A0A077ZIP5_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZIP5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 137 aa.

						>A0A077ZIP5_TRITR|A0A077ZIP5
MAYVTHRRTADTVKDFLMTYRSTPHCVPGATPSLLLHGRTLRTKLHPPVASRPVNDRAIREKVTRRQEYLRRYVSGKKKRNLPHLSAGDVVYTRQPSSAKGHSRPSWQPTIIQSQVREATYRMADGRVWNASNLARR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.5	Low	77	Confident	164 Å²	164	111.8 Å²	111.8	81%	0.808	58%	0.578	S	S	*	*				0	126.6	0	-90.5	172.4	150.8	0	0	108.3	Y3	M1-Y3 HydrophobicContact CB-CE2 3.94Å; M1-Y3 WeakPolarHBondContact O-CD2 3.36Å; M1-Y3 WeakPolarHBondContact O-CE2 3.38Å
2	A	64.9	Low	78.3	Confident	74 Å²	74	105.9 Å²	105.9	61%	0.612	55%	0.551	S	S	*	*			trans	-74.3	131.8	175.4	0	0	0	0	0	110.1	T9	A2-T9 VanDerWaalsContact C-OG1 3.29Å; A2-T9 PolarHBondContact O-N 2.94Å; A2-T9 PolarHBondContact O-OG1 2.8Å
3	Y	62.3	Low	79.5	Confident	137 Å²	137	103.3 Å²	103.3	54%	0.537	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	136.9	176.3	-67.9	-88	0	0	0	109.1	M1 R7 R8	M1-Y3 HydrophobicContact CB-CE2 3.94Å; M1-Y3 WeakPolarHBondContact O-CD2 3.36Å; M1-Y3 WeakPolarHBondContact O-CE2 3.38Å; Y3-R7 WeakPolarHBondContact CA-O 3.48Å; Y3-R7 WeakPolarHBondContact CD1-O 3.15Å; Y3-R8 HydrophobicContact CE1-CG 4.19Å
4	V	69.1	Low	80.4	Confident	77 Å²	77	106.6 Å²	106.6	47%	0.467	55%	0.55	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120	127.2	165.7	177.4	0	0	0	0	105	H6 R7	V4-H6 VanDerWaalsContact C-N 3.28Å; V4-H6 PolarHBondContact O-N 2.64Å; V4-R7 PolarHBondContact N-O 2.68Å; V4-R7 PolarHBondContact O-N 3.45Å
5	T	75.3	Confident	81.1	Confident	111 Å²	111	104 Å²	104	68%	0.681	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.7	41.6	179.5	57.4	0	0	0	0	114.5	R7	T5-R7 PolarHBondContact O-N 3.31Å; T5-R7 VanDerWaalsContact O-N 3.13Å
6	H	80.1	Confident	81.9	Confident	186 Å²	186	105.9 Å²	105.9	86%	0.861	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.8	9.3	-178.2	-52.4	-83.4	0	0	0	115.9	V4	V4-H6 VanDerWaalsContact C-N 3.28Å; V4-H6 PolarHBondContact O-N 2.64Å
7	R	82.6	Confident	82.6	Confident	139 Å²	139	103.1 Å²	103.1	53%	0.525	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	151.9	172.3	-64	-172.3	-176.8	-170.6	1.8	110.6	Y3 V4 T5 T9 D15	Y3-R7 WeakPolarHBondContact CA-O 3.48Å; Y3-R7 WeakPolarHBondContact CD1-O 3.15Å; V4-R7 PolarHBondContact N-O 2.68Å; V4-R7 PolarHBondContact O-N 3.45Å; T5-R7 PolarHBondContact O-N 3.31Å; T5-R7 VanDerWaalsContact O-N 3.13Å; R7-T9 PolarHBondContact O-N 2.77Å; R7-D15 IonicContact NH1-OD2 3.23Å; R7-D15 PolarHBondContact NH1-OD2 3.25Å; R7-D15 VanDerWaalsContact NH1-OD2 3.13Å
8	R	88.1	Confident	83.2	Confident	134 Å²	134	102.6 Å²	102.6	51%	0.506	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.4	134.2	170.1	-68.4	179.7	170.1	-168.8	-1.1	108.1	Y3 A10 D11 T12	Y3-R8 HydrophobicContact CE1-CG 4.19Å; R8-A10 PolarHBondContact O-N 2.93Å; R8-D11 PolarHBondContact O-N 2.74Å; R8-T12 PolarHBondContact O-N 2.83Å; R8-T12 PolarHBondContact O-OG1 2.92Å
9	T	88.7	Confident	83.6	Confident	54 Å²	54	101.2 Å²	101.2	33%	0.331	52%	0.52	S	S	.	.	H	α-helix	trans	-51.8	-36.9	-179.5	-60.1	0	0	0	0	112.5	A2 R7 D11 T12 V13	A2-T9 VanDerWaalsContact C-OG1 3.29Å; A2-T9 PolarHBondContact O-N 2.94Å; A2-T9 PolarHBondContact O-OG1 2.8Å; R7-T9 PolarHBondContact O-N 2.77Å; T9-D11 PolarHBondContact O-N 2.75Å; T9-T12 PolarHBondContact O-N 3.5Å; T9-V13 HydrophobicContact CG2-CG2 4.25Å; T9-V13 VanDerWaalsContact O-CG2 3.26Å; T9-V13 WeakPolarHBondContact O-CG2 3.43Å; T9-V13 PolarHBondContact O-N 2.86Å
10	A	91.3	Very high	84.2	Confident	73 Å²	73	102.6 Å²	102.6	60%	0.603	52%	0.52	S	S	*	.	H	α-helix	trans	-61.2	-42.2	178.1	0	0	0	0	0	113.3	R8 V13 K14	R8-A10 PolarHBondContact O-N 2.93Å; A10-V13 PolarHBondContact O-N 2.95Å; A10-K14 WeakPolarHBondContact O-CB 3.45Å; A10-K14 PolarHBondContact O-N 3.42Å
11	D	91.7	Very high	84.7	Confident	81 Å²	81	102.5 Å²	102.5	43%	0.433	51%	0.513	S	S	.	.	H	α-helix	trans	-68.5	-42.8	179.1	-62	-35.8	0	0	0	110.4	R8 T9 V13 K14 D15	R8-D11 PolarHBondContact O-N 2.74Å; T9-D11 PolarHBondContact O-N 2.75Å; D11-V13 VanDerWaalsContact C-N 3.34Å; D11-V13 PolarHBondContact O-N 2.98Å; D11-K14 WeakPolarHBondContact O-CB 3.37Å; D11-K14 PolarHBondContact O-N 3.3Å; D11-K14 VanDerWaalsContact O-N 3.16Å; D11-D15 PolarHBondContact O-N 2.89Å
12	T	92.5	Very high	86.5	Confident	41 Å²	41	96 Å²	96	25%	0.252	48%	0.484	S	S	.	.	H	α-helix	trans	-60.5	-42.1	175.6	-52.4	0	0	0	0	112	R8 T9 D15 F16	R8-T12 PolarHBondContact O-N 2.83Å; R8-T12 PolarHBondContact O-OG1 2.92Å; T9-T12 PolarHBondContact O-N 3.5Å; T12-D15 PolarHBondContact O-N 3.42Å; T12-F16 VanDerWaalsContact O-CB 3.3Å; T12-F16 WeakPolarHBondContact O-CB 3.38Å; T12-F16 PolarHBondContact O-N 2.81Å
13	V	93.5	Very high	87.7	Confident	72 Å²	72	96 Å²	96	44%	0.436	48%	0.476	S	S	.	.	H	α-helix	trans	-64.7	-40.6	176	170.2	0	0	0	0	110.9	T9 A10 D11 F16 L17	T9-V13 HydrophobicContact CG2-CG2 4.25Å; T9-V13 VanDerWaalsContact O-CG2 3.26Å; T9-V13 WeakPolarHBondContact O-CG2 3.43Å; T9-V13 PolarHBondContact O-N 2.86Å; A10-V13 PolarHBondContact O-N 2.95Å; D11-V13 VanDerWaalsContact C-N 3.34Å; D11-V13 PolarHBondContact O-N 2.98Å; V13-F16 PolarHBondContact O-N 2.87Å; V13-L17 HydrophobicContact CG1-CD1 3.85Å; V13-L17 HydrophobicContact CG1-CG 4.27Å; V13-L17 WeakPolarHBondContact O-CB 3.27Å; V13-L17 VanDerWaalsContact O-CG 3.25Å; V13-L17 WeakPolarHBondContact O-CG 3.25Å; V13-L17 PolarHBondContact O-N 3.43Å
14	K	92.6	Very high	89.1	Confident	150 Å²	150	93.2 Å²	93.2	65%	0.652	48%	0.475	S	S	*	.	H	α-helix	trans	-62.5	-47.3	177.6	-174.7	-179.1	177.6	-178.7	0	111.7	A10 D11 L17 M18	A10-K14 WeakPolarHBondContact O-CB 3.45Å; A10-K14 PolarHBondContact O-N 3.42Å; D11-K14 WeakPolarHBondContact O-CB 3.37Å; D11-K14 PolarHBondContact O-N 3.3Å; D11-K14 VanDerWaalsContact O-N 3.16Å; K14-L17 PolarHBondContact O-N 3.4Å; K14-M18 WeakPolarHBondContact O-CB 3.31Å; K14-M18 PolarHBondContact O-N 2.93Å
15	D	91	Very high	90.1	Very high	67 Å²	67	94 Å²	94	36%	0.358	47%	0.473	S	S	.	.	H	α-helix	trans	-62.4	-44.4	177.5	-74.5	-12.7	0	0	0	111.5	R7 D11 T12 M18 T19	R7-D15 IonicContact NH1-OD2 3.23Å; R7-D15 PolarHBondContact NH1-OD2 3.25Å; R7-D15 VanDerWaalsContact NH1-OD2 3.13Å; D11-D15 PolarHBondContact O-N 2.89Å; T12-D15 PolarHBondContact O-N 3.42Å; D15-M18 PolarHBondContact O-N 3.49Å; D15-T19 PolarHBondContact O-N 2.81Å; D15-T19 PolarHBondContact O-OG1 3.15Å
16	F	92.8	Very high	90.9	Very high	134 Å²	134	94 Å²	94	59%	0.588	48%	0.476	S	S	*	.	H	α-helix	trans	-59.7	-48.8	176	176	-96.6	0	0	0	111.7	T12 V13 M18 T19 Y20	T12-F16 VanDerWaalsContact O-CB 3.3Å; T12-F16 WeakPolarHBondContact O-CB 3.38Å; T12-F16 PolarHBondContact O-N 2.81Å; V13-F16 PolarHBondContact O-N 2.87Å; F16-M18 VanDerWaalsContact C-N 3.33Å; F16-M18 PolarHBondContact O-N 2.87Å; F16-T19 PolarHBondContact O-N 3.05Å; F16-Y20 WeakPolarHBondContact O-CB 3.26Å; F16-Y20 PolarHBondContact O-N 2.97Å
17	L	94.1	Very high	91.4	Very high	58 Å²	58	86.5 Å²	86.5	30%	0.304	44%	0.444	S	S	.	.	H	α-helix	trans	-64	-38	179.8	-73.6	174.7	0	0	0	112.1	V13 K14 T19 R21	V13-L17 HydrophobicContact CG1-CD1 3.85Å; V13-L17 HydrophobicContact CG1-CG 4.27Å; V13-L17 WeakPolarHBondContact O-CB 3.27Å; V13-L17 VanDerWaalsContact O-CG 3.25Å; V13-L17 WeakPolarHBondContact O-CG 3.25Å; V13-L17 PolarHBondContact O-N 3.43Å; K14-L17 PolarHBondContact O-N 3.4Å; L17-T19 VanDerWaalsContact C-N 3.35Å; L17-R21 VanDerWaalsContact O-CB 3.24Å; L17-R21 WeakPolarHBondContact O-CB 3.37Å; L17-R21 WeakPolarHBondContact O-CD 3.49Å; L17-R21 WeakPolarHBondContact O-CG 3.3Å; L17-R21 PolarHBondContact O-N 2.91Å
18	M	92.8	Very high	91.7	Very high	95 Å²	95	80.8 Å²	80.8	47%	0.468	43%	0.425	S	S	.	.	H	α-helix	trans	-62.5	-44.2	175.9	-172.8	-102.6	-85.5	0	0	111.2	K14 D15 F16 S22 T43	K14-M18 WeakPolarHBondContact O-CB 3.31Å; K14-M18 PolarHBondContact O-N 2.93Å; D15-M18 PolarHBondContact O-N 3.49Å; F16-M18 VanDerWaalsContact C-N 3.33Å; F16-M18 PolarHBondContact O-N 2.87Å; M18-S22 WeakPolarHBondContact O-CB 3.37Å; M18-S22 PolarHBondContact O-N 3.42Å; M18-S22 VanDerWaalsContact O-N 3.16Å; M18-S22 PolarHBondContact O-OG 3.05Å; M18-T43 HydrophobicContact SD-CG2 4.11Å
