A0A077ZJ63_TRITR Loading...

Phospho p8 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZJ63, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 77 aa.

						>A0A077ZJ63_TRITR|A0A077ZJ63
MSHAEDLADSLAAGEVDIEQELKGFGKSGKNRTKQEQHEHKKPHPEGDTRKIVNVATHGEQNRKEEEKKRLEKQERK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	75.1	Confident	180 Å²	180	88.8 Å²	88.8	89%	0.887	50%	0.496	S	S	*	.				0	109.3	0	-51	-63.5	-89.6	0	0	106.8	E5	M1-E5 WeakPolarHBondContact CA-OE2 3.44Å
2	S	73.3	Confident	75.3	Confident	58 Å²	58	88.8 Å²	88.8	41%	0.406	52%	0.516	S	S	.	.			trans	-83.2	152.5	174.1	78	0	0	0	0	109.6	A4 E5 D6	S2-A4 PolarHBondContact O-N 3.11Å; S2-E5 PolarHBondContact N-OE2 3.21Å; S2-E5 WeakPolarHBondContact O-CB 3.47Å; S2-E5 PolarHBondContact O-N 3.04Å; S2-E5 WeakPolarHBondContact OG-CG 3.21Å; S2-E5 PolarHBondContact OG-N 3.39Å; S2-D6 PolarHBondContact O-N 3.41Å
3	H	76.3	Confident	75.6	Confident	143 Å²	143	87.1 Å²	87.1	66%	0.662	52%	0.518	S	S	*	.	H	α-helix	trans	-56.1	-26.6	177.3	-173.3	50.1	0	0	0	113.3	L7	H3-L7 WeakPolarHBondContact O-CG 3.41Å; H3-L7 PolarHBondContact O-N 3.31Å
4	A	78	Confident	75.1	Confident	69 Å²	69	85.2 Å²	85.2	57%	0.57	53%	0.526	S	S	*	.	H	α-helix	trans	-72.3	-33.7	175.6	0	0	0	0	0	112.9	S2 A8	S2-A4 PolarHBondContact O-N 3.11Å; A4-A8 PolarHBondContact O-N 3.47Å
5	E	79.3	Confident	74.3	Confident	99 Å²	99	90.4 Å²	90.4	46%	0.463	54%	0.542	S	S	.	.	H	α-helix	trans	-68.5	-45.5	175.4	-68.8	167.9	157.9	0	0	110.1	M1 S2 L7 A8 D9	M1-E5 WeakPolarHBondContact CA-OE2 3.44Å; S2-E5 PolarHBondContact N-OE2 3.21Å; S2-E5 WeakPolarHBondContact O-CB 3.47Å; S2-E5 PolarHBondContact O-N 3.04Å; S2-E5 WeakPolarHBondContact OG-CG 3.21Å; S2-E5 PolarHBondContact OG-N 3.39Å; E5-L7 PolarHBondContact O-N 3.47Å; E5-A8 WeakPolarHBondContact O-CB 3.45Å; E5-A8 PolarHBondContact O-N 3.3Å; E5-D9 PolarHBondContact O-N 2.93Å
6	D	81.3	Confident	73.2	Confident	76 Å²	76	86.6 Å²	86.6	41%	0.406	52%	0.519	S	S	.	.	H	α-helix	trans	-60	-35.8	177.8	-58	-24.2	0	0	0	112.2	S2 S10	S2-D6 PolarHBondContact O-N 3.41Å; D6-S10 WeakPolarHBondContact O-CB 3.39Å; D6-S10 PolarHBondContact O-N 3.42Å; D6-S10 PolarHBondContact O-OG 3.18Å; D6-S10 VanDerWaalsContact O-OG 3.04Å
7	L	74.4	Confident	72.7	Confident	85 Å²	85	86.5 Å²	86.5	45%	0.445	52%	0.515	S	S	.	.	H	α-helix	trans	-71.4	-39.4	175.3	-75.1	172.7	0	0	0	112.2	H3 E5 D9 S10 L11	H3-L7 WeakPolarHBondContact O-CG 3.41Å; H3-L7 PolarHBondContact O-N 3.31Å; E5-L7 PolarHBondContact O-N 3.47Å; L7-D9 VanDerWaalsContact C-N 3.32Å; L7-S10 WeakPolarHBondContact CA-OG 3.47Å; L7-S10 PolarHBondContact O-N 3.1Å; L7-S10 PolarHBondContact O-OG 3.07Å; L7-L11 WeakPolarHBondContact O-CB 3.27Å; L7-L11 VanDerWaalsContact O-CG 3.3Å; L7-L11 WeakPolarHBondContact O-CG 3.24Å; L7-L11 PolarHBondContact O-N 3.3Å
