A0A077ZJ57_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJ57, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 96 aa.

						>A0A077ZJ57_TRITR|A0A077ZJ57
MSIRRGIRRSRSGEDGSGMDMSALTSLIEERIQAAVAPFASAVAELTQEVRKRSVSQQQRINGSEEGDDSRRAEEKCMPNRAADDLSWIEGSDTSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52	Low	63.5	Low	244 Å²	244	179 Å²	179	100%	1.202	84%	0.842	S	S	*	*				0	121.8	0	-60.9	-178.2	-158.2	0	0	107.7
2	S	65.7	Low	62.8	Low	115 Å²	115	173.2 Å²	173.2	80%	0.804	84%	0.836	S	S	*	*			trans	-88.4	117.1	-167.4	-178.6	0	0	0	0	111.4	R4	S2-R4 PolarHBondContact O-N 2.8Å
3	I	65.5	Low	61.8	Low	154 Å²	154	165.4 Å²	165.4	79%	0.79	83%	0.828	S	S	*	*			trans	-85	96	179.1	-56.6	169.6	0	0	0	107.7	R5	I3-R5 PolarHBondContact O-N 3.47Å
4	R	71	Confident	60.9	Low	235 Å²	235	164.1 Å²	164.1	89%	0.887	82%	0.818	S	S	*	*			trans	-70.2	97.1	169.1	-64.6	-172.8	-159.6	-144.2	4.3	108.3	S2 G6	S2-R4 PolarHBondContact O-N 2.8Å; R4-G6 PolarHBondContact O-N 2.83Å
5	R	68.9	Low	60.5	Low	229 Å²	229	164.7 Å²	164.7	86%	0.864	83%	0.826	S	S	*	*			trans	-65.1	86	164.4	-83	178.9	163.5	163	-5.3	108.4	I3 I7	I3-R5 PolarHBondContact O-N 3.47Å; R5-I7 VanDerWaalsContact C-N 3.33Å; R5-I7 PolarHBondContact O-N 3.14Å
6	G	68.6	Low	60.2	Low	67 Å²	67	159.1 Å²	159.1	69%	0.691	82%	0.822	S	S	*	*			trans	-69	93	167.1	0	0	0	0	0	108.8	R4 R8	R4-G6 PolarHBondContact O-N 2.83Å; G6-R8 PolarHBondContact O-N 2.99Å
7	I	64.6	Low	59.9	Low	156 Å²	156	157.5 Å²	157.5	80%	0.8	83%	0.828	S	S	*	*			trans	-69.9	86.6	162.9	-57.2	171.2	0	0	0	105.3	R5 R9	R5-I7 VanDerWaalsContact C-N 3.33Å; R5-I7 PolarHBondContact O-N 3.14Å; I7-R9 PolarHBondContact O-N 3.44Å
8	R	66.8	Low	59.8	Low	235 Å²	235	152.4 Å²	152.4	89%	0.887	82%	0.82	S	S	*	*			trans	-67.1	96.7	163.2	-77.1	-171.1	-175.7	-171.1	2	105.8	G6 S10	G6-R8 PolarHBondContact O-N 2.99Å; R8-S10 PolarHBondContact O-N 2.76Å
9	R	62	Low	59.9	Low	217 Å²	217	151.8 Å²	151.8	82%	0.819	81%	0.813	S	S	*	*			trans	-49.4	103.8	168	-174.9	-178.1	-69.2	-152.4	-1.1	107.3	I7 R11	I7-R9 PolarHBondContact O-N 3.44Å; R9-R11 VanDerWaalsContact C-N 3.32Å; R9-R11 PolarHBondContact O-N 3.37Å
10	S	59.5	Low	60.9	Low	101 Å²	101	149.3 Å²	149.3	71%	0.706	80%	0.799	S	S	*	*			trans	-59.4	100.7	165.1	-54.8	0	0	0	0	106.6	R8 S12	R8-S10 PolarHBondContact O-N 2.76Å; S10-S12 PolarHBondContact O-N 3.4Å
11	R	53.6	Low	62.1	Low	216 Å²	216	148.4 Å²	148.4	82%	0.815	79%	0.792	S	S	*	*			trans	-70.9	76.3	153.1	-85	-172.7	175.1	-168.5	-0.3	105.8	R9 G13	R9-R11 VanDerWaalsContact C-N 3.32Å; R9-R11 PolarHBondContact O-N 3.37Å; R11-G13 VanDerWaalsContact C-N 3.32Å
12	S	55.4	Low	64	Low	109 Å²	109	139.7 Å²	139.7	76%	0.762	76%	0.755	S	S	*	*			trans	-96.6	73.2	163.1	53.1	0	0	0	0	105.9	S10	S10-S12 PolarHBondContact O-N 3.4Å
13	G	50.6	Low	65.2	Low	72 Å²	72	137 Å²	137	74%	0.742	74%	0.74	S	S	*	*			trans	-149.3	5.3	-177.8	0	0	0	0	0	113.5	R11	R11-G13 VanDerWaalsContact C-N 3.32Å
14	E	49.2	Very low	66.4	Low	147 Å²	147	132.6 Å²	132.6	69%	0.687	72%	0.718	S	S	*	*	S	Bend	trans	-119	140.8	163.2	-82.9	160.2	97	0	0	104.6
15	D	54.9	Low	67.5	Low	174 Å²	174	124.5 Å²	124.5	93%	0.93	69%	0.694	S	S	*	*	S	Bend	trans	103.2	85.3	-178.3	-50.9	-22.6	0	0	0	114.5
16	G	54.5	Low	68.8	Low	75 Å²	75	116.9 Å²	116.9	77%	0.773	68%	0.676	S	S	*	*	S	Bend	trans	165.9	-21.2	156.7	0	0	0	0	0	117.7	G18	G16-G18 PolarHBondContact O-N 3.39Å
17	S	55	Low	70.1	Confident	132 Å²	132	117.5 Å²	117.5	92%	0.923	66%	0.663	S	S	*	*	S	Bend	trans	-101.2	66.6	-173.7	68.7	0	0	0	0	112.6
18	G	59.8	Low	71.5	Confident	65 Å²	65	114.1 Å²	114.1	67%	0.67	65%	0.646	S	S	*	*			trans	-171.2	62.3	171.8	0	0	0	0	0	108.2	G16 D20	G16-G18 PolarHBondContact O-N 3.39Å; G18-D20 VanDerWaalsContact C-N 3.34Å; G18-D20 PolarHBondContact O-N 3.26Å
19	M	60.5	Low	72.9	Confident	142 Å²	142	107.8 Å²	107.8	70%	0.7	63%	0.626	S	S	*	*			trans	-51.7	114.5	156.4	-78.2	179.4	75.6	0	0	105	M21	M19-M21 PolarHBondContact O-N 2.81Å
20	D	80.4	Confident	74.6	Confident	100 Å²	100	103.4 Å²	103.4	54%	0.535	62%	0.615	S	S	.	*			trans	-51.1	118	177.3	-176.9	-6.7	0	0	0	106.7	G18 S22 A23 L24	G18-D20 VanDerWaalsContact C-N 3.34Å; G18-D20 PolarHBondContact O-N 3.26Å; D20-S22 PolarHBondContact O-N 3Å; D20-S22 VanDerWaalsContact OD1-CB 3.29Å; D20-S22 WeakPolarHBondContact OD1-CB 3.31Å; D20-S22 PolarHBondContact OD1-N 3.26Å; D20-S22 PolarHBondContact OD1-OG 3.23Å; D20-S22 PolarHBondContact OD2-OG 3.48Å; D20-A23 HydrophobicContact CB-CB 4.39Å; D20-A23 WeakPolarHBondContact O-CB 3.32Å; D20-A23 PolarHBondContact O-N 3.46Å; D20-L24 PolarHBondContact O-N 3.39Å