19	T	92.5	Very high	91.7	Very high	76 Å²	76	76.7 Å²	76.7	47%	0.466	43%	0.425	S	S	.	.	H	α-helix	trans	-65.4	-50.1	177.4	-53.3	0	0	0	0	111.4	D15 F16 L17 R21 S22 T23	D15-T19 PolarHBondContact O-N 2.81Å; D15-T19 PolarHBondContact O-OG1 3.15Å; F16-T19 PolarHBondContact O-N 3.05Å; L17-T19 VanDerWaalsContact C-N 3.35Å; T19-R21 VanDerWaalsContact C-N 3.33Å; T19-R21 PolarHBondContact O-N 3.06Å; T19-S22 PolarHBondContact O-N 2.92Å; T19-S22 PolarHBondContact O-OG 3.36Å; T19-T23 WeakPolarHBondContact O-CB 3.45Å; T19-T23 PolarHBondContact O-N 2.93Å; T19-T23 PolarHBondContact O-OG1 2.79Å
20	Y	94.4	Very high	91.8	Very high	129 Å²	129	74.5 Å²	74.5	51%	0.506	41%	0.412	S	S	.	.	H	α-helix	trans	-58.2	-43.9	178.7	179.3	-108.6	0	0	0	111.8	F16 S22 P32	F16-Y20 WeakPolarHBondContact O-CB 3.26Å; F16-Y20 PolarHBondContact O-N 2.97Å; Y20-S22 PolarHBondContact O-N 3.29Å; Y20-P32 HydrophobicContact CD1-CG 4.21Å; Y20-P32 HydrophobicContact CE1-CB 4.21Å; Y20-P32 HydrophobicContact CE1-CG 3.91Å; Y20-P32 VanDerWaalsContact O-CD 3.23Å; Y20-P32 WeakPolarHBondContact O-CD 3.41Å; Y20-P32 VanDerWaalsContact O-CG 3.28Å; Y20-P32 WeakPolarHBondContact O-CG 3.49Å
21	R	94.2	Very high	91.8	Very high	101 Å²	101	71.6 Å²	71.6	38%	0.381	39%	0.387	S	S	.	.	H	α-helix	trans	-72.2	-24	-178.1	-72.7	171.5	174.6	155.1	-1.5	114.4	L17 T19 T31 S33 L41	L17-R21 VanDerWaalsContact O-CB 3.24Å; L17-R21 WeakPolarHBondContact O-CB 3.37Å; L17-R21 WeakPolarHBondContact O-CD 3.49Å; L17-R21 WeakPolarHBondContact O-CG 3.3Å; L17-R21 PolarHBondContact O-N 2.91Å; T19-R21 VanDerWaalsContact C-N 3.33Å; T19-R21 PolarHBondContact O-N 3.06Å; R21-T31 VanDerWaalsContact O-CB 3.32Å; R21-T31 WeakPolarHBondContact O-CB 3.23Å; R21-T31 PolarHBondContact O-OG1 2.78Å; R21-S33 WeakPolarHBondContact O-CB 3.41Å; R21-S33 PolarHBondContact O-N 3.11Å; R21-S33 VanDerWaalsContact O-N 3.09Å; R21-S33 PolarHBondContact O-OG 2.68Å; R21-L41 HydrophobicContact CB-CD1 3.56Å
22	S	91.9	Very high	91.8	Very high	27 Å²	27	68.5 Å²	68.5	19%	0.189	37%	0.371	C	S	.	.	H	α-helix	trans	-98.6	-12.3	-179.2	57	0	0	0	0	113.8	M18 T19 Y20 T31 T43	M18-S22 WeakPolarHBondContact O-CB 3.37Å; M18-S22 PolarHBondContact O-N 3.42Å; M18-S22 VanDerWaalsContact O-N 3.16Å; M18-S22 PolarHBondContact O-OG 3.05Å; T19-S22 PolarHBondContact O-N 2.92Å; T19-S22 PolarHBondContact O-OG 3.36Å; Y20-S22 PolarHBondContact O-N 3.29Å; S22-T31 VanDerWaalsContact O-CG2 3.27Å; S22-T31 WeakPolarHBondContact O-CG2 3.23Å; S22-T43 VanDerWaalsContact CB-CG2 3.47Å
23	T	90.7	Very high	91.8	Very high	73 Å²	73	66.6 Å²	66.6	45%	0.448	36%	0.359	S	S	.	.	S	Bend	trans	-90.3	125.9	179.5	-55	0	0	0	0	110.9	T19 H25 P32	T19-T23 WeakPolarHBondContact O-CB 3.45Å; T19-T23 PolarHBondContact O-N 2.93Å; T19-T23 PolarHBondContact O-OG1 2.79Å; T23-H25 PolarHBondContact O-N 2.88Å; T23-P32 WeakPolarHBondContact O-CD 3.37Å
24	P	90.9	Very high	91.7	Very high	80 Å²	80	64.6 Å²	64.6	52%	0.519	35%	0.346	S	S	.	.	P	Polyproline II helix	trans	-61.2	132.7	174.5	-24.2	34.4	0	0	0	112.4	T31	P24-T31 HydrophobicContact CG-CG2 3.96Å
25	H	91.4	Very high	91.6	Very high	92 Å²	92	61 Å²	61	43%	0.426	33%	0.334	S	S	.	.	P	Polyproline II helix	trans	-80.5	140.6	175.1	-175.2	-96.5	0	0	0	110.8	T23 V27 P28 G29 A30	T23-H25 PolarHBondContact O-N 2.88Å; H25-V27 VanDerWaalsContact C-N 3.25Å; H25-V27 PolarHBondContact ND1-N 2.97Å; H25-V27 PolarHBondContact O-N 3.46Å; H25-V27 VanDerWaalsContact O-N 3.13Å; H25-P28 HydrophobicContact CB-CG 3.9Å; H25-P28 WeakPolarHBondContact ND1-CD 3.32Å; H25-P28 WeakPolarHBondContact O-CD 3.46Å; H25-G29 VanDerWaalsContact O-CA 3.26Å; H25-G29 WeakPolarHBondContact O-CA 3.41Å; H25-G29 PolarHBondContact O-N 2.79Å; H25-A30 PolarHBondContact N-O 3.06Å
26	C	91	Very high	91.7	Very high	111 Å²	111	64 Å²	64	75%	0.75	35%	0.348	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.5	-30.7	-171.7	63.1	0	0	0	0	114.5
27	V	90.2	Very high	91.5	Very high	30 Å²	30	63 Å²	63	18%	0.182	35%	0.346	C	S	.	.	T	Hydrogen-bonded Turn	trans	-76.7	-66.3	179.7	179.1	0	0	0	0	111.8	H25 G29 K62 V63 R66	H25-V27 VanDerWaalsContact C-N 3.25Å; H25-V27 PolarHBondContact ND1-N 2.97Å; H25-V27 PolarHBondContact O-N 3.46Å; H25-V27 VanDerWaalsContact O-N 3.13Å; V27-G29 VanDerWaalsContact C-N 3.32Å; V27-G29 PolarHBondContact O-N 2.92Å; V27-K62 WeakPolarHBondContact O-CD 3.44Å; V27-K62 WeakPolarHBondContact O-CE 3.29Å; V27-K62 PolarHBondContact O-NZ 3.21Å; V27-V63 HydrophobicContact CG1-CG2 4.2Å; V27-R66 HydrophobicContact CB-CG 4.49Å; V27-R66 HydrophobicContact CG1-CB 3.68Å; V27-R66 HydrophobicContact CG1-CG 3.8Å; V27-R66 HydrophobicContact CG2-CG 3.83Å
28	P	89.1	Confident	91.2	Very high	18 Å²	18	63.1 Å²	63.1	12%	0.117	36%	0.36	C	S	.	.	T	Hydrogen-bonded Turn	trans	-72.7	-23.8	-178.7	31.8	-35.5	0	0	0	112.8	H25 A30 L35 I59 V63	H25-P28 HydrophobicContact CB-CG 3.9Å; H25-P28 WeakPolarHBondContact ND1-CD 3.32Å; H25-P28 WeakPolarHBondContact O-CD 3.46Å; P28-A30 HydrophobicContact CB-CB 4.41Å; P28-A30 PolarHBondContact O-N 3.2Å; P28-L35 HydrophobicContact CG-CD1 4.34Å; P28-I59 HydrophobicContact CB-CG2 3.65Å; P28-V63 HydrophobicContact CB-CG2 4.22Å
29	G	88.7	Confident	90.9	Very high	49 Å²	49	66.7 Å²	66.7	51%	0.505	37%	0.369	S	S	.	.			trans	71.7	2.3	-171	0	0	0	0	0	113.8	H25 V27	H25-G29 VanDerWaalsContact O-CA 3.26Å; H25-G29 WeakPolarHBondContact O-CA 3.41Å; H25-G29 PolarHBondContact O-N 2.79Å; V27-G29 VanDerWaalsContact C-N 3.32Å; V27-G29 PolarHBondContact O-N 2.92Å
30	A	89.4	Confident	90.6	Very high	8 Å²	8	65.5 Å²	65.5	7%	0.066	36%	0.361	C	S	.	.	S	Bend	trans	-103.4	153.2	177.8	0	0	0	0	0	110.9	H25 P28 L34 L35 I59	H25-A30 PolarHBondContact N-O 3.06Å; P28-A30 HydrophobicContact CB-CB 4.41Å; P28-A30 PolarHBondContact O-N 3.2Å; A30-L34 HydrophobicContact CB-CD2 4.13Å; A30-L35 HydrophobicContact CB-CD1 4.43Å; A30-L35 HydrophobicContact CB-CD2 3.78Å; A30-L35 HydrophobicContact CB-CG 4.02Å; A30-I59 HydrophobicContact CB-CD1 4.02Å
31	T	91.5	Very high	90.3	Very high	12 Å²	12	62.1 Å²	62.1	7%	0.074	35%	0.352	C	S	.	.			trans	-77.5	149.9	173.9	74.5	0	0	0	0	110.4	R21 S22 P24 S33 L34 L35	R21-T31 VanDerWaalsContact O-CB 3.32Å; R21-T31 WeakPolarHBondContact O-CB 3.23Å; R21-T31 PolarHBondContact O-OG1 2.78Å; S22-T31 VanDerWaalsContact O-CG2 3.27Å; S22-T31 WeakPolarHBondContact O-CG2 3.23Å; P24-T31 HydrophobicContact CG-CG2 3.96Å; T31-S33 PolarHBondContact O-N 2.89Å; T31-S33 PolarHBondContact OG1-OG 3.24Å; T31-L34 WeakPolarHBondContact O-CB 3.48Å; T31-L34 PolarHBondContact O-N 2.96Å; T31-L34 VanDerWaalsContact O-N 3.09Å; T31-L34 WeakPolarHBondContact OG1-CB 3.33Å; T31-L34 PolarHBondContact OG1-N 2.79Å; T31-L35 PolarHBondContact O-N 2.87Å
32	P	93.5	Very high	89.9	Confident	16 Å²	16	68.3 Å²	68.3	10%	0.104	38%	0.375	C	S	.	.	H	α-helix	trans	-59	-31.4	174.6	-25.9	34.7	0	0	0	113.4	Y20 T23 L34 L35 L36	Y20-P32 HydrophobicContact CD1-CG 4.21Å; Y20-P32 HydrophobicContact CE1-CB 4.21Å; Y20-P32 HydrophobicContact CE1-CG 3.91Å; Y20-P32 VanDerWaalsContact O-CD 3.23Å; Y20-P32 WeakPolarHBondContact O-CD 3.41Å; Y20-P32 VanDerWaalsContact O-CG 3.28Å; Y20-P32 WeakPolarHBondContact O-CG 3.49Å; T23-P32 WeakPolarHBondContact O-CD 3.37Å; P32-L34 VanDerWaalsContact C-N 3.32Å; P32-L34 PolarHBondContact O-N 3.25Å; P32-L35 PolarHBondContact O-N 2.89Å; P32-L36 WeakPolarHBondContact O-CB 3.45Å; P32-L36 WeakPolarHBondContact O-CG 3.37Å; P32-L36 PolarHBondContact O-N 2.82Å; P32-L36 VanDerWaalsContact O-N 3.07Å
33	S	92.4	Very high	89.6	Confident	0 Å²	0	69.2 Å²	69.2	0%	0	38%	0.38	C	S	.	.	H	α-helix	trans	-63.6	-39.7	175.3	75.6	0	0	0	0	112.4	R21 T31 H37 R39 L41	R21-S33 WeakPolarHBondContact O-CB 3.41Å; R21-S33 PolarHBondContact O-N 3.11Å; R21-S33 VanDerWaalsContact O-N 3.09Å; R21-S33 PolarHBondContact O-OG 2.68Å; T31-S33 PolarHBondContact O-N 2.89Å; T31-S33 PolarHBondContact OG1-OG 3.24Å; S33-H37 WeakPolarHBondContact O-CB 3.4Å; S33-H37 PolarHBondContact O-N 2.82Å; S33-H37 PolarHBondContact O-ND1 3.39Å; S33-R39 CarbonylContact C-O 3.56Å; S33-R39 WeakPolarHBondContact CB-O 3.38Å; S33-R39 PolarHBondContact OG-O 2.9Å; S33-L41 PolarHBondContact OG-N 3.15Å
