0	109.7	I60 E61 N62 R66 L67 V68	I60-I64 HydrophobicContact CG2-CD1 3.74Å; I60-I64 HydrophobicContact CG2-CG1 4.32Å; I60-I64 WeakPolarHBondContact O-CG1 3.49Å; I60-I64 PolarHBondContact O-N 3.3Å; E61-I64 PolarHBondContact O-N 2.91Å; N62-I64 PolarHBondContact O-N 3.48Å; I64-R66 VanDerWaalsContact C-N 3.29Å; I64-R66 PolarHBondContact O-N 2.93Å; I64-L67 PolarHBondContact O-N 3.21Å; I64-L67 VanDerWaalsContact O-N 3.11Å; I64-V68 HydrophobicContact CG2-CG2 4.01Å; I64-V68 WeakPolarHBondContact O-CB 3.27Å; I64-V68 VanDerWaalsContact O-CG2 3.27Å; I64-V68 WeakPolarHBondContact O-CG2 3.41Å; I64-V68 PolarHBondContact O-N 2.94Å
65	G	85.5	Confident	79.8	Confident	30 Å²	30	109 Å²	109	31%	0.309	57%	0.572	S	S	.	*	H	α-helix	trans	-57	-40.8	176.9	0	0	0	0	0	112.9	E61 N62 N63 V68 R69	E61-G65 PolarHBondContact O-N 2.88Å; N62-G65 PolarHBondContact O-N 3.11Å; N63-G65 VanDerWaalsContact C-N 3.34Å; N63-G65 PolarHBondContact O-N 2.99Å; G65-V68 PolarHBondContact O-N 3.47Å; G65-R69 VanDerWaalsContact O-CB 3.27Å; G65-R69 WeakPolarHBondContact O-CB 3.27Å; G65-R69 WeakPolarHBondContact O-CG 3.37Å; G65-R69 PolarHBondContact O-N 3.23Å
66	R	85.6	Confident	78.6	Confident	173 Å²	173	108.4 Å²	108.4	65%	0.653	58%	0.578	S	S	*	*	H	α-helix	trans	-68.3	-33.6	176.4	-69.8	-179.5	70.6	-158.8	1.9	113.4	N62 N63 I64 P70	N62-R66 WeakPolarHBondContact O-CG 3.33Å; N62-R66 PolarHBondContact O-N 3.31Å; N63-R66 PolarHBondContact O-N 3.23Å; I64-R66 VanDerWaalsContact C-N 3.29Å; I64-R66 PolarHBondContact O-N 2.93Å; R66-P70 WeakPolarHBondContact O-CD 3.46Å
67	L	86.2	Confident	77.7	Confident	122 Å²	122	106.6 Å²	106.6	64%	0.639	59%	0.589	S	S	*	*	H	α-helix	trans	-75.3	-35.1	176.8	-70.5	170.6	0	0	0	112.1	N63 I64 H71	N63-L67 WeakPolarHBondContact O-CG 3.21Å; N63-L67 PolarHBondContact O-N 3.49Å; I64-L67 PolarHBondContact O-N 3.21Å; I64-L67 VanDerWaalsContact O-N 3.11Å; L67-H71 PolarHBondContact O-CD2 3.01Å
68	V	85.5	Confident	76.4	Confident	59 Å²	59	109.1 Å²	109.1	36%	0.358	61%	0.609	S	S	.	*	H	α-helix	trans	-84.1	-32.4	-176.4	173.3	0	0	0	0	111.7	I64 G65 H71 L72	I64-V68 HydrophobicContact CG2-CG2 4.01Å; I64-V68 WeakPolarHBondContact O-CB 3.27Å; I64-V68 VanDerWaalsContact O-CG2 3.27Å; I64-V68 WeakPolarHBondContact O-CG2 3.41Å; I64-V68 PolarHBondContact O-N 2.94Å; G65-V68 PolarHBondContact O-N 3.47Å; V68-H71 WeakPolarHBondContact O-CA 3.14Å; V68-H71 PolarHBondContact O-N 3.39Å; V68-L72 HydrophobicContact CG1-CD1 3.37Å; V68-L72 HydrophobicContact CG1-CD2 4.34Å; V68-L72 HydrophobicContact CG1-CG 3.52Å; V68-L72 PolarHBondContact O-N 2.9Å