21	M	86.7	Confident	76.3	Confident	131 Å²	131	107.2 Å²	107.2	65%	0.645	61%	0.614	S	S	*	*	H	α-helix	trans	-55.4	-25.2	-179.5	-72.5	-66.6	-66.9	0	0	110.5	M19 L24 T25	M19-M21 PolarHBondContact O-N 2.81Å; M21-L24 HydrophobicContact SD-CD2 4.35Å; M21-T25 WeakPolarHBondContact O-CB 3.47Å; M21-T25 PolarHBondContact O-N 3.48Å; M21-T25 PolarHBondContact O-OG1 2.97Å
22	S	90.9	Very high	78.3	Confident	62 Å²	62	101.7 Å²	101.7	43%	0.434	60%	0.599	S	S	.	*	H	α-helix	trans	-61.1	-48	171.8	82.6	0	0	0	0	111.9	D20 L24 T25 S26	D20-S22 PolarHBondContact O-N 3Å; D20-S22 VanDerWaalsContact OD1-CB 3.29Å; D20-S22 WeakPolarHBondContact OD1-CB 3.31Å; D20-S22 PolarHBondContact OD1-N 3.26Å; D20-S22 PolarHBondContact OD1-OG 3.23Å; D20-S22 PolarHBondContact OD2-OG 3.48Å; S22-L24 PolarHBondContact O-N 2.81Å; S22-T25 WeakPolarHBondContact O-CB 3.4Å; S22-T25 PolarHBondContact O-N 3.3Å; S22-S26 PolarHBondContact O-N 2.89Å; S22-S26 PolarHBondContact O-OG 2.75Å
23	A	91	Very high	80.2	Confident	57 Å²	57	103 Å²	103	47%	0.471	59%	0.594	S	S	.	*	H	α-helix	trans	-65.9	-39.6	179.7	0	0	0	0	0	112	D20 L27	D20-A23 HydrophobicContact CB-CB 4.39Å; D20-A23 WeakPolarHBondContact O-CB 3.32Å; D20-A23 PolarHBondContact O-N 3.46Å; A23-L27 WeakPolarHBondContact O-CB 3.49Å; A23-L27 PolarHBondContact O-N 2.86Å
24	L	91.3	Very high	82.3	Confident	63 Å²	63	103 Å²	103	33%	0.33	59%	0.586	S	S	.	*	H	α-helix	trans	-63	-43.9	173.7	178.9	61.6	0	0	0	111.2	D20 M21 S22 L27 I28	D20-L24 PolarHBondContact O-N 3.39Å; M21-L24 HydrophobicContact SD-CD2 4.35Å; S22-L24 PolarHBondContact O-N 2.81Å; L24-L27 PolarHBondContact O-N 3.04Å; L24-I28 HydrophobicContact CD1-CD1 4.13Å; L24-I28 HydrophobicContact CD1-CG1 4.47Å; L24-I28 HydrophobicContact CG-CD1 3.99Å; L24-I28 VanDerWaalsContact O-CG1 3.3Å; L24-I28 WeakPolarHBondContact O-CG1 3.38Å; L24-I28 PolarHBondContact O-N 3.48Å
25	T	93.8	Very high	84.5	Confident	64 Å²	64	98.8 Å²	98.8	39%	0.393	58%	0.577	S	S	.	*	H	α-helix	trans	-62.1	-47.1	178.3	-56.7	0	0	0	0	110.9	M21 S22 L27 I28 E29	M21-T25 WeakPolarHBondContact O-CB 3.47Å; M21-T25 PolarHBondContact O-N 3.48Å; M21-T25 PolarHBondContact O-OG1 2.97Å; S22-T25 WeakPolarHBondContact O-CB 3.4Å; S22-T25 PolarHBondContact O-N 3.3Å; T25-L27 VanDerWaalsContact C-N 3.33Å; T25-L27 PolarHBondContact O-N 3.48Å; T25-I28 WeakPolarHBondContact O-CB 3.32Å; T25-I28 PolarHBondContact O-N 2.79Å; T25-I28 VanDerWaalsContact O-N 3.12Å; T25-E29 WeakPolarHBondContact O-CG 3.46Å; T25-E29 PolarHBondContact O-N 3.07Å
26	S	95.2	Very high	86.5	Confident	70 Å²	70	94.4 Å²	94.4	49%	0.49	56%	0.556	S	S	.	*	H	α-helix	trans	-60.2	-41	177.2	-61.5	0	0	0	0	112.6	S22 I28 E29 E30	S22-S26 PolarHBondContact O-N 2.89Å; S22-S26 PolarHBondContact O-OG 2.75Å; S26-I28 VanDerWaalsContact C-N 3.32Å; S26-I28 PolarHBondContact O-N 2.87Å; S26-E29 PolarHBondContact O-N 3.32Å; S26-E30 WeakPolarHBondContact O-CB 3.31Å; S26-E30 PolarHBondContact O-N 2.95Å
27	L	96	Very high	88.2	Confident	79 Å²	79	94 Å²	94	41%	0.414	55%	0.546	S	S	.	.	H	α-helix	trans	-64.2	-37.6	176.1	-176.4	69.1	0	0	0	112	A23 L24 T25 R31	A23-L27 WeakPolarHBondContact O-CB 3.49Å; A23-L27 PolarHBondContact O-N 2.86Å; L24-L27 PolarHBondContact O-N 3.04Å; T25-L27 VanDerWaalsContact C-N 3.33Å; T25-L27 PolarHBondContact O-N 3.48Å; L27-R31 WeakPolarHBondContact O-CG 3.44Å; L27-R31 PolarHBondContact O-N 2.89Å; L27-R31 VanDerWaalsContact O-N 3.11Å
28	I	95.4	Very high	90.2	Very high	85 Å²	85	91.6 Å²	91.6	44%	0.436	53%	0.527	S	S	.	.	H	α-helix	trans	-67.4	-46.3	176.3	-69.8	165.7	0	0	0	110.3	L24 T25 S26 E30 R31 I32	L24-I28 HydrophobicContact CD1-CD1 4.13Å; L24-I28 HydrophobicContact CD1-CG1 4.47Å; L24-I28 HydrophobicContact CG-CD1 3.99Å; L24-I28 VanDerWaalsContact O-CG1 3.3Å; L24-I28 WeakPolarHBondContact O-CG1 3.38Å; L24-I28 PolarHBondContact O-N 3.48Å; T25-I28 WeakPolarHBondContact O-CB 3.32Å; T25-I28 PolarHBondContact O-N 2.79Å; T25-I28 VanDerWaalsContact O-N 3.12Å; S26-I28 VanDerWaalsContact C-N 3.32Å; S26-I28 PolarHBondContact O-N 2.87Å; I28-E30 PolarHBondContact O-N 2.72Å; I28-R31 PolarHBondContact O-N 2.94Å; I28-I32 HydrophobicContact CG2-CD1 3.72Å; I28-I32 HydrophobicContact CG2-CG1 4.38Å; I28-I32 VanDerWaalsContact O-CG1 3.31Å; I28-I32 WeakPolarHBondContact O-CG1 3.36Å; I28-I32 PolarHBondContact O-N 3.48Å