34	L	90.5	Very high	89.3	Confident	31 Å²	31	76.6 Å²	76.6	16%	0.162	41%	0.406	C	S	.	.	H	α-helix	trans	-67.4	-41.6	-179.4	-175.7	61.9	0	0	0	110.7	A30 T31 P32 G38 R39 T40 V54	A30-L34 HydrophobicContact CB-CD2 4.13Å; T31-L34 WeakPolarHBondContact O-CB 3.48Å; T31-L34 PolarHBondContact O-N 2.96Å; T31-L34 VanDerWaalsContact O-N 3.09Å; T31-L34 WeakPolarHBondContact OG1-CB 3.33Å; T31-L34 PolarHBondContact OG1-N 2.79Å; P32-L34 VanDerWaalsContact C-N 3.32Å; P32-L34 PolarHBondContact O-N 3.25Å; L34-G38 WeakPolarHBondContact O-CA 3.33Å; L34-G38 PolarHBondContact O-N 3.07Å; L34-R39 WeakPolarHBondContact CA-O 3.39Å; L34-R39 PolarHBondContact N-O 3.32Å; L34-T40 HydrophobicContact CB-CG2 4.39Å; L34-T40 HydrophobicContact CD1-CG2 4.27Å; L34-T40 HydrophobicContact CD2-CG2 4.33Å; L34-V54 HydrophobicContact CD1-CG2 3.41Å; L34-V54 VanDerWaalsContact CD1-CG2 3.41Å; L34-V54 HydrophobicContact CD2-CG2 3.72Å; L34-V54 HydrophobicContact CG-CG2 3.5Å
35	L	91.4	Very high	88.8	Confident	75 Å²	75	80.5 Å²	80.5	39%	0.393	42%	0.421	S	S	.	.	H	α-helix	trans	-68.7	-36.2	178.3	-62.2	178.1	0	0	0	113.1	P28 A30 T31 P32 I59	P28-L35 HydrophobicContact CG-CD1 4.34Å; A30-L35 HydrophobicContact CB-CD1 4.43Å; A30-L35 HydrophobicContact CB-CD2 3.78Å; A30-L35 HydrophobicContact CB-CG 4.02Å; T31-L35 PolarHBondContact O-N 2.87Å; P32-L35 PolarHBondContact O-N 2.89Å; L35-I59 HydrophobicContact CD2-CD1 3.85Å; L35-I59 HydrophobicContact CD2-CG2 3.95Å
36	L	91.2	Very high	88	Confident	128 Å²	128	79.2 Å²	79.2	67%	0.67	42%	0.415	S	S	*	.	H	α-helix	trans	-86.9	-36.8	-177.5	-70	171.7	0	0	0	113.6	P32	P32-L36 WeakPolarHBondContact O-CB 3.45Å; P32-L36 WeakPolarHBondContact O-CG 3.37Å; P32-L36 PolarHBondContact O-N 2.82Å; P32-L36 VanDerWaalsContact O-N 3.07Å
37	H	89.8	Confident	87	Confident	115 Å²	115	77.4 Å²	77.4	53%	0.532	40%	0.402	S	S	.	.	H	α-helix	trans	-124.3	1.9	-169.2	-47.3	97.8	0	0	0	113.7	S33 R39	S33-H37 WeakPolarHBondContact O-CB 3.4Å; S33-H37 PolarHBondContact O-N 2.82Å; S33-H37 PolarHBondContact O-ND1 3.39Å; H37-R39 HydrophobicContact CB-CG 4.21Å; H37-R39 PolarHBondContact O-N 3.31Å
38	G	87.3	Confident	85.9	Confident	59 Å²	59	82.6 Å²	82.6	61%	0.608	44%	0.436	S	S	*	.	S	Bend	trans	70.1	8	-179.2	0	0	0	0	0	115.2	L34	L34-G38 WeakPolarHBondContact O-CA 3.33Å; L34-G38 PolarHBondContact O-N 3.07Å
39	R	87.3	Confident	84.7	Confident	171 Å²	171	86.3 Å²	86.3	65%	0.645	46%	0.458	S	S	*	.	S	Bend	trans	-137.7	148.5	-179	63.5	-179.1	178.1	166.3	-1.5	113.2	S33 L34 H37	S33-R39 CarbonylContact C-O 3.56Å; S33-R39 WeakPolarHBondContact CB-O 3.38Å; S33-R39 PolarHBondContact OG-O 2.9Å; L34-R39 WeakPolarHBondContact CA-O 3.39Å; L34-R39 PolarHBondContact N-O 3.32Å; H37-R39 HydrophobicContact CB-CG 4.21Å; H37-R39 PolarHBondContact O-N 3.31Å
40	T	85.9	Confident	83.4	Confident	51 Å²	51	88.1 Å²	88.1	31%	0.313	47%	0.468	S	S	.	.	P	Polyproline II helix	trans	-81.2	139.5	170.6	54.5	0	0	0	0	110.3	L34 H46	L34-T40 HydrophobicContact CB-CG2 4.39Å; L34-T40 HydrophobicContact CD1-CG2 4.27Å; L34-T40 HydrophobicContact CD2-CG2 4.33Å; T40-H46 PolarHBondContact OG1-NE2 2.93Å
41	L	87.7	Confident	82.3	Confident	58 Å²	58	92.6 Å²	92.6	30%	0.304	50%	0.5	S	S	.	.	P	Polyproline II helix	trans	-72.8	135.1	171.5	-70	175.2	0	0	0	109.8	R21 S33 T43 H46	R21-L41 HydrophobicContact CB-CD1 3.56Å; S33-L41 PolarHBondContact OG-N 3.15Å; L41-T43 PolarHBondContact O-N 3.46Å; L41-H46 PolarHBondContact O-CD2 3.45Å; L41-H46 VanDerWaalsContact O-CD2 3.29Å
42	R	85.2	Confident	81.2	Confident	231 Å²	231	102.2 Å²	102.2	87%	0.872	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-77.5	116.3	172.3	-64.3	178.4	70.6	150.8	0.9	109
43	T	87.1	Confident	80.3	Confident	46 Å²	46	107.7 Å²	107.7	28%	0.282	57%	0.57	S	S	.	*			trans	-106.5	168.9	171.8	63	0	0	0	0	110	M18 S22 L41 L45 H46	M18-T43 HydrophobicContact SD-CG2 4.11Å; S22-T43 VanDerWaalsContact CB-CG2 3.47Å; L41-T43 PolarHBondContact O-N 3.46Å; T43-L45 PolarHBondContact O-N 2.93Å; T43-L45 VanDerWaalsContact O-N 3.13Å; T43-H46 WeakPolarHBondContact O-CB 3.29Å; T43-H46 PolarHBondContact O-N 3.39Å; T43-H46 VanDerWaalsContact O-N 3.1Å; T43-H46 PolarHBondContact OG1-N 3.45Å
44	K	83.2	Confident	79.7	Confident	228 Å²	228	110.3 Å²	110.3	99%	0.991	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.4	-24.7	177.7	-66.1	-175.2	178.1	-177.6	0	113.4
45	L	81.1	Confident	79.6	Confident	161 Å²	161	113.7 Å²	113.7	84%	0.843	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.1	16.3	-179.5	-160.7	67	0	0	0	112.4	T43 P47	T43-L45 PolarHBondContact O-N 2.93Å; T43-L45 VanDerWaalsContact O-N 3.13Å; L45-P47 WeakPolarHBondContact O-CD 3.49Å
46	H	74.4	Confident	79.5	Confident	65 Å²	65	113.3 Å²	113.3	30%	0.301	60%	0.602	S	S	.	*			trans	-70.1	119.3	-176.4	-171.8	-75	0	0	0	110.1	T40 L41 T43	T40-H46 PolarHBondContact OG1-NE2 2.93Å; L41-H46 PolarHBondContact O-CD2 3.45Å; L41-H46 VanDerWaalsContact O-CD2 3.29Å; T43-H46 WeakPolarHBondContact O-CB 3.29Å; T43-H46 PolarHBondContact O-N 3.39Å; T43-H46 VanDerWaalsContact O-N 3.1Å; T43-H46 PolarHBondContact OG1-N 3.45Å
47	P	69.3	Low	79.6	Confident	74 Å²	74	116 Å²	116	48%	0.481	60%	0.604	S	S	.	*			trans	-67.1	147	177.6	30	-34.8	0	0	0	109.6	L45 V49	L45-P47 WeakPolarHBondContact O-CD 3.49Å; P47-V49 HydrophobicContact CB-CG2 3.96Å; P47-V49 HydrophobicContact CG-CG2 3.98Å; P47-V49 PolarHBondContact O-N 3.26Å
48	P	67.1	Low	79.8	Confident	139 Å²	139	112.6 Å²	112.6	90%	0.903	60%	0.596	S	S	*	*			trans	-74.7	66.9	176.8	32.4	-35	0	0	0	109.9
49	V	63.9	Low	80	Confident	95 Å²	95	111.1 Å²	111.1	58%	0.576	57%	0.573	S	S	*	*			trans	-101.3	127.8	174.5	-173.6	0	0	0	0	107.6	P47 S51	P47-V49 HydrophobicContact CB-CG2 3.96Å; P47-V49 HydrophobicContact CG-CG2 3.98Å; P47-V49 PolarHBondContact O-N 3.26Å; V49-S51 PolarHBondContact O-N 2.86Å
50	A	63.1	Low	80.3	Confident	87 Å²	87	110.8 Å²	110.8	72%	0.719	57%	0.572	S	S	*	*			trans	-54.3	135.1	172.7	0	0	0	0	0	110	R52	A50-R52 PolarHBondContact O-N 2.83Å
51	S	66.1	Low	80.8	Confident	103 Å²	103	111.7 Å²	111.7	72%	0.72	57%	0.573	S	S	*	*			trans	-56.6	110.5	174.7	52.5	0	0	0	0	109.4	V49	V49-S51 PolarHBondContact O-N 2.86Å
52	R	68.8	Low	81.1	Confident	214 Å²	214	113.8 Å²	113.8	81%	0.808	58%	0.58	S	S	*	*			trans	-71.8	140.8	173.5	-76.2	179.9	161.9	-179.4	-5.2	109.3	A50 V54	A50-R52 PolarHBondContact O-N 2.83Å; R52-V54 PolarHBondContact O-N 2.89Å
53	P	73.6	Confident	81.6	Confident	131 Å²	131	104.7 Å²	104.7	85%	0.851	55%	0.549	S	S	*	.			trans	-58.4	132.8	172.7	24.9	-32.8	0	0	0	109.4
54	V	79	Confident	82.1	Confident	55 Å²	55	105.6 Å²	105.6	33%	0.333	56%	0.555	S	S	.	*			trans	-85.9	115.4	-178.2	-177.9	0	0	0	0	108.5	L34 R52 D56 I59	L34-V54 HydrophobicContact CD1-CG2 3.41Å; L34-V54 VanDerWaalsContact CD1-CG2 3.41Å; L34-V54 HydrophobicContact CD2-CG2 3.72Å; L34-V54 HydrophobicContact CG-CG2 3.5Å; R52-V54 PolarHBondContact O-N 2.89Å; V54-D56 VanDerWaalsContact C-N 3.35Å; V54-D56 PolarHBondContact O-N 2.91Å; V54-D56 VanDerWaalsContact O-N 3.09Å; V54-I59 HydrophobicContact CG1-CD1 3.45Å; V54-I59 VanDerWaalsContact CG1-CD1 3.45Å
55	N	88.8	Confident	82.7	Confident	102 Å²	102	102.5 Å²	102.5	55%	0.545	54%	0.537	S	S	.	.			trans	-81.1	86.2	168.7	-171.9	-24.3	0	0	0	109.3	R57 A58 I59	N55-R57 PolarHBondContact O-N 2.85Å; N55-R57 PolarHBondContact OD1-N 3.38Å; N55-A58 HydrophobicContact CB-CB 3.95Å; N55-A58 PolarHBondContact O-N 3.22Å; N55-A58 VanDerWaalsContact O-N 3.16Å; N55-A58 PolarHBondContact OD1-N 2.89Å; N55-I59 WeakPolarHBondContact O-CG1 3.22Å; N55-I59 PolarHBondContact O-N 3.34Å
56	D	90.7	Very high	83.4	Confident	66 Å²	66	100.2 Å²	100.2	35%	0.353	52%	0.517	S	S	.	.	H	α-helix	trans	-57.1	-38.4	-177.6	-173.9	45.5	0	0	0	112	V54 I59 R60	V54-D56 VanDerWaalsContact C-N 3.35Å; V54-D56 PolarHBondContact O-N 2.91Å; V54-D56 VanDerWaalsContact O-N 3.09Å; D56-I59 PolarHBondContact O-N 3.33Å; D56-R60 WeakPolarHBondContact O-CG 3.39Å; D56-R60 PolarHBondContact O-N 2.86Å; D56-R60 IonicContact OD1-NE 3.1Å; D56-R60 IonicContact OD2-CZ 3.77Å; D56-R60 IonicContact OD2-NE 3.3Å; D56-R60 PolarHBondContact OD2-NE 3.19Å; D56-R60 IonicContact OD2-NH2 2.68Å; D56-R60 PolarHBondContact OD2-NH2 3.27Å
57	R	93	Very high	84.4	Confident	185 Å²	185	103 Å²	103	70%	0.698	53%	0.53	S	S	*	.	H	α-helix	trans	-60.1	-50	175.7	-179.9	178.3	172.8	169.8	3.4	111.7	N55 I59 R60 E61	N55-R57 PolarHBondContact O-N 2.85Å; N55-R57 PolarHBondContact OD1-N 3.38Å; R57-I59 VanDerWaalsContact C-N 3.27Å; R57-I59 PolarHBondContact O-N 2.87Å; R57-R60 PolarHBondContact O-N 3.39Å; R57-E61 WeakPolarHBondContact CG-OE1 3.28Å; R57-E61 IonicContact CZ-OE1 3.06Å; R57-E61 IonicContact NE-OE1 3.13Å; R57-E61 PolarHBondContact NE-OE1 2.91Å; R57-E61 IonicContact NH2-OE1 2.72Å; R57-E61 WeakPolarHBondContact O-CG 3.47Å; R57-E61 PolarHBondContact O-N 3.04Å