8	A	78.1	Confident	71.9	Confident	52 Å²	52	87.6 Å²	87.6	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-63.6	-41.4	175.3	0	0	0	0	0	111.1	A4 E5 L11 A12	A4-A8 PolarHBondContact O-N 3.47Å; E5-A8 WeakPolarHBondContact O-CB 3.45Å; E5-A8 PolarHBondContact O-N 3.3Å; A8-L11 PolarHBondContact O-N 3.01Å; A8-A12 VanDerWaalsContact O-CB 3.28Å; A8-A12 WeakPolarHBondContact O-CB 3.37Å; A8-A12 PolarHBondContact O-N 2.93Å
9	D	81.9	Confident	71.1	Confident	92 Å²	92	90.4 Å²	90.4	49%	0.492	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-42.5	177.9	-71.4	-15.9	0	0	0	111.7	E5 L7 A12 A13	E5-D9 PolarHBondContact O-N 2.93Å; L7-D9 VanDerWaalsContact C-N 3.32Å; D9-A12 PolarHBondContact O-N 2.91Å; D9-A13 VanDerWaalsContact O-CB 3.27Å; D9-A13 WeakPolarHBondContact O-CB 3.42Å; D9-A13 PolarHBondContact O-N 3.45Å
10	S	77.4	Confident	70.4	Confident	28 Å²	28	92.5 Å²	92.5	20%	0.196	53%	0.529	C	S	.	.	H	α-helix	trans	-69.8	-34.6	177.7	57.2	0	0	0	0	113.6	D6 L7 G14 E15	D6-S10 WeakPolarHBondContact O-CB 3.39Å; D6-S10 PolarHBondContact O-N 3.42Å; D6-S10 PolarHBondContact O-OG 3.18Å; D6-S10 VanDerWaalsContact O-OG 3.04Å; L7-S10 WeakPolarHBondContact CA-OG 3.47Å; L7-S10 PolarHBondContact O-N 3.1Å; L7-S10 PolarHBondContact O-OG 3.07Å; S10-G14 PolarHBondContact O-N 2.97Å; S10-E15 PolarHBondContact O-N 3.18Å
11	L	73.4	Confident	69.6	Low	95 Å²	95	94 Å²	94	50%	0.497	53%	0.531	S	S	.	.	H	α-helix	trans	-65.6	-43.7	170.5	-76.2	167.8	0	0	0	111.4	L7 A8 G14 V16	L7-L11 WeakPolarHBondContact O-CB 3.27Å; L7-L11 VanDerWaalsContact O-CG 3.3Å; L7-L11 WeakPolarHBondContact O-CG 3.24Å; L7-L11 PolarHBondContact O-N 3.3Å; A8-L11 PolarHBondContact O-N 3.01Å; L11-G14 PolarHBondContact O-N 3.39Å; L11-V16 HydrophobicContact CD2-CB 3.86Å; L11-V16 HydrophobicContact CD2-CG1 3.94Å; L11-V16 HydrophobicContact CD2-CG2 4.16Å; L11-V16 HydrophobicContact CG-CG2 4.4Å
12	A	77.4	Confident	69.5	Low	89 Å²	89	90.6 Å²	90.6	74%	0.736	52%	0.516	S	S	*	.	H	α-helix	trans	-68	-34.7	178.4	0	0	0	0	0	112.5	A8 D9 G14	A8-A12 VanDerWaalsContact O-CB 3.28Å; A8-A12 WeakPolarHBondContact O-CB 3.37Å; A8-A12 PolarHBondContact O-N 2.93Å; D9-A12 PolarHBondContact O-N 2.91Å; A12-G14 PolarHBondContact O-N 3.1Å