29	E	96.2	Very high	91.9	Very high	102 Å²	102	95.5 Å²	95.5	48%	0.477	53%	0.526	S	S	.	.	H	α-helix	trans	-59.4	-45.1	177.3	-72.9	176.6	174.9	0	0	111.8	T25 S26 R31 I32 Q33	T25-E29 WeakPolarHBondContact O-CG 3.46Å; T25-E29 PolarHBondContact O-N 3.07Å; S26-E29 PolarHBondContact O-N 3.32Å; E29-R31 VanDerWaalsContact C-N 3.34Å; E29-R31 PolarHBondContact O-N 3.34Å; E29-I32 PolarHBondContact O-N 3.4Å; E29-Q33 WeakPolarHBondContact O-CB 3.3Å; E29-Q33 VanDerWaalsContact O-CG 3.3Å; E29-Q33 WeakPolarHBondContact O-CG 3.37Å; E29-Q33 PolarHBondContact O-N 3.32Å
30	E	95.9	Very high	93.6	Very high	125 Å²	125	91.2 Å²	91.2	58%	0.584	51%	0.513	S	S	*	.	H	α-helix	trans	-58.4	-45.6	175.7	-174.9	-172.9	175.2	0	0	111.3	S26 I28 I32 Q33 A34	S26-E30 WeakPolarHBondContact O-CB 3.31Å; S26-E30 PolarHBondContact O-N 2.95Å; I28-E30 PolarHBondContact O-N 2.72Å; E30-I32 PolarHBondContact O-N 3.24Å; E30-Q33 PolarHBondContact O-N 3.2Å; E30-A34 WeakPolarHBondContact O-CB 3.49Å; E30-A34 PolarHBondContact O-N 3.01Å
31	R	95.9	Very high	94.4	Very high	182 Å²	182	89.2 Å²	89.2	69%	0.687	51%	0.507	S	S	*	.	H	α-helix	trans	-65.2	-39	178	-77.1	-173.2	177.1	-130.7	0.7	112.8	L27 I28 E29 A35	L27-R31 WeakPolarHBondContact O-CG 3.44Å; L27-R31 PolarHBondContact O-N 2.89Å; L27-R31 VanDerWaalsContact O-N 3.11Å; I28-R31 PolarHBondContact O-N 2.94Å; E29-R31 VanDerWaalsContact C-N 3.34Å; E29-R31 PolarHBondContact O-N 3.34Å; R31-A35 WeakPolarHBondContact O-CB 3.46Å; R31-A35 PolarHBondContact O-N 2.85Å; R31-A35 VanDerWaalsContact O-N 3.08Å
32	I	95.8	Very high	94.9	Very high	99 Å²	99	85.5 Å²	85.5	51%	0.508	50%	0.497	S	S	.	.	H	α-helix	trans	-63.8	-48.5	175.2	-69	167.8	0	0	0	109.4	I28 E29 E30 A34 A35 V36	I28-I32 HydrophobicContact CG2-CD1 3.72Å; I28-I32 HydrophobicContact CG2-CG1 4.38Å; I28-I32 VanDerWaalsContact O-CG1 3.31Å; I28-I32 WeakPolarHBondContact O-CG1 3.36Å; I28-I32 PolarHBondContact O-N 3.48Å; E29-I32 PolarHBondContact O-N 3.4Å; E30-I32 PolarHBondContact O-N 3.24Å; I32-A34 VanDerWaalsContact C-N 3.33Å; I32-A34 PolarHBondContact O-N 3.01Å; I32-A35 PolarHBondContact O-N 3.45Å; I32-A35 VanDerWaalsContact O-N 3.1Å; I32-V36 HydrophobicContact CG2-CG2 4.24Å; I32-V36 VanDerWaalsContact O-CG2 3.25Å; I32-V36 WeakPolarHBondContact O-CG2 3.26Å; I32-V36 PolarHBondContact O-N 3.25Å
33	Q	95.6	Very high	95.2	Very high	138 Å²	138	85.7 Å²	85.7	65%	0.645	50%	0.495	S	S	*	.	H	α-helix	trans	-59.7	-43.1	178.7	-72.4	176.1	7.4	0	0	112.2	E29 E30 A35 V36	E29-Q33 WeakPolarHBondContact O-CB 3.3Å; E29-Q33 VanDerWaalsContact O-CG 3.3Å; E29-Q33 WeakPolarHBondContact O-CG 3.37Å; E29-Q33 PolarHBondContact O-N 3.32Å; E30-Q33 PolarHBondContact O-N 3.2Å; Q33-A35 VanDerWaalsContact C-N 3.28Å; Q33-A35 PolarHBondContact O-N 2.93Å; Q33-V36 PolarHBondContact O-N 3.42Å
34	A	95	Very high	95.5	Very high	70 Å²	70	85.8 Å²	85.8	58%	0.579	50%	0.496	S	S	*	.	H	α-helix	trans	-63	-32.7	176.3	0	0	0	0	0	112.8	E30 I32 P38	E30-A34 WeakPolarHBondContact O-CB 3.49Å; E30-A34 PolarHBondContact O-N 3.01Å; I32-A34 VanDerWaalsContact C-N 3.33Å; I32-A34 PolarHBondContact O-N 3.01Å; A34-P38 WeakPolarHBondContact O-CD 3.3Å
35	A	94.1	Very high	95.9	Very high	60 Å²	60	88.6 Å²	88.6	50%	0.496	51%	0.508	S	S	.	.	H	α-helix	trans	-80.8	-27	177.9	0	0	0	0	0	113.6	R31 I32 Q33 P38 F39	R31-A35 WeakPolarHBondContact O-CB 3.46Å; R31-A35 PolarHBondContact O-N 2.85Å; R31-A35 VanDerWaalsContact O-N 3.08Å; I32-A35 PolarHBondContact O-N 3.45Å; I32-A35 VanDerWaalsContact O-N 3.1Å; Q33-A35 VanDerWaalsContact C-N 3.28Å; Q33-A35 PolarHBondContact O-N 2.93Å; A35-P38 WeakPolarHBondContact O-CD 3.49Å; A35-P38 WeakPolarHBondContact O-CG 3.47Å; A35-F39 PolarHBondContact O-N 2.93Å
36	V	96.7	Very high	96.1	Very high	82 Å²	82	91 Å²	91	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-67.2	-40.1	-178.6	167.5	0	0	0	0	111.9	I32 Q33 F39 A40	I32-V36 HydrophobicContact CG2-CG2 4.24Å; I32-V36 VanDerWaalsContact O-CG2 3.25Å; I32-V36 WeakPolarHBondContact O-CG2 3.26Å; I32-V36 PolarHBondContact O-N 3.25Å; Q33-V36 PolarHBondContact O-N 3.42Å; V36-F39 PolarHBondContact O-N 3.22Å; V36-A40 WeakPolarHBondContact O-CB 3.36Å; V36-A40 PolarHBondContact O-N 2.93Å