58	A	92.6	Very high	85.7	Confident	44 Å²	44	104.7 Å²	104.7	36%	0.364	53%	0.532	S	S	.	.	H	α-helix	trans	-61.7	-36.8	178.8	0	0	0	0	0	112.1	N55 K62	N55-A58 HydrophobicContact CB-CB 3.95Å; N55-A58 PolarHBondContact O-N 3.22Å; N55-A58 VanDerWaalsContact O-N 3.16Å; N55-A58 PolarHBondContact OD1-N 2.89Å; A58-K62 WeakPolarHBondContact O-CB 3.36Å; A58-K62 PolarHBondContact O-N 3.38Å
59	I	92.3	Very high	87	Confident	27 Å²	27	103.8 Å²	103.8	14%	0.138	51%	0.511	C	S	.	.	H	α-helix	trans	-64.8	-48.9	175.2	-68.7	177	0	0	0	110.8	P28 A30 L35 V54 N55 D56 R57 E61 K62 V63	P28-I59 HydrophobicContact CB-CG2 3.65Å; A30-I59 HydrophobicContact CB-CD1 4.02Å; L35-I59 HydrophobicContact CD2-CD1 3.85Å; L35-I59 HydrophobicContact CD2-CG2 3.95Å; V54-I59 HydrophobicContact CG1-CD1 3.45Å; V54-I59 VanDerWaalsContact CG1-CD1 3.45Å; N55-I59 WeakPolarHBondContact O-CG1 3.22Å; N55-I59 PolarHBondContact O-N 3.34Å; D56-I59 PolarHBondContact O-N 3.33Å; R57-I59 VanDerWaalsContact C-N 3.27Å; R57-I59 PolarHBondContact O-N 2.87Å; I59-E61 VanDerWaalsContact C-N 3.33Å; I59-E61 PolarHBondContact O-N 3.12Å; I59-K62 PolarHBondContact O-N 3.48Å; I59-V63 HydrophobicContact CG2-CG2 4.44Å; I59-V63 WeakPolarHBondContact O-CG2 3.36Å; I59-V63 PolarHBondContact O-N 2.94Å
60	R	94.4	Very high	88.4	Confident	164 Å²	164	102.7 Å²	102.7	62%	0.619	50%	0.502	S	S	*	.	H	α-helix	trans	-58.6	-45.8	177.3	-71.5	179.1	-168.9	-158.9	6.4	111.2	D56 R57 K62 V63 T64	D56-R60 WeakPolarHBondContact O-CG 3.39Å; D56-R60 PolarHBondContact O-N 2.86Å; D56-R60 IonicContact OD1-NE 3.1Å; D56-R60 IonicContact OD2-CZ 3.77Å; D56-R60 IonicContact OD2-NE 3.3Å; D56-R60 PolarHBondContact OD2-NE 3.19Å; D56-R60 IonicContact OD2-NH2 2.68Å; D56-R60 PolarHBondContact OD2-NH2 3.27Å; R57-R60 PolarHBondContact O-N 3.39Å; R60-K62 PolarHBondContact O-N 2.83Å; R60-V63 PolarHBondContact O-N 3.3Å; R60-T64 WeakPolarHBondContact O-CB 3.14Å; R60-T64 PolarHBondContact O-N 2.91Å; R60-T64 PolarHBondContact O-OG1 3.09Å; R60-T64 VanDerWaalsContact O-OG1 3.09Å
61	E	95.6	Very high	89.7	Confident	70 Å²	70	107 Å²	107	33%	0.327	50%	0.5	S	S	.	.	H	α-helix	trans	-59	-44.5	176.6	-73	177	-165	0	0	112	R57 I59 V63 T64 R65	R57-E61 WeakPolarHBondContact CG-OE1 3.28Å; R57-E61 IonicContact CZ-OE1 3.06Å; R57-E61 IonicContact NE-OE1 3.13Å; R57-E61 PolarHBondContact NE-OE1 2.91Å; R57-E61 IonicContact NH2-OE1 2.72Å; R57-E61 WeakPolarHBondContact O-CG 3.47Å; R57-E61 PolarHBondContact O-N 3.04Å; I59-E61 VanDerWaalsContact C-N 3.33Å; I59-E61 PolarHBondContact O-N 3.12Å; E61-V63 PolarHBondContact O-N 3.23Å; E61-T64 PolarHBondContact O-N 3.02Å; E61-R65 WeakPolarHBondContact O-CB 3.34Å; E61-R65 VanDerWaalsContact O-CG 3.29Å; E61-R65 WeakPolarHBondContact O-CG 3.47Å; E61-R65 PolarHBondContact O-N 3.42Å; E61-R65 IonicContact OE2-NH2 2.93Å; E61-R65 PolarHBondContact OE2-NH2 2.98Å
62	K	94.3	Very high	90.8	Very high	103 Å²	103	112 Å²	112	45%	0.448	50%	0.502	S	S	.	.	H	α-helix	trans	-62	-42.7	176.5	-170.8	178.8	-174.2	-162.7	0	111.9	V27 A58 I59 R60 R66	V27-K62 WeakPolarHBondContact O-CD 3.44Å; V27-K62 WeakPolarHBondContact O-CE 3.29Å; V27-K62 PolarHBondContact O-NZ 3.21Å; A58-K62 WeakPolarHBondContact O-CB 3.36Å; A58-K62 PolarHBondContact O-N 3.38Å; I59-K62 PolarHBondContact O-N 3.48Å; R60-K62 PolarHBondContact O-N 2.83Å; K62-R66 WeakPolarHBondContact O-CB 3.35Å; K62-R66 PolarHBondContact O-N 3.33Å
63	V	95.9	Very high	91.9	Very high	39 Å²	39	106.6 Å²	106.6	24%	0.236	48%	0.483	C	S	.	.	H	α-helix	trans	-63.6	-47.9	176.9	171.1	0	0	0	0	110.5	V27 P28 I59 R60 E61 R66 Q67	V27-V63 HydrophobicContact CG1-CG2 4.2Å; P28-V63 HydrophobicContact CB-CG2 4.22Å; I59-V63 HydrophobicContact CG2-CG2 4.44Å; I59-V63 WeakPolarHBondContact O-CG2 3.36Å; I59-V63 PolarHBondContact O-N 2.94Å; R60-V63 PolarHBondContact O-N 3.3Å; E61-V63 PolarHBondContact O-N 3.23Å; V63-R66 PolarHBondContact O-N 3Å; V63-Q67 HydrophobicContact CG1-CG 4.33Å; V63-Q67 WeakPolarHBondContact O-CG 3.47Å; V63-Q67 PolarHBondContact O-N 2.77Å
64	T	96.6	Very high	92.5	Very high	65 Å²	65	103.4 Å²	103.4	40%	0.399	46%	0.461	S	S	.	.	H	α-helix	trans	-58.8	-49.8	177.4	-62.6	0	0	0	0	111.3	R60 E61 R66 Q67 E68	R60-T64 WeakPolarHBondContact O-CB 3.14Å; R60-T64 PolarHBondContact O-N 2.91Å; R60-T64 PolarHBondContact O-OG1 3.09Å; R60-T64 VanDerWaalsContact O-OG1 3.09Å; E61-T64 PolarHBondContact O-N 3.02Å; T64-R66 VanDerWaalsContact C-N 3.27Å; T64-R66 PolarHBondContact O-N 3.4Å; T64-Q67 PolarHBondContact O-N 3.44Å; T64-Q67 VanDerWaalsContact O-N 3.12Å; T64-E68 HydrophobicContact CG2-CG 4.4Å; T64-E68 WeakPolarHBondContact O-CG 3.37Å; T64-E68 PolarHBondContact O-N 3.13Å
65	R	96.6	Very high	92.8	Very high	163 Å²	163	103 Å²	103	62%	0.615	46%	0.461	S	S	*	.	H	α-helix	trans	-56.4	-41.8	176.3	-71.2	177.9	-149.4	176.1	8.1	111.9	E61 Y69	E61-R65 WeakPolarHBondContact O-CB 3.34Å; E61-R65 VanDerWaalsContact O-CG 3.29Å; E61-R65 WeakPolarHBondContact O-CG 3.47Å; E61-R65 PolarHBondContact O-N 3.42Å; E61-R65 IonicContact OE2-NH2 2.93Å; E61-R65 PolarHBondContact OE2-NH2 2.98Å; R65-Y69 WeakPolarHBondContact O-CB 3.44Å; R65-Y69 PolarHBondContact O-N 3.45Å
66	R	96.2	Very high	92.5	Very high	113 Å²	113	101.4 Å²	101.4	43%	0.426	47%	0.468	S	S	.	.	H	α-helix	trans	-67.8	-41.9	178	-176.4	58.7	174.4	-173.5	-1.5	111.9	V27 K62 V63 T64 Y69 L70	V27-R66 HydrophobicContact CB-CG 4.49Å; V27-R66 HydrophobicContact CG1-CB 3.68Å; V27-R66 HydrophobicContact CG1-CG 3.8Å; V27-R66 HydrophobicContact CG2-CG 3.83Å; K62-R66 WeakPolarHBondContact O-CB 3.35Å; K62-R66 PolarHBondContact O-N 3.33Å; V63-R66 PolarHBondContact O-N 3Å; T64-R66 VanDerWaalsContact C-N 3.27Å; T64-R66 PolarHBondContact O-N 3.4Å; R66-Y69 PolarHBondContact O-N 3.36Å; R66-L70 HydrophobicContact CG-CD1 4.22Å; R66-L70 WeakPolarHBondContact O-CB 2.89Å; R66-L70 VanDerWaalsContact O-CG 3.29Å; R66-L70 WeakPolarHBondContact O-CG 3.16Å; R66-L70 PolarHBondContact O-N 3.07Å
67	Q	95.7	Very high	92	Very high	123 Å²	123	105.2 Å²	105.2	58%	0.575	48%	0.482	S	S	*	.	H	α-helix	trans	-63.6	-41.9	176.6	-73.7	176.5	-8.7	0	0	111.5	V63 T64 L70 R71	V63-Q67 HydrophobicContact CG1-CG 4.33Å; V63-Q67 WeakPolarHBondContact O-CG 3.47Å; V63-Q67 PolarHBondContact O-N 2.77Å; T64-Q67 PolarHBondContact O-N 3.44Å; T64-Q67 VanDerWaalsContact O-N 3.12Å; Q67-L70 PolarHBondContact O-N 3.16Å; Q67-R71 WeakPolarHBondContact O-CB 3.17Å; Q67-R71 PolarHBondContact O-N 3.23Å
68	E	95.7	Very high	90.7	Very high	111 Å²	111	103.2 Å²	103.2	52%	0.519	48%	0.478	S	S	.	.	H	α-helix	trans	-64.1	-45.8	174.8	-73.2	174.2	174.9	0	0	112.1	T64 L70 R71 R72	T64-E68 HydrophobicContact CG2-CG 4.4Å; T64-E68 WeakPolarHBondContact O-CG 3.37Å; T64-E68 PolarHBondContact O-N 3.13Å; E68-L70 VanDerWaalsContact C-N 3.34Å; E68-L70 PolarHBondContact O-N 2.99Å; E68-R71 WeakPolarHBondContact O-CB 3.48Å; E68-R71 PolarHBondContact O-N 3.37Å; E68-R72 WeakPolarHBondContact O-CG 3.44Å; E68-R72 PolarHBondContact O-N 3.38Å
69	Y	95.1	Very high	89.4	Confident	119 Å²	119	110.5 Å²	110.5	47%	0.467	50%	0.501	S	S	.	.	H	α-helix	trans	-55.7	-50.1	173.2	167.9	-94.2	0	0	0	111	R65 R66 R71 R72 Y73	R65-Y69 WeakPolarHBondContact O-CB 3.44Å; R65-Y69 PolarHBondContact O-N 3.45Å; R66-Y69 PolarHBondContact O-N 3.36Å; Y69-R71 VanDerWaalsContact C-N 3.34Å; Y69-R71 PolarHBondContact O-N 3.28Å; Y69-R72 PolarHBondContact O-N 2.89Å; Y69-Y73 VanDerWaalsContact O-CB 3.25Å; Y69-Y73 WeakPolarHBondContact O-CB 3.35Å; Y69-Y73 PolarHBondContact O-N 2.8Å
70	L	92.6	Very high	88.2	Confident	73 Å²	73	113.3 Å²	113.3	38%	0.382	51%	0.51	S	S	.	.	H	α-helix	trans	-63.3	-40.5	179.5	-72.1	174.5	0	0	0	111.5	R66 Q67 E68 Y73 V74	R66-L70 HydrophobicContact CG-CD1 4.22Å; R66-L70 WeakPolarHBondContact O-CB 2.89Å; R66-L70 VanDerWaalsContact O-CG 3.29Å; R66-L70 WeakPolarHBondContact O-CG 3.16Å; R66-L70 PolarHBondContact O-N 3.07Å; Q67-L70 PolarHBondContact O-N 3.16Å; E68-L70 VanDerWaalsContact C-N 3.34Å; E68-L70 PolarHBondContact O-N 2.99Å; L70-Y73 PolarHBondContact O-N 3.14Å; L70-V74 WeakPolarHBondContact O-CB 3.32Å; L70-V74 VanDerWaalsContact O-CG2 3.23Å; L70-V74 WeakPolarHBondContact O-CG2 3.26Å; L70-V74 PolarHBondContact O-N 3.05Å