13	A	79.5	Confident	68.5	Low	66 Å²	66	96.7 Å²	96.7	55%	0.545	54%	0.535	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.4	-11.4	174.2	0	0	0	0	0	113.2	D9 E15	D9-A13 VanDerWaalsContact O-CB 3.27Å; D9-A13 WeakPolarHBondContact O-CB 3.42Å; D9-A13 PolarHBondContact O-N 3.45Å; A13-E15 HydrophobicContact CB-CG 4.06Å; A13-E15 PolarHBondContact O-N 2.69Å
14	G	68	Low	67.1	Low	61 Å²	61	90.4 Å²	90.4	63%	0.629	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	69.1	17.1	-177.9	0	0	0	0	0	113.5	S10 L11 A12 V16	S10-G14 PolarHBondContact O-N 2.97Å; L11-G14 PolarHBondContact O-N 3.39Å; A12-G14 PolarHBondContact O-N 3.1Å; G14-V16 VanDerWaalsContact C-N 3.27Å
15	E	62.7	Low	65.6	Low	163 Å²	163	95.4 Å²	95.4	76%	0.762	52%	0.519	S	S	*	.			trans	-76.4	-19	176.6	-68.1	-170.8	163.3	0	0	112.2	S10 A13	S10-E15 PolarHBondContact O-N 3.18Å; A13-E15 HydrophobicContact CB-CG 4.06Å; A13-E15 PolarHBondContact O-N 2.69Å
16	V	57.5	Low	64.1	Low	30 Å²	30	94.6 Å²	94.6	18%	0.182	54%	0.537	C	S	.	.	S	Bend	trans	-92.2	103.9	178.1	-174.6	0	0	0	0	109.1	L11 G14 I18 E21	L11-V16 HydrophobicContact CD2-CB 3.86Å; L11-V16 HydrophobicContact CD2-CG1 3.94Å; L11-V16 HydrophobicContact CD2-CG2 4.16Å; L11-V16 HydrophobicContact CG-CG2 4.4Å; G14-V16 VanDerWaalsContact C-N 3.27Å; V16-I18 PolarHBondContact O-N 3.41Å; V16-E21 VanDerWaalsContact CG1-CD 3.46Å; V16-E21 HydrophobicContact CG1-CG 3.7Å
17	D	65.2	Low	62.5	Low	85 Å²	85	96.1 Å²	96.1	46%	0.455	54%	0.54	S	S	.	.			trans	-68.1	97.2	169.4	-179.7	1.4	0	0	0	109.8	E19 Q20 E21	D17-E19 PolarHBondContact O-N 3.41Å; D17-E19 WeakPolarHBondContact OD1-CB 3.46Å; D17-E19 PolarHBondContact OD1-N 3.44Å; D17-Q20 HydrophobicContact CB-CB 3.98Å; D17-Q20 PolarHBondContact O-N 2.87Å; D17-Q20 PolarHBondContact OD1-N 2.95Å; D17-Q20 WeakPolarHBondContact OD2-CB 3.39Å; D17-E21 PolarHBondContact O-N 3.32Å
18	I	57.8	Low	61.5	Low	106 Å²	106	96.5 Å²	96.5	54%	0.544	55%	0.55	S	S	.	.	H	α-helix	trans	-57.2	-30.6	179.3	-57.3	172.6	0	0	0	110.9	V16 E21 L22	V16-I18 PolarHBondContact O-N 3.41Å; I18-E21 PolarHBondContact O-N 2.87Å; I18-L22 HydrophobicContact CG2-CD1 3.79Å; I18-L22 HydrophobicContact CG2-CG 4.32Å; I18-L22 VanDerWaalsContact O-CB 3.29Å; I18-L22 WeakPolarHBondContact O-CB 3.45Å; I18-L22 WeakPolarHBondContact O-CG 3.48Å; I18-L22 PolarHBondContact O-N 2.93Å
19	E	56.9	Low	60.4	Low	141 Å²	141	95.4 Å²	95.4	66%	0.659	54%	0.543	S	S	*	.	H	α-helix	trans	-71.7	-36.2	178.3	-60.3	-167.6	175.9	0	0	112.1	D17 K23	D17-E19 PolarHBondContact O-N 3.41Å; D17-E19 WeakPolarHBondContact OD1-CB 3.46Å; D17-E19 PolarHBondContact OD1-N 3.44Å; E19-K23 PolarHBondContact O-N 3.27Å