69	R	79.3	Confident	74.8	Confident	199 Å²	199	120.2 Å²	120.2	75%	0.751	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-50.9	-45.3	-179.7	-93.1	179.9	-171.2	-128	4.6	114.7	G65 H71	G65-R69 VanDerWaalsContact O-CB 3.27Å; G65-R69 WeakPolarHBondContact O-CB 3.27Å; G65-R69 WeakPolarHBondContact O-CG 3.37Å; G65-R69 PolarHBondContact O-N 3.23Å; R69-H71 PolarHBondContact O-N 3.02Å
70	P	79.9	Confident	74.4	Confident	96 Å²	96	123.1 Å²	123.1	62%	0.623	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	-13.7	177.5	-22.1	34.1	0	0	0	114.5	R66	R66-P70 WeakPolarHBondContact O-CD 3.46Å
71	H	77.8	Confident	73.7	Confident	158 Å²	158	124.7 Å²	124.7	73%	0.731	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.7	-22.5	-176	-55.2	-25.7	0	0	0	112.7	L67 V68 R69 G73	L67-H71 PolarHBondContact O-CD2 3.01Å; V68-H71 WeakPolarHBondContact O-CA 3.14Å; V68-H71 PolarHBondContact O-N 3.39Å; R69-H71 PolarHBondContact O-N 3.02Å; H71-G73 PolarHBondContact O-N 3.46Å
72	L	67.3	Low	72.9	Confident	117 Å²	117	125 Å²	125	61%	0.613	67%	0.667	S	S	*	*	S	Bend	trans	-82.6	86.4	164.4	-65.4	177.1	0	0	0	107.5	V68 E74	V68-L72 HydrophobicContact CG1-CD1 3.37Å; V68-L72 HydrophobicContact CG1-CD2 4.34Å; V68-L72 HydrophobicContact CG1-CG 3.52Å; V68-L72 PolarHBondContact O-N 2.9Å; L72-E74 PolarHBondContact O-N 3.23Å
73	G	62.8	Low	72.1	Confident	67 Å²	67	126.2 Å²	126.2	69%	0.691	67%	0.674	S	S	*	*			trans	-42.7	137.4	169.2	0	0	0	0	0	110.2	H71	H71-G73 PolarHBondContact O-N 3.46Å
74	E	62.1	Low	71.1	Confident	177 Å²	177	129.4 Å²	129.4	83%	0.827	69%	0.69	S	S	*	*			trans	-44.6	128.5	-167.8	-62.3	-159.7	133.3	0	0	110.9	L72 S76	L72-E74 PolarHBondContact O-N 3.23Å; E74-S76 PolarHBondContact O-N 2.85Å
75	P	57.7	Low	70.2	Confident	120 Å²	120	131.8 Å²	131.8	78%	0.779	71%	0.705	S	S	*	*			trans	-58.7	112.6	168.7	24.7	-29.2	0	0	0	105.1	S77	P75-S77 PolarHBondContact O-N 2.72Å
76	S	55.1	Low	69.1	Low	113 Å²	113	139.1 Å²	139.1	79%	0.79	73%	0.733	S	S	*	*			trans	-60.8	93.9	175.9	-59.6	0	0	0	0	106.2	E74 S78	E74-S76 PolarHBondContact O-N 2.85Å; S76-S78 PolarHBondContact O-N 3.38Å
77	S	63.6	Low	67.9	Low	117 Å²	117	136.5 Å²	136.5	82%	0.818	74%	0.739	S	S	*	*			trans	-72.2	88.4	173.3	-172.8	0	0	0	0	105.6	P75 R79	P75-S77 PolarHBondContact O-N 2.72Å; S77-R79 PolarHBondContact O-N 3.14Å; S77-R79 VanDerWaalsContact O-N 3.14Å
78	S	56	Low	66.3	Low	114 Å²	114	137.7 Å²	137.7	80%	0.797	75%	0.747	S	S	*	*			trans	-58.5	118.1	165.9	-72.9	0	0	0	0	108.2	S76	S76-S78 PolarHBondContact O-N 3.38Å
79	R	48.9	Very low	64.6	Low	315 Å²	315	144.8 Å²	144.8	100%	1.189	78%	0.783	S	S	*	*			trans	-28.6	0	172.3	-156	178.6	-167.5	-177	2.6	116.7	S77	S77-R79 PolarHBondContact O-N 3.14Å; S77-R79 VanDerWaalsContact O-N 3.14Å

Retrieved 79 of 79 residues in 139.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).