71	R	89.5	Confident	87.1	Confident	178 Å²	178	113 Å²	113	67%	0.672	52%	0.521	S	S	*	.	H	α-helix	trans	-57.6	-50.6	174.4	-177	-179.4	178.2	-171.7	-2.7	110.9	Q67 E68 Y69 S75	Q67-R71 WeakPolarHBondContact O-CB 3.17Å; Q67-R71 PolarHBondContact O-N 3.23Å; E68-R71 WeakPolarHBondContact O-CB 3.48Å; E68-R71 PolarHBondContact O-N 3.37Å; Y69-R71 VanDerWaalsContact C-N 3.34Å; Y69-R71 PolarHBondContact O-N 3.28Å; R71-S75 VanDerWaalsContact O-CB 3.31Å; R71-S75 WeakPolarHBondContact O-CB 3.49Å; R71-S75 PolarHBondContact O-N 2.81Å; R71-S75 PolarHBondContact O-OG 3.29Å; R71-S75 VanDerWaalsContact O-OG 3.11Å
72	R	90.9	Very high	86.1	Confident	206 Å²	206	112.6 Å²	112.6	78%	0.777	52%	0.52	S	S	*	.	H	α-helix	trans	-63.4	-45.8	178.1	-70	176.3	66.6	-175.6	1.1	112.1	E68 Y69 V74 S75 G76	E68-R72 WeakPolarHBondContact O-CG 3.44Å; E68-R72 PolarHBondContact O-N 3.38Å; Y69-R72 PolarHBondContact O-N 2.89Å; R72-V74 PolarHBondContact O-N 3.29Å; R72-S75 PolarHBondContact O-N 3.46Å; R72-G76 PolarHBondContact O-N 3.09Å
73	Y	91	Very high	85.4	Confident	101 Å²	101	110.2 Å²	110.2	40%	0.396	52%	0.515	S	S	.	.	H	α-helix	trans	-58.9	-48.4	178.6	176.3	-92.4	0	0	0	111.7	Y69 L70 G76 K77	Y69-Y73 VanDerWaalsContact O-CB 3.25Å; Y69-Y73 WeakPolarHBondContact O-CB 3.35Å; Y69-Y73 PolarHBondContact O-N 2.8Å; L70-Y73 PolarHBondContact O-N 3.14Å; Y73-G76 PolarHBondContact O-N 2.72Å; Y73-K77 HydrophobicContact CE1-CD 3.89Å; Y73-K77 HydrophobicContact CE1-CG 4.5Å; Y73-K77 HydrophobicContact CE2-CD 3.89Å; Y73-K77 VanDerWaalsContact CE2-CE 3.46Å; Y73-K77 HydrophobicContact CE2-CG 4.39Å; Y73-K77 VanDerWaalsContact CZ-CD 3.49Å; Y73-K77 VanDerWaalsContact CZ-CE 3.42Å; Y73-K77 WeakPolarHBondContact O-CB 3.38Å; Y73-K77 PolarHBondContact O-N 3.49Å; Y73-K77 VanDerWaalsContact OH-CE 3.27Å; Y73-K77 WeakPolarHBondContact OH-CE 3.4Å; Y73-K77 PolarHBondContact OH-NZ 3.01Å
74	V	87	Confident	84.9	Confident	65 Å²	65	115.8 Å²	115.8	39%	0.394	54%	0.539	S	S	.	.	H	α-helix	trans	-67.8	-43.7	179.7	173	0	0	0	0	110.9	L70 R72 G76 K78	L70-V74 WeakPolarHBondContact O-CB 3.32Å; L70-V74 VanDerWaalsContact O-CG2 3.23Å; L70-V74 WeakPolarHBondContact O-CG2 3.26Å; L70-V74 PolarHBondContact O-N 3.05Å; R72-V74 PolarHBondContact O-N 3.29Å; V74-G76 VanDerWaalsContact C-N 3.3Å; V74-G76 PolarHBondContact O-N 2.74Å; V74-K78 HydrophobicContact CG1-CD 4.11Å; V74-K78 WeakPolarHBondContact O-CB 3.35Å; V74-K78 PolarHBondContact O-N 3.19Å
75	S	83.5	Confident	84.6	Confident	46 Å²	46	113.3 Å²	113.3	32%	0.322	52%	0.523	S	S	.	.	H	α-helix	trans	-62.9	-34.7	176.3	-70.5	0	0	0	0	112.9	R71 R72 R80	R71-S75 VanDerWaalsContact O-CB 3.31Å; R71-S75 WeakPolarHBondContact O-CB 3.49Å; R71-S75 PolarHBondContact O-N 2.81Å; R71-S75 PolarHBondContact O-OG 3.29Å; R71-S75 VanDerWaalsContact O-OG 3.11Å; R72-S75 PolarHBondContact O-N 3.46Å; S75-R80 PolarHBondContact OG-NH1 3.17Å
76	G	83.2	Confident	84.3	Confident	68 Å²	68	108.2 Å²	108.2	70%	0.701	51%	0.512	S	S	*	.	H	α-helix	trans	-78.5	-38.6	178.5	0	0	0	0	0	113.9	R72 Y73 V74	R72-G76 PolarHBondContact O-N 3.09Å; Y73-G76 PolarHBondContact O-N 2.72Å; V74-G76 VanDerWaalsContact C-N 3.3Å; V74-G76 PolarHBondContact O-N 2.74Å
77	K	79.9	Confident	84.2	Confident	147 Å²	147	106.1 Å²	106.1	64%	0.639	52%	0.519	S	S	*	.	H	α-helix	trans	-79.3	-37.2	-179.6	-78.8	-154.4	172.8	-172	0	113.8	Y73	Y73-K77 HydrophobicContact CE1-CD 3.89Å; Y73-K77 HydrophobicContact CE1-CG 4.5Å; Y73-K77 HydrophobicContact CE2-CD 3.89Å; Y73-K77 VanDerWaalsContact CE2-CE 3.46Å; Y73-K77 HydrophobicContact CE2-CG 4.39Å; Y73-K77 VanDerWaalsContact CZ-CD 3.49Å; Y73-K77 VanDerWaalsContact CZ-CE 3.42Å; Y73-K77 WeakPolarHBondContact O-CB 3.38Å; Y73-K77 PolarHBondContact O-N 3.49Å; Y73-K77 VanDerWaalsContact OH-CE 3.27Å; Y73-K77 WeakPolarHBondContact OH-CE 3.4Å; Y73-K77 PolarHBondContact OH-NZ 3.01Å
78	K	65.9	Low	84.1	Confident	142 Å²	142	102.7 Å²	102.7	62%	0.617	52%	0.517	S	S	*	.	S	Bend	trans	-86	117.3	176.5	-70.8	-172.7	175.6	-177.5	0	107.5	V74 R80	V74-K78 HydrophobicContact CG1-CD 4.11Å; V74-K78 WeakPolarHBondContact O-CB 3.35Å; V74-K78 PolarHBondContact O-N 3.19Å; K78-R80 HydrophobicContact CB-CG 4.13Å; K78-R80 PolarHBondContact O-N 3.45Å
79	K	65	Low	84	Confident	197 Å²	197	99.2 Å²	99.2	86%	0.857	50%	0.502	S	S	*	.			trans	-58.5	89.5	152.9	-67.4	-173.8	-178.9	-176.5	0	106.1	N81	K79-N81 PolarHBondContact O-N 3.48Å
80	R	68.5	Low	84	Confident	87 Å²	87	97.6 Å²	97.6	33%	0.328	50%	0.504	S	S	.	.			trans	-68.9	101.7	178.9	-72.1	177.5	63.7	-179.4	-9.4	105.3	S75 K78 L82 E118	S75-R80 PolarHBondContact OG-NH1 3.17Å; K78-R80 HydrophobicContact CB-CG 4.13Å; K78-R80 PolarHBondContact O-N 3.45Å; R80-L82 HydrophobicContact CB-CD1 3.97Å; R80-L82 HydrophobicContact CB-CG 4.05Å; R80-L82 PolarHBondContact O-N 3.47Å; R80-E118 IonicContact CZ-OE1 3.8Å; R80-E118 IonicContact CZ-OE2 3.83Å; R80-E118 VanDerWaalsContact CZ-OE2 3.23Å; R80-E118 IonicContact NE-OE1 3.9Å; R80-E118 IonicContact NH1-OE1 3.98Å; R80-E118 PolarHBondContact NH1-OE1 2.99Å; R80-E118 IonicContact NH1-OE2 3.84Å; R80-E118 PolarHBondContact NH1-OE2 3.27Å; R80-E118 IonicContact NH2-OE1 3.3Å; R80-E118 PolarHBondContact NH2-OE1 3.4Å; R80-E118 IonicContact NH2-OE2 2.98Å; R80-E118 PolarHBondContact NH2-OE2 2.82Å
81	N	70.1	Confident	84	Confident	157 Å²	157	94.1 Å²	94.1	84%	0.84	49%	0.486	S	S	*	.			trans	-70.1	68	170	-66.1	-17.9	0	0	0	108.1	K79	K79-N81 PolarHBondContact O-N 3.48Å
82	L	74.9	Confident	84.2	Confident	61 Å²	61	88.9 Å²	88.9	32%	0.319	47%	0.467	S	S	.	.			trans	-74.1	125.4	172.1	-73.3	156.5	0	0	0	106.7	R80 H84 E118 A119	R80-L82 HydrophobicContact CB-CD1 3.97Å; R80-L82 HydrophobicContact CB-CG 4.05Å; R80-L82 PolarHBondContact O-N 3.47Å; L82-H84 PolarHBondContact O-N 3.22Å; L82-E118 HydrophobicContact CD1-CG 3.85Å; L82-A119 HydrophobicContact CD2-CB 3.46Å; L82-A119 VanDerWaalsContact CD2-CB 3.46Å
83	P	79.2	Confident	84.2	Confident	53 Å²	53	79.2 Å²	79.2	34%	0.344	43%	0.431	S	S	.	.			trans	-64.2	137.3	173.7	29.5	-34.2	0	0	0	108.6	L85 A131	P83-L85 HydrophobicContact CB-CD1 4.17Å; P83-L85 HydrophobicContact CB-CD2 4.32Å; P83-L85 HydrophobicContact CB-CG 3.88Å; P83-L85 HydrophobicContact CG-CD1 3.71Å; P83-L85 HydrophobicContact CG-CG 3.91Å; P83-L85 PolarHBondContact O-N 3.09Å; P83-A131 HydrophobicContact CG-CB 3.89Å
84	H	85.4	Confident	84.1	Confident	157 Å²	157	79.9 Å²	79.9	73%	0.727	43%	0.433	S	S	*	.			trans	-74.8	80.3	175.9	-174.8	73.6	0	0	0	109.3	L82 R136	L82-H84 PolarHBondContact O-N 3.22Å; H84-R136 VanDerWaalsContact O-CZ 3.24Å; H84-R136 PolarHBondContact O-NH1 3.29Å; H84-R136 PolarHBondContact O-NH2 3.39Å
85	L	90.2	Very high	83.8	Confident	13 Å²	13	78.2 Å²	78.2	7%	0.068	42%	0.421	C	S	.	.			trans	-105.7	136.2	-179.5	-58.7	175.6	0	0	0	111	P83 D89 V91 I112 Y121 L134 R136	P83-L85 HydrophobicContact CB-CD1 4.17Å; P83-L85 HydrophobicContact CB-CD2 4.32Å; P83-L85 HydrophobicContact CB-CG 3.88Å; P83-L85 HydrophobicContact CG-CD1 3.71Å; P83-L85 HydrophobicContact CG-CG 3.91Å; P83-L85 PolarHBondContact O-N 3.09Å; L85-D89 WeakPolarHBondContact CA-OD2 3.36Å; L85-V91 HydrophobicContact CD1-CG1 4.43Å; L85-V91 HydrophobicContact CD2-CG1 3.9Å; L85-I112 HydrophobicContact CB-CD1 3.69Å; L85-I112 HydrophobicContact CD1-CD1 4.03Å; L85-I112 HydrophobicContact CD2-CD1 4.45Å; L85-I112 HydrophobicContact CG-CD1 4.26Å; L85-Y121 HydrophobicContact CB-CE1 3.87Å; L85-Y121 HydrophobicContact CB-CE2 4.43Å; L85-Y121 HydrophobicContact CD1-CD2 4.4Å; L85-Y121 HydrophobicContact CD1-CE2 4.02Å; L85-L134 HydrophobicContact CD1-CB 4.19Å; L85-L134 HydrophobicContact CD1-CD1 3.68Å; L85-R136 HydrophobicContact CD2-CG 4.1Å
86	S	91.5	Very high	83.4	Confident	55 Å²	55	80.6 Å²	80.6	39%	0.385	44%	0.435	S	S	.	.			trans	-122.2	161.1	-178.6	-67.3	0	0	0	0	111.1	D89	S86-D89 PolarHBondContact N-OD2 3.07Å; S86-D89 WeakPolarHBondContact O-CB 3.27Å; S86-D89 VanDerWaalsContact O-CG 3.3Å; S86-D89 PolarHBondContact O-N 3.24Å
87	A	93.6	Very high	82.7	Confident	69 Å²	69	81.5 Å²	81.5	57%	0.57	43%	0.43	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.6	137.8	170.1	0	0	0	0	0	110.1	Q113	A87-Q113 WeakPolarHBondContact CB-O 3.25Å
88	G	94.2	Very high	81.6	Confident	52 Å²	52	79.2 Å²	79.2	54%	0.536	43%	0.433	S	S	.	.	T	Hydrogen-bonded Turn	trans	94.3	-16.2	-173.8	0	0	0	0	0	114.5	V90 I112	G88-V90 PolarHBondContact O-N 3.33Å; G88-I112 PolarHBondContact N-O 3.32Å