20	Q	57.2	Low	59.2	Low	131 Å²	131	97.9 Å²	97.9	61%	0.612	55%	0.55	S	S	*	.	H	α-helix	trans	-73.1	-34.6	174.5	-164.9	177.8	69.2	0	0	111.9	D17 G24	D17-Q20 HydrophobicContact CB-CB 3.98Å; D17-Q20 PolarHBondContact O-N 2.87Å; D17-Q20 PolarHBondContact OD1-N 2.95Å; D17-Q20 WeakPolarHBondContact OD2-CB 3.39Å; Q20-G24 PolarHBondContact O-N 2.99Å
21	E	52.7	Low	58.6	Low	124 Å²	124	104.5 Å²	104.5	58%	0.579	58%	0.583	S	S	*	*	H	α-helix	trans	-71	-40.2	174.7	-67.7	-129.2	144.1	0	0	112.5	V16 D17 I18 G24 F25	V16-E21 VanDerWaalsContact CG1-CD 3.46Å; V16-E21 HydrophobicContact CG1-CG 3.7Å; D17-E21 PolarHBondContact O-N 3.32Å; I18-E21 PolarHBondContact O-N 2.87Å; E21-G24 CarbonylContact O-C 3.24Å; E21-G24 VanDerWaalsContact O-C 3.24Å; E21-G24 WeakPolarHBondContact O-CA 3.48Å; E21-G24 PolarHBondContact O-N 2.92Å; E21-F25 PolarHBondContact O-N 3.45Å; E21-F25 VanDerWaalsContact O-N 3.14Å
22	L	52.4	Low	58.1	Low	110 Å²	110	104.8 Å²	104.8	58%	0.576	58%	0.577	S	S	*	*	H	α-helix	trans	-65.3	-41.9	176	-84.5	164.3	0	0	0	112.4	I18 G24 F25	I18-L22 HydrophobicContact CG2-CD1 3.79Å; I18-L22 HydrophobicContact CG2-CG 4.32Å; I18-L22 VanDerWaalsContact O-CB 3.29Å; I18-L22 WeakPolarHBondContact O-CB 3.45Å; I18-L22 WeakPolarHBondContact O-CG 3.48Å; I18-L22 PolarHBondContact O-N 2.93Å; L22-G24 PolarHBondContact O-N 3.16Å; L22-F25 HydrophobicContact CD2-CD2 4.21Å; L22-F25 HydrophobicContact CD2-CE2 3.99Å; L22-F25 PolarHBondContact O-N 3.48Å
23	K	52	Low	57.9	Low	185 Å²	185	104.2 Å²	104.2	80%	0.804	56%	0.564	S	S	*	*	H	α-helix	trans	-66.7	-20.9	169.2	-74.7	175.6	-178.1	163	0	112.2	E19	E19-K23 PolarHBondContact O-N 3.27Å
24	G	46.1	Very low	57.8	Low	12 Å²	12	110.1 Å²	110.1	12%	0.124	58%	0.578	C	S	.	*	T	Hydrogen-bonded Turn	trans	-91.2	5.6	-179.1	0	0	0	0	0	115.5	Q20 E21 L22 G26 K27	Q20-G24 PolarHBondContact O-N 2.99Å; E21-G24 CarbonylContact O-C 3.24Å; E21-G24 VanDerWaalsContact O-C 3.24Å; E21-G24 WeakPolarHBondContact O-CA 3.48Å; E21-G24 PolarHBondContact O-N 2.92Å; L22-G24 PolarHBondContact O-N 3.16Å; G24-G26 CarbonylContact O-C 3.56Å; G24-G26 PolarHBondContact O-N 3.15Å; G24-K27 VanDerWaalsContact O-CB 3.31Å; G24-K27 WeakPolarHBondContact O-CB 3.12Å; G24-K27 PolarHBondContact O-N 3.45Å