37	A	91.8	Very high	96.1	Very high	67 Å²	67	91 Å²	91	55%	0.554	51%	0.514	S	S	*	.	H	α-helix	trans	-59.6	-52.9	-179	0	0	0	0	0	114.4	F39 A40 S41	A37-F39 VanDerWaalsContact C-N 3.29Å; A37-F39 PolarHBondContact O-N 2.88Å; A37-A40 PolarHBondContact O-N 3.01Å; A37-S41 PolarHBondContact O-N 3.34Å
38	P	95.9	Very high	96.2	Very high	81 Å²	81	92.1 Å²	92.1	53%	0.526	52%	0.517	S	S	.	.	H	α-helix	trans	-64.6	-34.4	177.4	24.6	-33.5	0	0	0	112.1	A34 A35 S41 A42	A34-P38 WeakPolarHBondContact O-CD 3.3Å; A35-P38 WeakPolarHBondContact O-CD 3.49Å; A35-P38 WeakPolarHBondContact O-CG 3.47Å; P38-S41 PolarHBondContact O-N 3.16Å; P38-A42 WeakPolarHBondContact O-CB 3.41Å; P38-A42 PolarHBondContact O-N 3.15Å
39	F	95.8	Very high	96.3	Very high	146 Å²	146	91.5 Å²	91.5	64%	0.64	51%	0.513	S	S	*	.	H	α-helix	trans	-63.9	-46.5	174.8	-178.7	-100.6	0	0	0	111.9	A35 V36 A37 S41 A42 V43	A35-F39 PolarHBondContact O-N 2.93Å; V36-F39 PolarHBondContact O-N 3.22Å; A37-F39 VanDerWaalsContact C-N 3.29Å; A37-F39 PolarHBondContact O-N 2.88Å; F39-S41 VanDerWaalsContact C-N 3.31Å; F39-S41 PolarHBondContact O-N 3.44Å; F39-A42 PolarHBondContact O-N 3.04Å; F39-V43 HydrophobicContact CD1-CG2 4.26Å; F39-V43 HydrophobicContact CE1-CG2 3.84Å; F39-V43 HydrophobicContact CE2-CG2 4.25Å; F39-V43 HydrophobicContact CZ-CG2 3.83Å; F39-V43 WeakPolarHBondContact O-CG2 3.44Å; F39-V43 PolarHBondContact O-N 3.34Å
40	A	96.1	Very high	96.3	Very high	52 Å²	52	90.7 Å²	90.7	43%	0.43	52%	0.515	S	S	.	.	H	α-helix	trans	-60.7	-40	176.7	0	0	0	0	0	112	V36 A37 V43 A44	V36-A40 WeakPolarHBondContact O-CB 3.36Å; V36-A40 PolarHBondContact O-N 2.93Å; A37-A40 PolarHBondContact O-N 3.01Å; A40-V43 PolarHBondContact O-N 3.46Å; A40-A44 WeakPolarHBondContact O-CB 3.47Å; A40-A44 PolarHBondContact O-N 2.99Å
41	S	97.1	Very high	96.3	Very high	59 Å²	59	92.4 Å²	92.4	41%	0.413	52%	0.516	S	S	.	.	H	α-helix	trans	-61.7	-49.2	174.3	-163.6	0	0	0	0	111.6	A37 P38 F39 V43 A44 E45	A37-S41 PolarHBondContact O-N 3.34Å; P38-S41 PolarHBondContact O-N 3.16Å; F39-S41 VanDerWaalsContact C-N 3.31Å; F39-S41 PolarHBondContact O-N 3.44Å; S41-V43 VanDerWaalsContact C-N 3.3Å; S41-V43 PolarHBondContact O-N 2.98Å; S41-A44 WeakPolarHBondContact O-CB 3.49Å; S41-A44 PolarHBondContact O-N 3.33Å; S41-A44 VanDerWaalsContact O-N 3.11Å; S41-E45 WeakPolarHBondContact O-CG 3.49Å; S41-E45 PolarHBondContact O-N 2.57Å; S41-E45 PolarHBondContact OG-OE1 2.92Å
42	A	97.3	Very high	96.2	Very high	53 Å²	53	88.9 Å²	88.9	44%	0.438	51%	0.505	S	S	.	.	H	α-helix	trans	-59.8	-40.1	179.5	0	0	0	0	0	112.3	P38 F39 L46	P38-A42 WeakPolarHBondContact O-CB 3.41Å; P38-A42 PolarHBondContact O-N 3.15Å; F39-A42 PolarHBondContact O-N 3.04Å; A42-L46 WeakPolarHBondContact O-CB 3.11Å; A42-L46 PolarHBondContact O-N 2.97Å
43	V	98.1	Very high	96	Very high	66 Å²	66	91.9 Å²	91.9	40%	0.4	51%	0.51	S	S	.	.	H	α-helix	trans	-66.4	-40.4	175.7	171.7	0	0	0	0	111.5	F39 A40 S41 T47	F39-V43 HydrophobicContact CD1-CG2 4.26Å; F39-V43 HydrophobicContact CE1-CG2 3.84Å; F39-V43 HydrophobicContact CE2-CG2 4.25Å; F39-V43 HydrophobicContact CZ-CG2 3.83Å; F39-V43 WeakPolarHBondContact O-CG2 3.44Å; F39-V43 PolarHBondContact O-N 3.34Å; A40-V43 PolarHBondContact O-N 3.46Å; S41-V43 VanDerWaalsContact C-N 3.3Å; S41-V43 PolarHBondContact O-N 2.98Å; V43-T47 VanDerWaalsContact O-CB 3.32Å; V43-T47 WeakPolarHBondContact O-CB 3.35Å; V43-T47 PolarHBondContact O-N 2.88Å; V43-T47 PolarHBondContact O-OG1 3.25Å
44	A	97.6	Very high	95.8	Very high	59 Å²	59	88.2 Å²	88.2	49%	0.488	50%	0.5	S	S	.	.	H	α-helix	trans	-64.4	-45	177.3	0	0	0	0	0	111.7	A40 S41 T47 Q48	A40-A44 WeakPolarHBondContact O-CB 3.47Å; A40-A44 PolarHBondContact O-N 2.99Å; S41-A44 WeakPolarHBondContact O-CB 3.49Å; S41-A44 PolarHBondContact O-N 3.33Å; S41-A44 VanDerWaalsContact O-N 3.11Å; A44-T47 PolarHBondContact O-N 2.92Å; A44-Q48 WeakPolarHBondContact O-CB 3.4Å; A44-Q48 PolarHBondContact O-N 3.41Å
45	E	97.8	Very high	95.5	Very high	122 Å²	122	88.2 Å²	88.2	57%	0.57	49%	0.493	S	S	*	.	H	α-helix	trans	-61.6	-46.9	176.4	-73.3	171.3	-145.1	0	0	111.7	S41 T47 Q48 E49	S41-E45 WeakPolarHBondContact O-CG 3.49Å; S41-E45 PolarHBondContact O-N 2.57Å; S41-E45 PolarHBondContact OG-OE1 2.92Å; E45-T47 VanDerWaalsContact C-N 3.33Å; E45-T47 PolarHBondContact O-N 3.11Å; E45-Q48 PolarHBondContact O-N 3.04Å; E45-E49 PolarHBondContact O-N 3.3Å