89	D	93.3	Very high	81.3	Confident	38 Å²	38	75.9 Å²	75.9	20%	0.203	43%	0.432	C	S	.	.			trans	-65.5	137.4	178	-71	-18.6	0	0	0	111.9	L85 S86 V91 I111 I112 R136	L85-D89 WeakPolarHBondContact CA-OD2 3.36Å; S86-D89 PolarHBondContact N-OD2 3.07Å; S86-D89 WeakPolarHBondContact O-CB 3.27Å; S86-D89 VanDerWaalsContact O-CG 3.3Å; S86-D89 PolarHBondContact O-N 3.24Å; D89-V91 HydrophobicContact CB-CG1 4.44Å; D89-I111 WeakPolarHBondContact O-CA 3.32Å; D89-I112 HydrophobicContact CB-CD1 4.13Å; D89-I112 HydrophobicContact CB-CG1 4.38Å; D89-I112 PolarHBondContact O-N 3.24Å; D89-R136 IonicContact OD1-NH2 3.76Å; D89-R136 IonicContact OD2-CZ 3.65Å; D89-R136 IonicContact OD2-NE 3.05Å; D89-R136 IonicContact OD2-NH2 2.64Å; D89-R136 PolarHBondContact OD2-NH2 3.13Å
90	V	94.5	Very high	81.2	Confident	84 Å²	84	77.1 Å²	77.1	51%	0.509	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.7	120.8	167.5	-176.2	0	0	0	0	108.6	G88 P109 T110 I111	G88-V90 PolarHBondContact O-N 3.33Å; V90-P109 HydrophobicContact CG1-CB 4.3Å; V90-T110 WeakPolarHBondContact CA-O 3.23Å; V90-I111 HydrophobicContact CG2-CG1 4.26Å
91	V	93.6	Very high	80.8	Confident	0 Å²	0	76.4 Å²	76.4	0%	0	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	149.8	177.8	-66.7	0	0	0	0	110.5	L85 D89 P109 T110 I112 M123 L134 R136	L85-V91 HydrophobicContact CD1-CG1 4.43Å; L85-V91 HydrophobicContact CD2-CG1 3.9Å; D89-V91 HydrophobicContact CB-CG1 4.44Å; V91-P109 CarbonylContact O-C 3.59Å; V91-P109 WeakPolarHBondContact O-CA 3.41Å; V91-T110 HydrophobicContact CG2-CG2 4.11Å; V91-T110 PolarHBondContact N-O 2.94Å; V91-T110 PolarHBondContact O-N 2.9Å; V91-I112 HydrophobicContact CG1-CD1 3.84Å; V91-I112 HydrophobicContact CG1-CG1 4.16Å; V91-I112 HydrophobicContact CG2-CD1 4.16Å; V91-I112 HydrophobicContact CG2-CG1 3.71Å; V91-M123 HydrophobicContact CG2-SD 3.85Å; V91-L134 HydrophobicContact CB-CB 4.46Å; V91-L134 HydrophobicContact CG2-CD1 4.44Å; V91-L134 HydrophobicContact CG2-CD2 3.95Å; V91-R136 HydrophobicContact CG1-CG 4.45Å
92	Y	92.4	Very high	80.2	Confident	68 Å²	68	75.7 Å²	75.7	27%	0.267	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	130	171.5	-69.8	-99.4	0	0	0	109	W107 Q108 P109 L134 A135 R137	Y92-W107 HydrophobicContact CD1-CB 4.13Å; Y92-W107 VanDerWaalsContact O-CZ3 3.26Å; Y92-W107 WeakPolarHBondContact O-CZ3 3.33Å; Y92-Q108 WeakPolarHBondContact CA-O 3.28Å; Y92-P109 HydrophobicContact CD1-CB 4.24Å; Y92-P109 HydrophobicContact CE1-CB 3.88Å; Y92-P109 HydrophobicContact CE1-CG 4.24Å; Y92-L134 CarbonylContact O-C 3.43Å; Y92-L134 WeakPolarHBondContact O-CA 3.21Å; Y92-A135 PolarHBondContact N-O 3Å; Y92-A135 PolarHBondContact O-N 3.13Å; Y92-R137 HydrophobicContact CD2-CB 3.9Å; Y92-R137 HydrophobicContact CD2-CG 3.91Å; Y92-R137 HydrophobicContact CE2-CB 3.67Å; Y92-R137 HydrophobicContact CE2-CG 4.13Å; Y92-R137 HydrophobicContact CG-CG 4.4Å
93	T	91.3	Very high	79.4	Confident	4 Å²	4	78.3 Å²	78.3	3%	0.025	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	132.1	176.7	50	0	0	0	0	110.7	Q95 W107 Q108 T110 M123 W129 L134	T93-Q95 PolarHBondContact O-N 3.02Å; T93-Q95 VanDerWaalsContact O-N 3.15Å; T93-Q95 PolarHBondContact OG1-NE2 3.27Å; T93-W107 VanDerWaalsContact C-CE3 3.5Å; T93-W107 WeakPolarHBondContact O-CA 3.3Å; T93-Q108 PolarHBondContact N-O 2.92Å; T93-Q108 PolarHBondContact O-N 2.98Å; T93-Q108 PolarHBondContact OG1-O 3.39Å; T93-T110 HydrophobicContact CG2-CG2 3.6Å; T93-M123 HydrophobicContact CG2-CG 4.41Å; T93-M123 HydrophobicContact CG2-SD 4.2Å; T93-W129 HydrophobicContact CG2-CD2 4.02Å; T93-W129 HydrophobicContact CG2-CG 4.01Å; T93-W129 HydrophobicContact CG2-CZ2 4.46Å; T93-L134 HydrophobicContact CG2-CD2 3.64Å
94	R	87.9	Confident	78.6	Confident	115 Å²	115	85.7 Å²	85.7	43%	0.434	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	101.1	174.7	-169.5	176.6	132.4	-128	4.4	109.6	P105 W107 W129 N133	R94-P105 HydrophobicContact CG-CB 3.49Å; R94-P105 VanDerWaalsContact CG-CB 3.49Å; R94-P105 HydrophobicContact CG-CG 3.6Å; R94-W107 HydrophobicContact CB-CD2 4.43Å; R94-W107 HydrophobicContact CB-CE3 4.1Å; R94-W107 HydrophobicContact CB-CH2 3.63Å; R94-W107 HydrophobicContact CB-CZ2 3.92Å; R94-W107 HydrophobicContact CB-CZ3 3.7Å; R94-W107 HydrophobicContact CG-CH2 4.17Å; R94-W107 HydrophobicContact CG-CZ2 3.97Å; R94-W129 WeakPolarHBondContact O-CH2 3.42Å; R94-W129 WeakPolarHBondContact O-CZ3 3.4Å; R94-N133 HydrophobicContact CB-CB 4.24Å; R94-N133 PolarHBondContact N-O 3.42Å; R94-N133 PolarHBondContact NH1-OD1 3.23Å
95	Q	82.5	Confident	77.6	Confident	30 Å²	30	80.1 Å²	80.1	14%	0.14	47%	0.471	C	S	.	.			trans	-64	140.1	176.5	-60.5	-57.1	-48.5	0	0	110	T93 S97 P105 S106 Q108	T93-Q95 PolarHBondContact O-N 3.02Å; T93-Q95 VanDerWaalsContact O-N 3.15Å; T93-Q95 PolarHBondContact OG1-NE2 3.27Å; Q95-S97 PolarHBondContact O-N 2.73Å; Q95-P105 WeakPolarHBondContact O-CB 3.37Å; Q95-S106 WeakPolarHBondContact CB-O 3.43Å; Q95-S106 WeakPolarHBondContact CG-O 3.21Å; Q95-S106 PolarHBondContact N-O 3.36Å; Q95-Q108 HydrophobicContact CG-CG 4.29Å
96	P	75	Confident	76.9	Confident	96 Å²	96	82.8 Å²	82.8	62%	0.623	49%	0.491	S	S	*	.			trans	-56.6	133.9	169.5	25.7	-32.6	0	0	0	108.1	S98	P96-S98 PolarHBondContact O-N 3.04Å
97	S	67.7	Low	76.6	Confident	87 Å²	87	83.8 Å²	83.8	61%	0.608	49%	0.486	S	S	*	.			trans	-61.1	111.7	-178.6	54.3	0	0	0	0	109.8	Q95 A99	Q95-S97 PolarHBondContact O-N 2.73Å; S97-A99 PolarHBondContact O-N 3.36Å
98	S	57.6	Low	76.2	Confident	98 Å²	98	85.4 Å²	85.4	69%	0.685	48%	0.482	S	S	*	.			trans	-69.7	120.3	168.6	-43.9	0	0	0	0	108.2	P96 H102	P96-S98 PolarHBondContact O-N 3.04Å; S98-H102 PolarHBondContact O-CD2 3.26Å
99	A	59.7	Low	76.1	Confident	73 Å²	73	86.8 Å²	86.8	60%	0.603	48%	0.482	S	S	*	.	S	Bend	trans	62	140.8	174.4	0	0	0	0	0	118	S97 G101	S97-A99 PolarHBondContact O-N 3.36Å; A99-G101 PolarHBondContact O-N 3.16Å; A99-G101 VanDerWaalsContact O-N 3.14Å
100	K	61.6	Low	76.1	Confident	222 Å²	222	86 Å²	86	97%	0.965	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.5	113.8	173	-173.6	-177.9	-176.8	-176.3	0	108.9
101	G	61.7	Low	76.1	Confident	73 Å²	73	86 Å²	86	75%	0.753	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	132.6	-14.9	174.4	0	0	0	0	0	116.1	A99	A99-G101 PolarHBondContact O-N 3.16Å; A99-G101 VanDerWaalsContact O-N 3.14Å
102	H	56.9	Low	76.2	Confident	141 Å²	141	86 Å²	86	65%	0.653	48%	0.475	S	S	*	.			trans	-89	113.2	172.8	-65.4	-68.8	0	0	0	110.5	S98 R104	S98-H102 PolarHBondContact O-CD2 3.26Å; H102-R104 VanDerWaalsContact C-N 3.27Å; H102-R104 PolarHBondContact O-N 2.84Å
103	S	57.5	Low	76.4	Confident	116 Å²	116	88.2 Å²	88.2	81%	0.811	49%	0.487	S	S	*	.	S	Bend	trans	-73.7	-9.2	-165.9	67.3	0	0	0	0	115.3
104	R	62.5	Low	76.6	Confident	208 Å²	208	90.3 Å²	90.3	79%	0.785	50%	0.502	S	S	*	.	S	Bend	trans	-140.2	131	-179.6	-65.2	-177.4	174.3	135	-1.3	110.5	H102 S106	H102-R104 VanDerWaalsContact C-N 3.27Å; H102-R104 PolarHBondContact O-N 2.84Å; R104-S106 PolarHBondContact O-N 3.43Å
105	P	64.1	Low	76.9	Confident	40 Å²	40	90 Å²	90	26%	0.26	51%	0.505	S	S	.	.			trans	-59	133.6	171.3	24.8	-31.5	0	0	0	109	R94 Q95	R94-P105 HydrophobicContact CG-CB 3.49Å; R94-P105 VanDerWaalsContact CG-CB 3.49Å; R94-P105 HydrophobicContact CG-CG 3.6Å; Q95-P105 WeakPolarHBondContact O-CB 3.37Å
106	S	76.1	Confident	77.5	Confident	70 Å²	70	91.8 Å²	91.8	49%	0.49	52%	0.518	S	S	.	.			trans	-65.3	139.2	173.1	-176.2	0	0	0	0	109.2	Q95 R104	Q95-S106 WeakPolarHBondContact CB-O 3.43Å; Q95-S106 WeakPolarHBondContact CG-O 3.21Å; Q95-S106 PolarHBondContact N-O 3.36Å; R104-S106 PolarHBondContact O-N 3.43Å
107	W	84.7	Confident	78.2	Confident	75 Å²	75	96.2 Å²	96.2	28%	0.284	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	114.4	178.3	-73.7	93.9	0	0	0	107.8	Y92 T93 R94 A135	Y92-W107 HydrophobicContact CD1-CB 4.13Å; Y92-W107 VanDerWaalsContact O-CZ3 3.26Å; Y92-W107 WeakPolarHBondContact O-CZ3 3.33Å; T93-W107 VanDerWaalsContact C-CE3 3.5Å; T93-W107 WeakPolarHBondContact O-CA 3.3Å; R94-W107 HydrophobicContact CB-CD2 4.43Å; R94-W107 HydrophobicContact CB-CE3 4.1Å; R94-W107 HydrophobicContact CB-CH2 3.63Å; R94-W107 HydrophobicContact CB-CZ2 3.92Å; R94-W107 HydrophobicContact CB-CZ3 3.7Å; R94-W107 HydrophobicContact CG-CH2 4.17Å; R94-W107 HydrophobicContact CG-CZ2 3.97Å; W107-A135 HydrophobicContact CE3-CB 4.15Å; W107-A135 HydrophobicContact CH2-CB 3.95Å; W107-A135 HydrophobicContact CZ3-CB 3.63Å
108	Q	85.1	Confident	79.1	Confident	103 Å²	103	96 Å²	96	48%	0.481	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	133	178.8	-69.1	-172.4	-7.2	0	0	110.3	Y92 T93 Q95	Y92-Q108 WeakPolarHBondContact CA-O 3.28Å; T93-Q108 PolarHBondContact N-O 2.92Å; T93-Q108 PolarHBondContact O-N 2.98Å; T93-Q108 PolarHBondContact OG1-O 3.39Å; Q95-Q108 HydrophobicContact CG-CG 4.29Å
109	P	92	Very high	80.6	Confident	82 Å²	82	92 Å²	92	53%	0.532	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.1	138.6	177.3	29.8	-33.7	0	0	0	109.8	V90 V91 Y92	V90-P109 HydrophobicContact CG1-CB 4.3Å; V91-P109 CarbonylContact O-C 3.59Å; V91-P109 WeakPolarHBondContact O-CA 3.41Å; Y92-P109 HydrophobicContact CD1-CB 4.24Å; Y92-P109 HydrophobicContact CE1-CB 3.88Å; Y92-P109 HydrophobicContact CE1-CG 4.24Å
110	T	92.7	Very high	82.2	Confident	22 Å²	22	90.1 Å²	90.1	14%	0.135	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	163.7	172.6	-158.4	0	0	0	0	109.4	V90 V91 T93 M123	V90-T110 WeakPolarHBondContact CA-O 3.23Å; V91-T110 HydrophobicContact CG2-CG2 4.11Å; V91-T110 PolarHBondContact N-O 2.94Å; V91-T110 PolarHBondContact O-N 2.9Å; T93-T110 HydrophobicContact CG2-CG2 3.6Å; T110-M123 HydrophobicContact CG2-CB 3.8Å; T110-M123 HydrophobicContact CG2-CG 3.59Å; T110-M123 HydrophobicContact CG2-SD 3.32Å; T110-M123 WeakPolarHBondContact CG2-SD 3.44Å
111	I	94.9	Very high	83.8	Confident	82 Å²	82	79.8 Å²	79.8	42%	0.421	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	136.9	-177.7	-60.1	172.3	0	0	0	109	D89 V90 Q113 M123 A124	D89-I111 WeakPolarHBondContact O-CA 3.32Å; V90-I111 HydrophobicContact CG2-CG1 4.26Å; I111-Q113 PolarHBondContact O-N 3.45Å; I111-M123 CarbonylContact O-C 3.49Å; I111-M123 VanDerWaalsContact O-CA 3.23Å; I111-M123 WeakPolarHBondContact O-CA 3.42Å; I111-A124 HydrophobicContact CB-CB 4.22Å; I111-A124 PolarHBondContact O-N 2.77Å
112	I	96	Very high	85.5	Confident	2 Å²	2	81 Å²	81	1%	0.01	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	121.1	171.5	-58.2	-173.5	0	0	0	109.2	L85 G88 D89 V91 Y121 M123	L85-I112 HydrophobicContact CB-CD1 3.69Å; L85-I112 HydrophobicContact CD1-CD1 4.03Å; L85-I112 HydrophobicContact CD2-CD1 4.45Å; L85-I112 HydrophobicContact CG-CD1 4.26Å; G88-I112 PolarHBondContact N-O 3.32Å; D89-I112 HydrophobicContact CB-CD1 4.13Å; D89-I112 HydrophobicContact CB-CG1 4.38Å; D89-I112 PolarHBondContact O-N 3.24Å; V91-I112 HydrophobicContact CG1-CD1 3.84Å; V91-I112 HydrophobicContact CG1-CG1 4.16Å; V91-I112 HydrophobicContact CG2-CD1 4.16Å; V91-I112 HydrophobicContact CG2-CG1 3.71Å; I112-Y121 HydrophobicContact CD1-CD1 4.17Å; I112-Y121 HydrophobicContact CD1-CG 4.42Å; I112-Y121 HydrophobicContact CG2-CD1 3.88Å; I112-Y121 HydrophobicContact CG2-CG 4.46Å; I112-M123 HydrophobicContact CB-CE 4.32Å; I112-M123 HydrophobicContact CG1-CE 3.82Å; I112-M123 HydrophobicContact CG1-SD 4.27Å; I112-M123 HydrophobicContact CG2-CE 4.33Å
113	Q	96.1	Very high	87.3	Confident	113 Å²	113	74.2 Å²	74.2	53%	0.528	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.9	-47.8	174	-172.1	-175.6	22	0	0	111.4	A87 I111 R122	A87-Q113 WeakPolarHBondContact CB-O 3.25Å; I111-Q113 PolarHBondContact O-N 3.45Å; Q113-R122 WeakPolarHBondContact CB-O 3.45Å; Q113-R122 PolarHBondContact N-O 3.41Å
114	S	95.7	Very high	89	Confident	48 Å²	48	71.9 Å²	71.9	34%	0.336	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.9	160.2	-178.8	61.5	0	0	0	0	112.8	Y121 R122	S114-Y121 WeakPolarHBondContact O-CA 3.18Å; S114-R122 PolarHBondContact N-O 3.01Å; S114-R122 PolarHBondContact O-N 3.26Å
115	Q	94.9	Very high	90.4	Very high	108 Å²	108	66 Å²	66	51%	0.505	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	121.1	171.9	-169.6	177	23.4	0	0	110	R117 E118 Y121	Q115-R117 WeakPolarHBondContact CG-O 3.32Å; Q115-R117 PolarHBondContact NE2-O 3.09Å; Q115-E118 PolarHBondContact NE2-O 2.95Å; Q115-Y121 HydrophobicContact CB-CD1 4.01Å; Q115-Y121 HydrophobicContact CB-CE1 3.99Å; Q115-Y121 HydrophobicContact CG-CD1 4.02Å; Q115-Y121 HydrophobicContact CG-CE1 3.74Å
116	V	94.3	Very high	91.8	Very high	68 Å²	68	65.7 Å²	65.7	41%	0.412	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	-40.4	-179.8	-175.9	0	0	0	0	111.1	T120 R122	V116-T120 HydrophobicContact CB-CG2 4.25Å; V116-T120 PolarHBondContact N-O 3.13Å; V116-R122 HydrophobicContact CG2-CB 3.81Å
117	R	90.1	Very high	92.6	Very high	190 Å²	190	68.8 Å²	68.8	72%	0.717	35%	0.348	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145.1	171.3	173.1	-58.4	-173.9	175.6	-141.9	-2.6	108.7	Q115 A119 T120	Q115-R117 WeakPolarHBondContact CG-O 3.32Å; Q115-R117 PolarHBondContact NE2-O 3.09Å; R117-A119 PolarHBondContact O-N 2.87Å; R117-T120 PolarHBondContact N-O 3.19Å; R117-T120 PolarHBondContact O-N 3.18Å
118	E	86.2	Confident	93.1	Very high	82 Å²	82	68.7 Å²	68.7	38%	0.383	36%	0.356	S	S	.	.	T	Hydrogen-bonded Turn	trans	-45	-36.5	-176.4	-167.2	-177.8	169.1	0	0	115.4	R80 L82 Q115	R80-E118 IonicContact CZ-OE1 3.8Å; R80-E118 IonicContact CZ-OE2 3.83Å; R80-E118 VanDerWaalsContact CZ-OE2 3.23Å; R80-E118 IonicContact NE-OE1 3.9Å; R80-E118 IonicContact NH1-OE1 3.98Å; R80-E118 PolarHBondContact NH1-OE1 2.99Å; R80-E118 IonicContact NH1-OE2 3.84Å; R80-E118 PolarHBondContact NH1-OE2 3.27Å; R80-E118 IonicContact NH2-OE1 3.3Å; R80-E118 PolarHBondContact NH2-OE1 3.4Å; R80-E118 IonicContact NH2-OE2 2.98Å; R80-E118 PolarHBondContact NH2-OE2 2.82Å; L82-E118 HydrophobicContact CD1-CG 3.85Å; Q115-E118 PolarHBondContact NE2-O 2.95Å
119	A	89.9	Confident	93.5	Very high	15 Å²	15	65.5 Å²	65.5	12%	0.124	34%	0.339	C	S	.	.	T	Hydrogen-bonded Turn	trans	-123.4	20.6	176.9	0	0	0	0	0	112.7	L82 R117 N130 A131	L82-A119 HydrophobicContact CD2-CB 3.46Å; L82-A119 VanDerWaalsContact CD2-CB 3.46Å; R117-A119 PolarHBondContact O-N 2.87Å; A119-N130 CarbonylContact O-C 3.6Å; A119-N130 VanDerWaalsContact O-CA 3.3Å; A119-N130 WeakPolarHBondContact O-CA 3.46Å; A119-N130 PolarHBondContact O-ND2 3.35Å; A119-A131 HydrophobicContact CB-CB 4.18Å; A119-A131 PolarHBondContact O-N 2.95Å
120	T	93.6	Very high	93.5	Very high	32 Å²	32	64.9 Å²	64.9	20%	0.196	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	122.2	-170.2	-53.6	0	0	0	0	109.2	V116 R117 V128 W129	V116-T120 HydrophobicContact CB-CG2 4.25Å; V116-T120 PolarHBondContact N-O 3.13Å; R117-T120 PolarHBondContact N-O 3.19Å; R117-T120 PolarHBondContact O-N 3.18Å; T120-V128 HydrophobicContact CG2-CG1 3.26Å; T120-W129 WeakPolarHBondContact CA-O 3.49Å
121	Y	95.2	Very high	93.4	Very high	6 Å²	6	64.2 Å²	64.2	2%	0.024	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	143.4	-172.1	-61.1	-91.1	0	0	0	109.9	L85 I112 S114 Q115 M123 V128 W129 A131 L134	L85-Y121 HydrophobicContact CB-CE1 3.87Å; L85-Y121 HydrophobicContact CB-CE2 4.43Å; L85-Y121 HydrophobicContact CD1-CD2 4.4Å; L85-Y121 HydrophobicContact CD1-CE2 4.02Å; I112-Y121 HydrophobicContact CD1-CD1 4.17Å; I112-Y121 HydrophobicContact CD1-CG 4.42Å; I112-Y121 HydrophobicContact CG2-CD1 3.88Å; I112-Y121 HydrophobicContact CG2-CG 4.46Å; S114-Y121 WeakPolarHBondContact O-CA 3.18Å; Q115-Y121 HydrophobicContact CB-CD1 4.01Å; Q115-Y121 HydrophobicContact CB-CE1 3.99Å; Q115-Y121 HydrophobicContact CG-CD1 4.02Å; Q115-Y121 HydrophobicContact CG-CE1 3.74Å; Y121-M123 HydrophobicContact CG-CE 4.49Å; Y121-V128 CarbonylContact O-C 3.18Å; Y121-V128 WeakPolarHBondContact O-CA 3.49Å; Y121-W129 PolarHBondContact N-O 3.16Å; Y121-W129 PolarHBondContact O-N 3.22Å; Y121-A131 HydrophobicContact CD2-CB 4.49Å; Y121-A131 HydrophobicContact CE2-CB 3.98Å; Y121-L134 HydrophobicContact CD2-CD1 3.77Å; Y121-L134 HydrophobicContact CG-CD1 4.23Å
122	R	96.3	Very high	93.1	Very high	97 Å²	97	64.6 Å²	64.6	37%	0.366	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	131.2	170.2	-177.5	-178	-64.8	-94.1	5.3	108.2	Q113 S114 V116 G126 R127 V128	Q113-R122 WeakPolarHBondContact CB-O 3.45Å; Q113-R122 PolarHBondContact N-O 3.41Å; S114-R122 PolarHBondContact N-O 3.01Å; S114-R122 PolarHBondContact O-N 3.26Å; V116-R122 HydrophobicContact CG2-CB 3.81Å; R122-G126 PolarHBondContact NH1-O 3.41Å; R122-R127 WeakPolarHBondContact CA-O 3.24Å; R122-V128 HydrophobicContact CB-CG2 4.47Å