46	L	98	Very high	95.1	Very high	115 Å²	115	88.3 Å²	88.3	60%	0.602	49%	0.489	S	S	*	.	H	α-helix	trans	-60.4	-44.4	176.3	178.6	61.3	0	0	0	111.4	A42 Q48 E49 V50	A42-L46 WeakPolarHBondContact O-CB 3.11Å; A42-L46 PolarHBondContact O-N 2.97Å; L46-Q48 VanDerWaalsContact C-N 3.31Å; L46-Q48 PolarHBondContact O-N 3.01Å; L46-E49 PolarHBondContact O-N 2.75Å; L46-V50 HydrophobicContact CD1-CG2 4.18Å; L46-V50 HydrophobicContact CG-CG2 4.45Å; L46-V50 WeakPolarHBondContact O-CB 3.45Å; L46-V50 VanDerWaalsContact O-CG2 3.3Å; L46-V50 WeakPolarHBondContact O-CG2 3.32Å; L46-V50 PolarHBondContact O-N 3.06Å
47	T	97.1	Very high	94.7	Very high	68 Å²	68	90.4 Å²	90.4	42%	0.417	49%	0.494	S	S	.	.	H	α-helix	trans	-61.7	-41.1	178	-60.1	0	0	0	0	111.2	V43 A44 E45 R51	V43-T47 VanDerWaalsContact O-CB 3.32Å; V43-T47 WeakPolarHBondContact O-CB 3.35Å; V43-T47 PolarHBondContact O-N 2.88Å; V43-T47 PolarHBondContact O-OG1 3.25Å; A44-T47 PolarHBondContact O-N 2.92Å; E45-T47 VanDerWaalsContact C-N 3.33Å; E45-T47 PolarHBondContact O-N 3.11Å; T47-R51 WeakPolarHBondContact O-CB 3.32Å; T47-R51 PolarHBondContact O-N 2.85Å
48	Q	97.3	Very high	94.4	Very high	103 Å²	103	91.9 Å²	91.9	48%	0.481	49%	0.489	S	S	.	.	H	α-helix	trans	-64.7	-43.2	176.7	-171.7	-175.8	2.4	0	0	111.5	A44 E45 L46 R51 K52	A44-Q48 WeakPolarHBondContact O-CB 3.4Å; A44-Q48 PolarHBondContact O-N 3.41Å; E45-Q48 PolarHBondContact O-N 3.04Å; L46-Q48 VanDerWaalsContact C-N 3.31Å; L46-Q48 PolarHBondContact O-N 3.01Å; Q48-R51 PolarHBondContact O-N 3.35Å; Q48-K52 WeakPolarHBondContact O-CG 3.38Å; Q48-K52 PolarHBondContact O-N 3.43Å
49	E	96.8	Very high	93.9	Very high	72 Å²	72	94.1 Å²	94.1	34%	0.336	49%	0.493	S	S	.	.	H	α-helix	trans	-66.5	-43.3	179.1	-174.7	58	-157.4	0	0	111.8	E45 L46 R51 K52 R53	E45-E49 PolarHBondContact O-N 3.3Å; L46-E49 PolarHBondContact O-N 2.75Å; E49-R51 VanDerWaalsContact C-N 3.3Å; E49-R51 PolarHBondContact O-N 3.4Å; E49-K52 PolarHBondContact O-N 3.4Å; E49-R53 WeakPolarHBondContact O-CG 3.36Å; E49-R53 PolarHBondContact O-N 3.07Å; E49-R53 IonicContact OE1-CZ 3.47Å; E49-R53 IonicContact OE1-NE 2.89Å; E49-R53 PolarHBondContact OE1-NE 3.31Å; E49-R53 IonicContact OE1-NH2 3.2Å; E49-R53 PolarHBondContact OE1-NH2 3.1Å
50	V	96.6	Very high	93.3	Very high	86 Å²	86	97 Å²	97	52%	0.521	50%	0.499	S	S	.	.	H	α-helix	trans	-59	-43.1	173.5	170.5	0	0	0	0	110.8	L46 R53 S54	L46-V50 HydrophobicContact CD1-CG2 4.18Å; L46-V50 HydrophobicContact CG-CG2 4.45Å; L46-V50 WeakPolarHBondContact O-CB 3.45Å; L46-V50 VanDerWaalsContact O-CG2 3.3Å; L46-V50 WeakPolarHBondContact O-CG2 3.32Å; L46-V50 PolarHBondContact O-N 3.06Å; V50-R53 PolarHBondContact O-N 2.91Å; V50-S54 WeakPolarHBondContact O-CB 3.43Å; V50-S54 PolarHBondContact O-N 3.08Å; V50-S54 PolarHBondContact O-OG 2.88Å
51	R	95.1	Very high	92.6	Very high	161 Å²	161	98.8 Å²	98.8	61%	0.608	50%	0.501	S	S	*	.	H	α-helix	trans	-64.5	-42.3	176.7	-171.4	-176.4	-63.3	154.3	1.8	112.3	T47 Q48 E49 R53 S54 V55	T47-R51 WeakPolarHBondContact O-CB 3.32Å; T47-R51 PolarHBondContact O-N 2.85Å; Q48-R51 PolarHBondContact O-N 3.35Å; E49-R51 VanDerWaalsContact C-N 3.3Å; E49-R51 PolarHBondContact O-N 3.4Å; R51-R53 VanDerWaalsContact C-N 3.32Å; R51-R53 PolarHBondContact O-N 2.96Å; R51-S54 WeakPolarHBondContact CA-OG 3.25Å; R51-S54 PolarHBondContact O-N 3.37Å; R51-S54 PolarHBondContact O-OG 2.88Å; R51-V55 WeakPolarHBondContact O-CB 3.09Å; R51-V55 VanDerWaalsContact O-CG2 3.26Å; R51-V55 WeakPolarHBondContact O-CG2 3.33Å; R51-V55 PolarHBondContact O-N 3.31Å
52	K	94.2	Very high	91.8	Very high	107 Å²	107	100.3 Å²	100.3	47%	0.465	50%	0.504	S	S	.	.	H	α-helix	trans	-60.7	-44	175.8	-74.7	173.1	-178.7	171.6	0	111.1	Q48 E49 S56	Q48-K52 WeakPolarHBondContact O-CG 3.38Å; Q48-K52 PolarHBondContact O-N 3.43Å; E49-K52 PolarHBondContact O-N 3.4Å; K52-S56 WeakPolarHBondContact O-CB 3.37Å; K52-S56 PolarHBondContact O-N 3.23Å; K52-S56 PolarHBondContact O-OG 3.26Å
53	R	92.4	Very high	90.2	Very high	163 Å²	163	100.4 Å²	100.4	62%	0.615	51%	0.511	S	S	*	.	H	α-helix	trans	-67.3	-42.4	178.6	-70.7	-178.2	-171.5	-174.6	1.8	112.3	E49 V50 R51 S56 Q57	E49-R53 WeakPolarHBondContact O-CG 3.36Å; E49-R53 PolarHBondContact O-N 3.07Å; E49-R53 IonicContact OE1-CZ 3.47Å; E49-R53 IonicContact OE1-NE 2.89Å; E49-R53 PolarHBondContact OE1-NE 3.31Å; E49-R53 IonicContact OE1-NH2 3.2Å; E49-R53 PolarHBondContact OE1-NH2 3.1Å; V50-R53 PolarHBondContact O-N 2.91Å; R51-R53 VanDerWaalsContact C-N 3.32Å; R51-R53 PolarHBondContact O-N 2.96Å; R53-S56 PolarHBondContact O-N 3.44Å; R53-Q57 VanDerWaalsContact O-CB 3.3Å; R53-Q57 WeakPolarHBondContact O-CB 3.41Å; R53-Q57 PolarHBondContact O-N 3.49Å