123	M	94.5	Very high	92.9	Very high	0 Å²	0	66.2 Å²	66.2	0%	0	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	169.1	178.6	-49	-68.2	96.5	0	0	110.3	V91 T93 T110 I111 I112 Y121 D125 G126 R127 W129 L134	V91-M123 HydrophobicContact CG2-SD 3.85Å; T93-M123 HydrophobicContact CG2-CG 4.41Å; T93-M123 HydrophobicContact CG2-SD 4.2Å; T110-M123 HydrophobicContact CG2-CB 3.8Å; T110-M123 HydrophobicContact CG2-CG 3.59Å; T110-M123 HydrophobicContact CG2-SD 3.32Å; T110-M123 WeakPolarHBondContact CG2-SD 3.44Å; I111-M123 CarbonylContact O-C 3.49Å; I111-M123 VanDerWaalsContact O-CA 3.23Å; I111-M123 WeakPolarHBondContact O-CA 3.42Å; I112-M123 HydrophobicContact CB-CE 4.32Å; I112-M123 HydrophobicContact CG1-CE 3.82Å; I112-M123 HydrophobicContact CG1-SD 4.27Å; I112-M123 HydrophobicContact CG2-CE 4.33Å; Y121-M123 HydrophobicContact CG-CE 4.49Å; M123-D125 WeakPolarHBondContact CB-OD1 3.4Å; M123-D125 PolarHBondContact O-N 2.93Å; M123-G126 PolarHBondContact O-N 3.44Å; M123-R127 PolarHBondContact N-O 3.43Å; M123-W129 VanDerWaalsContact CG-CD1 3.43Å; M123-W129 HydrophobicContact CG-CG 4.43Å; M123-L134 HydrophobicContact CE-CD1 4.29Å; M123-L134 HydrophobicContact SD-CD2 4.16Å
124	A	93.8	Very high	92.6	Very high	67 Å²	67	61.7 Å²	61.7	55%	0.554	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-26.4	178.5	0	0	0	0	0	113.7	I111 G126	I111-A124 HydrophobicContact CB-CB 4.22Å; I111-A124 PolarHBondContact O-N 2.77Å; A124-G126 PolarHBondContact O-N 3.49Å
125	D	91.9	Very high	92.3	Very high	83 Å²	83	60.8 Å²	60.8	44%	0.444	32%	0.322	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.8	0.7	173.8	71.5	-2.6	0	0	0	113.6	M123 R127	M123-D125 WeakPolarHBondContact CB-OD1 3.4Å; M123-D125 PolarHBondContact O-N 2.93Å; D125-R127 VanDerWaalsContact C-N 3.28Å; D125-R127 PolarHBondContact O-N 3.38Å; D125-R127 VanDerWaalsContact OD1-CB 3.22Å; D125-R127 WeakPolarHBondContact OD1-CB 3.39Å; D125-R127 WeakPolarHBondContact OD1-CG 3.45Å; D125-R127 PolarHBondContact OD1-N 2.96Å; D125-R127 VanDerWaalsContact OD2-CD 3.28Å; D125-R127 WeakPolarHBondContact OD2-CD 3.26Å; D125-R127 IonicContact OD2-NE 2.8Å; D125-R127 IonicContact OD2-NH1 3.58Å
126	G	93.8	Very high	91.8	Very high	34 Å²	34	62.3 Å²	62.3	35%	0.351	32%	0.323	S	S	.	.	S	Bend	trans	82.9	-9.2	-178.3	0	0	0	0	0	115	R122 M123 A124	R122-G126 PolarHBondContact NH1-O 3.41Å; M123-G126 PolarHBondContact O-N 3.44Å; A124-G126 PolarHBondContact O-N 3.49Å
127	R	93.2	Very high	91	Very high	136 Å²	136	70 Å²	70	51%	0.513	35%	0.345	S	S	.	.			trans	-71.4	153.3	177.6	-62.1	-178	178.6	162.9	-4.6	111	R122 M123 D125	R122-R127 WeakPolarHBondContact CA-O 3.24Å; M123-R127 PolarHBondContact N-O 3.43Å; D125-R127 VanDerWaalsContact C-N 3.28Å; D125-R127 PolarHBondContact O-N 3.38Å; D125-R127 VanDerWaalsContact OD1-CB 3.22Å; D125-R127 WeakPolarHBondContact OD1-CB 3.39Å; D125-R127 WeakPolarHBondContact OD1-CG 3.45Å; D125-R127 PolarHBondContact OD1-N 2.96Å; D125-R127 VanDerWaalsContact OD2-CD 3.28Å; D125-R127 WeakPolarHBondContact OD2-CD 3.26Å; D125-R127 IonicContact OD2-NE 2.8Å; D125-R127 IonicContact OD2-NH1 3.58Å
128	V	94.7	Very high	91	Very high	73 Å²	73	64.1 Å²	64.1	44%	0.442	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	126.1	-178.1	-179.5	0	0	0	0	109.8	T120 Y121 R122	T120-V128 HydrophobicContact CG2-CG1 3.26Å; Y121-V128 CarbonylContact O-C 3.18Å; Y121-V128 WeakPolarHBondContact O-CA 3.49Å; R122-V128 HydrophobicContact CB-CG2 4.47Å
129	W	93.1	Very high	91.3	Very high	35 Å²	35	63.1 Å²	63.1	13%	0.133	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	145.1	-176.6	-68.5	89.2	0	0	0	111.7	T93 R94 T120 Y121 M123 N133 L134	T93-W129 HydrophobicContact CG2-CD2 4.02Å; T93-W129 HydrophobicContact CG2-CG 4.01Å; T93-W129 HydrophobicContact CG2-CZ2 4.46Å; R94-W129 WeakPolarHBondContact O-CH2 3.42Å; R94-W129 WeakPolarHBondContact O-CZ3 3.4Å; T120-W129 WeakPolarHBondContact CA-O 3.49Å; Y121-W129 PolarHBondContact N-O 3.16Å; Y121-W129 PolarHBondContact O-N 3.22Å; M123-W129 VanDerWaalsContact CG-CD1 3.43Å; M123-W129 HydrophobicContact CG-CG 4.43Å; W129-N133 HydrophobicContact CE3-CB 3.74Å; W129-N133 HydrophobicContact CZ3-CB 4.2Å; W129-L134 HydrophobicContact CB-CD2 3.86Å; W129-L134 HydrophobicContact CB-CG 4.4Å; W129-L134 HydrophobicContact CG-CD2 4.33Å
130	N	92.6	Very high	91.3	Very high	69 Å²	69	65.8 Å²	65.8	37%	0.369	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	143.6	165.4	-171.1	-79	0	0	0	109.8	A119 S132 N133	A119-N130 CarbonylContact O-C 3.6Å; A119-N130 VanDerWaalsContact O-CA 3.3Å; A119-N130 WeakPolarHBondContact O-CA 3.46Å; A119-N130 PolarHBondContact O-ND2 3.35Å; N130-S132 PolarHBondContact O-N 2.69Å; N130-S132 WeakPolarHBondContact OD1-CB 3.38Å; N130-S132 PolarHBondContact OD1-N 3.47Å; N130-S132 PolarHBondContact OD1-OG 3.35Å; N130-S132 VanDerWaalsContact OD1-OG 3.07Å; N130-N133 WeakPolarHBondContact O-CB 3.42Å; N130-N133 PolarHBondContact O-N 2.98Å
131	A	91.3	Very high	91.2	Very high	9 Å²	9	67.8 Å²	67.8	7%	0.074	34%	0.342	C	S	.	.	G	3₁₀ helix	trans	-49.9	-32.6	176.5	0	0	0	0	0	113.4	P83 A119 Y121 N133 L134	P83-A131 HydrophobicContact CG-CB 3.89Å; A119-A131 HydrophobicContact CB-CB 4.18Å; A119-A131 PolarHBondContact O-N 2.95Å; Y121-A131 HydrophobicContact CD2-CB 4.49Å; Y121-A131 HydrophobicContact CE2-CB 3.98Å; A131-N133 PolarHBondContact O-N 3.07Å; A131-N133 VanDerWaalsContact O-N 3.15Å; A131-L134 PolarHBondContact O-N 3.1Å
132	S	89	Confident	91	Very high	89 Å²	89	71.6 Å²	71.6	62%	0.622	36%	0.362	S	S	*	.	G	3₁₀ helix	trans	-63.9	-15.6	176.9	71.7	0	0	0	0	114.3	N130	N130-S132 PolarHBondContact O-N 2.69Å; N130-S132 WeakPolarHBondContact OD1-CB 3.38Å; N130-S132 PolarHBondContact OD1-N 3.47Å; N130-S132 PolarHBondContact OD1-OG 3.35Å; N130-S132 VanDerWaalsContact OD1-OG 3.07Å
133	N	90	Very high	90.6	Very high	36 Å²	36	69.9 Å²	69.9	19%	0.193	36%	0.362	C	S	.	.	G	3₁₀ helix	trans	-106.4	9.7	177.9	-63.5	-40.7	0	0	0	112.1	R94 W129 N130 A131	R94-N133 HydrophobicContact CB-CB 4.24Å; R94-N133 PolarHBondContact N-O 3.42Å; R94-N133 PolarHBondContact NH1-OD1 3.23Å; W129-N133 HydrophobicContact CE3-CB 3.74Å; W129-N133 HydrophobicContact CZ3-CB 4.2Å; N130-N133 WeakPolarHBondContact O-CB 3.42Å; N130-N133 PolarHBondContact O-N 2.98Å; A131-N133 PolarHBondContact O-N 3.07Å; A131-N133 VanDerWaalsContact O-N 3.15Å
134	L	90.8	Very high	90.3	Very high	18 Å²	18	74.9 Å²	74.9	9%	0.094	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	143	178.3	-56.8	-179.2	0	0	0	109.8	L85 V91 Y92 T93 Y121 M123 W129 A131	L85-L134 HydrophobicContact CD1-CB 4.19Å; L85-L134 HydrophobicContact CD1-CD1 3.68Å; V91-L134 HydrophobicContact CB-CB 4.46Å; V91-L134 HydrophobicContact CG2-CD1 4.44Å; V91-L134 HydrophobicContact CG2-CD2 3.95Å; Y92-L134 CarbonylContact O-C 3.43Å; Y92-L134 WeakPolarHBondContact O-CA 3.21Å; T93-L134 HydrophobicContact CG2-CD2 3.64Å; Y121-L134 HydrophobicContact CD2-CD1 3.77Å; Y121-L134 HydrophobicContact CG-CD1 4.23Å; M123-L134 HydrophobicContact CE-CD1 4.29Å; M123-L134 HydrophobicContact SD-CD2 4.16Å; W129-L134 HydrophobicContact CB-CD2 3.86Å; W129-L134 HydrophobicContact CB-CG 4.4Å; W129-L134 HydrophobicContact CG-CD2 4.33Å; A131-L134 PolarHBondContact O-N 3.1Å
135	A	88.9	Confident	90.1	Very high	29 Å²	29	75.5 Å²	75.5	24%	0.24	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	140.7	172.4	0	0	0	0	0	110.2	Y92 W107	Y92-A135 PolarHBondContact N-O 3Å; Y92-A135 PolarHBondContact O-N 3.13Å; W107-A135 HydrophobicContact CE3-CB 4.15Å; W107-A135 HydrophobicContact CH2-CB 3.95Å; W107-A135 HydrophobicContact CZ3-CB 3.63Å
136	R	84.6	Confident	89.9	Confident	140 Å²	140	74.9 Å²	74.9	53%	0.528	37%	0.369	S	S	.	.			trans	-88.4	133.1	160.8	-72.3	-178.9	171.7	167.5	-0.3	107.3	H84 L85 D89 V91	H84-R136 VanDerWaalsContact O-CZ 3.24Å; H84-R136 PolarHBondContact O-NH1 3.29Å; H84-R136 PolarHBondContact O-NH2 3.39Å; L85-R136 HydrophobicContact CD2-CG 4.1Å; D89-R136 IonicContact OD1-NH2 3.76Å; D89-R136 IonicContact OD2-CZ 3.65Å; D89-R136 IonicContact OD2-NE 3.05Å; D89-R136 IonicContact OD2-NH2 2.64Å; D89-R136 PolarHBondContact OD2-NH2 3.13Å; V91-R136 HydrophobicContact CG1-CG 4.45Å
137	R	76.9	Confident	89.6	Confident	231 Å²	231	78.6 Å²	78.6	87%	0.872	37%	0.371	S	S	*	.			trans	-120.9	0	170.8	-69.9	-171.4	174.6	-155.3	0.5	108.7	Y92	Y92-R137 HydrophobicContact CD2-CB 3.9Å; Y92-R137 HydrophobicContact CD2-CG 3.91Å; Y92-R137 HydrophobicContact CE2-CB 3.67Å; Y92-R137 HydrophobicContact CE2-CG 4.13Å; Y92-R137 HydrophobicContact CG-CG 4.4Å

Retrieved 137 of 137 residues in 23.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).