54	S	91.5	Very high	88.3	Confident	60 Å²	60	101.5 Å²	101.5	42%	0.42	52%	0.521	S	S	.	.	H	α-helix	trans	-65.3	-41.5	178.4	66.7	0	0	0	0	112	V50 R51 Q57 Q58	V50-S54 WeakPolarHBondContact O-CB 3.43Å; V50-S54 PolarHBondContact O-N 3.08Å; V50-S54 PolarHBondContact O-OG 2.88Å; R51-S54 WeakPolarHBondContact CA-OG 3.25Å; R51-S54 PolarHBondContact O-N 3.37Å; R51-S54 PolarHBondContact O-OG 2.88Å; S54-Q57 PolarHBondContact O-N 3.33Å; S54-Q58 WeakPolarHBondContact O-CB 3.3Å; S54-Q58 PolarHBondContact O-N 3.45Å
55	V	89.2	Confident	86.4	Confident	71 Å²	71	106.7 Å²	106.7	43%	0.43	54%	0.535	S	S	.	.	H	α-helix	trans	-62.8	-45.1	173.7	172.4	0	0	0	0	110.9	R51 Q57 Q58 Q59	R51-V55 WeakPolarHBondContact O-CB 3.09Å; R51-V55 VanDerWaalsContact O-CG2 3.26Å; R51-V55 WeakPolarHBondContact O-CG2 3.33Å; R51-V55 PolarHBondContact O-N 3.31Å; V55-Q57 VanDerWaalsContact C-N 3.34Å; V55-Q57 PolarHBondContact O-N 2.87Å; V55-Q58 PolarHBondContact O-N 3.1Å; V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CB 3.46Å; V55-Q59 VanDerWaalsContact O-CG 3.31Å; V55-Q59 WeakPolarHBondContact O-CG 3.36Å; V55-Q59 PolarHBondContact O-N 3.11Å
56	S	85.6	Confident	84.1	Confident	61 Å²	61	110 Å²	110	43%	0.427	55%	0.551	S	S	.	*	H	α-helix	trans	-63.6	-40.3	178.2	-56.6	0	0	0	0	111.9	K52 R53 Q59 R60	K52-S56 WeakPolarHBondContact O-CB 3.37Å; K52-S56 PolarHBondContact O-N 3.23Å; K52-S56 PolarHBondContact O-OG 3.26Å; R53-S56 PolarHBondContact O-N 3.44Å; S56-Q59 PolarHBondContact O-N 3.39Å; S56-R60 VanDerWaalsContact O-CG 3.32Å; S56-R60 WeakPolarHBondContact O-CG 3.31Å; S56-R60 PolarHBondContact O-N 2.91Å
57	Q	87.5	Confident	81.8	Confident	127 Å²	127	107.3 Å²	107.3	59%	0.593	55%	0.551	S	S	*	*	H	α-helix	trans	-66.1	-43.7	176.2	-175.4	176.7	-0.5	0	0	111.2	R53 S54 V55 Q59 R60 I61	R53-Q57 VanDerWaalsContact O-CB 3.3Å; R53-Q57 WeakPolarHBondContact O-CB 3.41Å; R53-Q57 PolarHBondContact O-N 3.49Å; S54-Q57 PolarHBondContact O-N 3.33Å; V55-Q57 VanDerWaalsContact C-N 3.34Å; V55-Q57 PolarHBondContact O-N 2.87Å; Q57-Q59 VanDerWaalsContact C-N 3.35Å; Q57-Q59 PolarHBondContact O-N 3.04Å; Q57-R60 PolarHBondContact O-N 3.12Å; Q57-I61 HydrophobicContact CG-CD1 4.1Å; Q57-I61 WeakPolarHBondContact O-CG1 3.45Å; Q57-I61 PolarHBondContact O-N 3.04Å
58	Q	86	Confident	79.5	Confident	98 Å²	98	110.5 Å²	110.5	46%	0.458	57%	0.565	S	S	.	*	H	α-helix	trans	-63.3	-40.7	176.5	-169.5	66	54.2	0	0	111.9	S54 V55 R60 I61 N62	S54-Q58 WeakPolarHBondContact O-CB 3.3Å; S54-Q58 PolarHBondContact O-N 3.45Å; V55-Q58 PolarHBondContact O-N 3.1Å; Q58-R60 VanDerWaalsContact C-N 3.32Å; Q58-R60 PolarHBondContact O-N 3.39Å; Q58-I61 PolarHBondContact O-N 3.36Å; Q58-N62 PolarHBondContact NE2-ND2 3.47Å; Q58-N62 PolarHBondContact NE2-OD1 2.93Å; Q58-N62 WeakPolarHBondContact O-CB 3.47Å; Q58-N62 PolarHBondContact O-N 2.9Å
59	Q	85.3	Confident	77.3	Confident	127 Å²	127	114.2 Å²	114.2	59%	0.593	59%	0.589	S	S	*	*	H	α-helix	trans	-63.2	-38.1	175	-75.9	176	-14.3	0	0	112.1	V55 S56 Q57 G63	V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CB 3.46Å; V55-Q59 VanDerWaalsContact O-CG 3.31Å; V55-Q59 WeakPolarHBondContact O-CG 3.36Å; V55-Q59 PolarHBondContact O-N 3.11Å; S56-Q59 PolarHBondContact O-N 3.39Å; Q57-Q59 VanDerWaalsContact C-N 3.35Å; Q57-Q59 PolarHBondContact O-N 3.04Å; Q59-G63 WeakPolarHBondContact O-CA 3.3Å; Q59-G63 PolarHBondContact O-N 3.36Å
60	R	81.8	Confident	75.1	Confident	206 Å²	206	114.4 Å²	114.4	78%	0.777	60%	0.598	S	S	*	*	H	α-helix	trans	-66.1	-37.7	174.4	-72.7	177	69	177.1	2.3	112.4	S56 Q57 Q58 S64	S56-R60 VanDerWaalsContact O-CG 3.32Å; S56-R60 WeakPolarHBondContact O-CG 3.31Å; S56-R60 PolarHBondContact O-N 2.91Å; Q57-R60 PolarHBondContact O-N 3.12Å; Q58-R60 VanDerWaalsContact C-N 3.32Å; Q58-R60 PolarHBondContact O-N 3.39Å; R60-S64 WeakPolarHBondContact O-CB 3.5Å; R60-S64 PolarHBondContact O-N 2.89Å
61	I	81.7	Confident	72.6	Confident	91 Å²	91	121.1 Å²	121.1	47%	0.467	61%	0.614	S	S	.	*	H	α-helix	trans	-68.4	-51.8	177	-66.5	164.1	0	0	0	109.8	Q57 Q58 S64	Q57-I61 HydrophobicContact CG-CD1 4.1Å; Q57-I61 WeakPolarHBondContact O-CG1 3.45Å; Q57-I61 PolarHBondContact O-N 3.04Å; Q58-I61 PolarHBondContact O-N 3.36Å; I61-S64 PolarHBondContact O-N 3.2Å
62	N	80.1	Confident	70.3	Confident	90 Å²	90	126 Å²	126	48%	0.481	63%	0.632	S	S	.	*	H	α-helix	trans	-73.5	-35.4	-175.5	-65.8	1.6	0	0	0	113.1	Q58 S64 E65	Q58-N62 PolarHBondContact NE2-ND2 3.47Å; Q58-N62 PolarHBondContact NE2-OD1 2.93Å; Q58-N62 WeakPolarHBondContact O-CB 3.47Å; Q58-N62 PolarHBondContact O-N 2.9Å; N62-S64 PolarHBondContact O-N 2.94Å; N62-E65 PolarHBondContact O-N 3.47Å
63	G	64.3	Low	68.2	Low	56 Å²	56	124.9 Å²	124.9	58%	0.577	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-10.9	177.9	0	0	0	0	0	113.7	Q59 E65	Q59-G63 WeakPolarHBondContact O-CA 3.3Å; Q59-G63 PolarHBondContact O-N 3.36Å; G63-E65 VanDerWaalsContact C-N 3.33Å
64	S	58.8	Low	66	Low	88 Å²	88	126.6 Å²	126.6	62%	0.615	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.1	-17.2	174	-169.2	0	0	0	0	112.8	R60 I61 N62	R60-S64 WeakPolarHBondContact O-CB 3.5Å; R60-S64 PolarHBondContact O-N 2.89Å; I61-S64 PolarHBondContact O-N 3.2Å; N62-S64 PolarHBondContact O-N 2.94Å
65	E	56.4	Low	64.2	Low	169 Å²	169	132.6 Å²	132.6	79%	0.79	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	-9.8	-174.8	-66.6	-168.5	140.2	0	0	114.1	N62 G63	N62-E65 PolarHBondContact O-N 3.47Å; G63-E65 VanDerWaalsContact C-N 3.33Å
66	E	51.2	Low	62.5	Low	191 Å²	191	138.3 Å²	138.3	89%	0.893	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.5	4	172.6	-65.3	-169	159.8	0	0	113.1	D68	E66-D68 PolarHBondContact O-N 3.19Å
67	G	49.3	Very low	61.2	Low	58 Å²	58	141.1 Å²	141.1	60%	0.598	72%	0.716	S	S	*	*	S	Bend	trans	-99.2	77.6	-178.7	0	0	0	0	0	113.9
68	D	48.8	Very low	59.8	Low	136 Å²	136	142 Å²	142	73%	0.727	72%	0.722	S	S	*	*			trans	68.3	91.4	152	-142.3	-2.3	0	0	0	117.6	E66 S70	E66-D68 PolarHBondContact O-N 3.19Å; D68-S70 PolarHBondContact O-N 2.87Å; D68-S70 VanDerWaalsContact OD1-CB 3.31Å; D68-S70 WeakPolarHBondContact OD1-CB 3.44Å
69	D	50.2	Low	58.5	Low	181 Å²	181	142.7 Å²	142.7	97%	0.968	74%	0.735	S	S	*	*			trans	-68.8	51.4	162.9	-150.6	3	0	0	0	111.1
70	S	50.9	Low	57.3	Low	75 Å²	75	143.1 Å²	143.1	52%	0.524	74%	0.742	S	S	.	*			trans	-130.6	109.1	178.4	-140.8	0	0	0	0	111.4	D68	D68-S70 PolarHBondContact O-N 2.87Å; D68-S70 VanDerWaalsContact OD1-CB 3.31Å; D68-S70 WeakPolarHBondContact OD1-CB 3.44Å
71	R	44.7	Very low	56.1	Low	228 Å²	228	144 Å²	144	86%	0.86	75%	0.745	S	S	*	*			trans	84.1	73.7	165.8	-54.8	-179.8	175.8	-169.8	-2.3	115.8	A73	R71-A73 PolarHBondContact O-N 3.15Å
72	R	45.4	Very low	55	Low	264 Å²	264	143.3 Å²	143.3	100%	0.996	75%	0.753	S	S	*	*			trans	-37.4	80.8	130.9	-158.9	-177.7	-150.1	-134.6	6.6	111.6
73	A	50.2	Low	54.2	Low	82 Å²	82	142.7 Å²	142.7	68%	0.678	76%	0.76	S	S	*	*			trans	-115.7	134.1	160.6	0	0	0	0	0	107.4	R71 E75	R71-A73 PolarHBondContact O-N 3.15Å; A73-E75 PolarHBondContact O-N 2.69Å; A73-E75 VanDerWaalsContact O-N 3.14Å
74	E	47	Very low	54.3	Low	200 Å²	200	146.8 Å²	146.8	94%	0.935	77%	0.769	S	S	*	*			trans	-64.1	105.7	-165.2	-59.6	167.9	140.5	0	0	112.4
75	E	53.9	Low	55	Low	186 Å²	186	146.9 Å²	146.9	87%	0.869	76%	0.763	S	S	*	*			trans	-121.4	112.4	153.5	-93.3	-173.7	159.7	0	0	108.9	A73 C77	A73-E75 PolarHBondContact O-N 2.69Å; A73-E75 VanDerWaalsContact O-N 3.14Å; E75-C77 PolarHBondContact O-N 3.01Å
76	K	53.5	Low	55.6	Low	191 Å²	191	143.7 Å²	143.7	83%	0.83	75%	0.75	S	S	*	*			trans	-58.2	83.1	168.6	-78.5	164.7	172.8	169.5	0	108.8	M78	K76-M78 VanDerWaalsContact C-N 3.3Å; K76-M78 HydrophobicContact CB-CE 4.35Å; K76-M78 PolarHBondContact O-N 2.99Å
77	C	58.7	Low	56.6	Low	120 Å²	120	138.4 Å²	138.4	81%	0.811	74%	0.735	S	S	*	*			trans	-70.9	95.6	163.4	-163.8	0	0	0	0	106.4	E75 P79	E75-C77 PolarHBondContact O-N 3.01Å; C77-P79 WeakPolarHBondContact O-CD 3.5Å
78	M	58.3	Low	57.7	Low	144 Å²	144	145 Å²	145	71%	0.709	74%	0.742	S	S	*	*			trans	-55.9	121.6	174.7	-74.7	-75	152.6	0	0	107.9	K76 N80	K76-M78 VanDerWaalsContact C-N 3.3Å; K76-M78 HydrophobicContact CB-CE 4.35Å; K76-M78 PolarHBondContact O-N 2.99Å; M78-N80 PolarHBondContact O-N 3Å
79	P	56.9	Low	58.8	Low	113 Å²	113	143.2 Å²	143.2	73%	0.734	73%	0.731	S	S	*	*			trans	-59	132.2	176.7	24	-31.7	0	0	0	108.2	C77 R81	C77-P79 WeakPolarHBondContact O-CD 3.5Å; P79-R81 PolarHBondContact O-N 2.68Å
80	N	60.1	Low	59.7	Low	137 Å²	137	142.5 Å²	142.5	73%	0.733	72%	0.722	S	S	*	*			trans	-67.8	76.9	-172.4	-146.7	13.4	0	0	0	109.3	M78 A82 A83	M78-N80 PolarHBondContact O-N 3Å; N80-A82 PolarHBondContact O-N 3.02Å; N80-A83 PolarHBondContact O-N 2.93Å
81	R	58.5	Low	60.3	Low	223 Å²	223	141.8 Å²	141.8	84%	0.842	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.2	-13.8	-173.6	-157.5	179.2	-175.9	-178.7	0.9	113.3	P79 A83	P79-R81 PolarHBondContact O-N 2.68Å; R81-A83 VanDerWaalsContact C-N 3.33Å
82	A	58.5	Low	61.1	Low	78 Å²	78	136 Å²	136	65%	0.645	72%	0.721	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.4	-22.5	175.5	0	0	0	0	0	113.9	N80	N80-A82 PolarHBondContact O-N 3.02Å
83	A	63.3	Low	61.9	Low	77 Å²	77	131.2 Å²	131.2	64%	0.636	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74	-27.7	179.5	0	0	0	0	0	113	N80 R81	N80-A83 PolarHBondContact O-N 2.93Å; R81-A83 VanDerWaalsContact C-N 3.33Å
84	D	65.4	Low	62.4	Low	142 Å²	142	133.7 Å²	133.7	76%	0.759	72%	0.722	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100	8.3	-179.4	-61.9	-42	0	0	0	112.8	L86	D84-L86 PolarHBondContact O-N 2.99Å
85	D	72.9	Confident	63.2	Low	90 Å²	90	129.6 Å²	129.6	48%	0.481	72%	0.715	S	S	.	*			trans	-80.7	84.9	175	-168.1	-0.1	0	0	0	110.3	S87	D85-S87 VanDerWaalsContact C-N 3.26Å; D85-S87 WeakPolarHBondContact OD1-CB 3.34Å; D85-S87 PolarHBondContact OD1-N 3.32Å; D85-S87 VanDerWaalsContact OD1-N 3.15Å; D85-S87 PolarHBondContact OD1-OG 2.9Å
86	L	69.4	Low	63.8	Low	101 Å²	101	130.2 Å²	130.2	53%	0.529	74%	0.741	S	S	.	*			trans	-90	17.8	173.2	-57.9	179.8	0	0	0	112.3	D84 W88 I89	D84-L86 PolarHBondContact O-N 2.99Å; L86-W88 PolarHBondContact O-N 2.96Å; L86-I89 HydrophobicContact CB-CD1 4.08Å; L86-I89 HydrophobicContact CB-CG1 4.34Å; L86-I89 HydrophobicContact CD1-CD1 4.34Å; L86-I89 HydrophobicContact CD2-CD1 3.81Å; L86-I89 HydrophobicContact CG-CD1 4.29Å; L86-I89 WeakPolarHBondContact O-CB 3.29Å; L86-I89 PolarHBondContact O-N 2.91Å
87	S	72.3	Confident	64.3	Low	81 Å²	81	127.2 Å²	127.2	57%	0.566	74%	0.736	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	-20.2	178.6	60.4	0	0	0	0	113.6	D85 I89	D85-S87 VanDerWaalsContact C-N 3.26Å; D85-S87 WeakPolarHBondContact OD1-CB 3.34Å; D85-S87 PolarHBondContact OD1-N 3.32Å; D85-S87 VanDerWaalsContact OD1-N 3.15Å; D85-S87 PolarHBondContact OD1-OG 2.9Å; S87-I89 VanDerWaalsContact C-N 3.32Å
88	W	72.5	Confident	64.6	Low	195 Å²	195	127.6 Å²	127.6	74%	0.739	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-18.8	173.3	68	-92	0	0	0	113.9	L86	L86-W88 PolarHBondContact O-N 2.96Å
89	I	72.1	Confident	64.9	Low	99 Å²	99	126.7 Å²	126.7	51%	0.508	73%	0.733	S	S	.	*	T	Hydrogen-bonded Turn	trans	-80.6	-33.9	178.4	-61.4	-175.5	0	0	0	110.7	L86 S87 G91	L86-I89 HydrophobicContact CB-CD1 4.08Å; L86-I89 HydrophobicContact CB-CG1 4.34Å; L86-I89 HydrophobicContact CD1-CD1 4.34Å; L86-I89 HydrophobicContact CD2-CD1 3.81Å; L86-I89 HydrophobicContact CG-CD1 4.29Å; L86-I89 WeakPolarHBondContact O-CB 3.29Å; L86-I89 PolarHBondContact O-N 2.91Å; S87-I89 VanDerWaalsContact C-N 3.32Å; I89-G91 PolarHBondContact O-N 2.91Å
90	E	69.2	Low	65.4	Low	166 Å²	166	127.5 Å²	127.5	78%	0.776	73%	0.733	S	S	*	*	S	Bend	trans	-81.8	76.8	179	-150.7	161.9	-146.9	0	0	108.9	S92	E90-S92 PolarHBondContact O-N 2.99Å; E90-S92 VanDerWaalsContact O-N 3.07Å
91	G	63	Low	65.7	Low	60 Å²	60	126.9 Å²	126.9	62%	0.619	73%	0.733	S	S	*	*			trans	-51	116.6	171.5	0	0	0	0	0	109	I89 D93	I89-G91 PolarHBondContact O-N 2.91Å; G91-D93 PolarHBondContact O-N 2.86Å; G91-D93 VanDerWaalsContact O-N 3.1Å
92	S	62.7	Low	66.2	Low	106 Å²	106	120.5 Å²	120.5	74%	0.741	73%	0.726	S	S	*	*			trans	-56.4	117.3	-179.3	-53.8	0	0	0	0	109.8	E90 T94	E90-S92 PolarHBondContact O-N 2.99Å; E90-S92 VanDerWaalsContact O-N 3.07Å; S92-T94 VanDerWaalsContact C-N 3.35Å; S92-T94 PolarHBondContact O-N 3.01Å
93	D	60.8	Low	66.8	Low	164 Å²	164	123.5 Å²	123.5	88%	0.877	73%	0.732	S	S	*	*			trans	-58.7	97.7	166.7	-80.9	-40.6	0	0	0	108.8	G91 S95	G91-D93 PolarHBondContact O-N 2.86Å; G91-D93 VanDerWaalsContact O-N 3.1Å; D93-S95 PolarHBondContact O-N 3.29Å
94	T	61.3	Low	67	Low	134 Å²	134	127.1 Å²	127.1	82%	0.822	74%	0.739	S	S	*	*			trans	-88.6	81.3	164.3	60.5	0	0	0	0	108.1	S92	S92-T94 VanDerWaalsContact C-N 3.35Å; S92-T94 PolarHBondContact O-N 3.01Å
95	S	64.5	Low	67.2	Low	114 Å²	114	125.8 Å²	125.8	80%	0.797	74%	0.738	S	S	*	*			trans	-121.4	102.1	156.7	-75.6	0	0	0	0	108.1	D93	D93-S95 PolarHBondContact O-N 3.29Å
96	S	65.6	Low	66.7	Low	200 Å²	200	129.1 Å²	129.1	100%	1.399	76%	0.761	S	S	*	*			trans	-76.6	0	157.1	-72.3	0	0	0	0	110.3

Retrieved 96 of 96 residues in 104.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).