25	F	47	Very low	58	Low	174 Å²	174	113.7 Å²	113.7	76%	0.763	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.4	-7.6	-178.3	-114.8	-100.7	0	0	0	115.3	E21 L22	E21-F25 PolarHBondContact O-N 3.45Å; E21-F25 VanDerWaalsContact O-N 3.14Å; L22-F25 HydrophobicContact CD2-CD2 4.21Å; L22-F25 HydrophobicContact CD2-CE2 3.99Å; L22-F25 PolarHBondContact O-N 3.48Å
26	G	46.8	Very low	58.5	Low	81 Å²	81	109.7 Å²	109.7	84%	0.835	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.9	5.2	166.2	0	0	0	0	0	116.8	G24	G24-G26 CarbonylContact O-C 3.56Å; G24-G26 PolarHBondContact O-N 3.15Å
27	K	47.3	Very low	59.2	Low	108 Å²	108	111.7 Å²	111.7	47%	0.47	57%	0.567	S	S	.	*			trans	-100.1	6.8	-171.8	-69.5	-176.4	-176.6	171.1	0	116	G24 G29 K30	G24-K27 VanDerWaalsContact O-CB 3.31Å; G24-K27 WeakPolarHBondContact O-CB 3.12Å; G24-K27 PolarHBondContact O-N 3.45Å; K27-G29 PolarHBondContact O-N 2.97Å; K27-K30 HydrophobicContact CB-CD 4.34Å; K27-K30 HydrophobicContact CB-CG 4.37Å; K27-K30 HydrophobicContact CD-CD 4.05Å; K27-K30 HydrophobicContact CG-CD 4.02Å; K27-K30 HydrophobicContact CG-CG 4.46Å; K27-K30 PolarHBondContact O-N 3.35Å
28	S	54.7	Low	59.5	Low	94 Å²	94	113.8 Å²	113.8	66%	0.657	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.2	-7.1	175.5	-179.3	0	0	0	0	114.5
29	G	54.9	Low	60	Low	28 Å²	28	113 Å²	113	29%	0.289	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.3	-18.4	170.8	0	0	0	0	0	116.1	K27 N31 R32 Q37	K27-G29 PolarHBondContact O-N 2.97Å; G29-N31 PolarHBondContact O-N 2.92Å; G29-R32 PolarHBondContact O-N 3.47Å; G29-R32 VanDerWaalsContact O-N 3.16Å; G29-Q37 PolarHBondContact O-NE2 3.36Å
30	K	56.2	Low	60.4	Low	145 Å²	145	111.8 Å²	111.8	63%	0.63	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	-28.6	-164.5	-75.4	-165.9	178.2	-168.8	0	115	K27	K27-K30 HydrophobicContact CB-CD 4.34Å; K27-K30 HydrophobicContact CB-CG 4.37Å; K27-K30 HydrophobicContact CD-CD 4.05Å; K27-K30 HydrophobicContact CG-CD 4.02Å; K27-K30 HydrophobicContact CG-CG 4.46Å; K27-K30 PolarHBondContact O-N 3.35Å
31	N	65.2	Low	60.9	Low	166 Å²	166	113.3 Å²	113.3	89%	0.888	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.1	-3.2	177.9	-62.8	-8.6	0	0	0	113	G29	G29-N31 PolarHBondContact O-N 2.92Å
32	R	62.8	Low	61.7	Low	102 Å²	102	112.9 Å²	112.9	39%	0.385	56%	0.563	S	S	.	*	S	Bend	trans	-85.5	134.9	174.9	-67.7	-175	-176.6	149.7	5.4	109.7	G29 E36 Q37	G29-R32 PolarHBondContact O-N 3.47Å; G29-R32 VanDerWaalsContact O-N 3.16Å; R32-E36 VanDerWaalsContact CA-OE2 3.26Å; R32-E36 WeakPolarHBondContact CA-OE2 3.41Å; R32-E36 HydrophobicContact CB-CB 3.97Å; R32-E36 WeakPolarHBondContact CB-OE2 3.29Å; R32-Q37 HydrophobicContact CB-CG 3.84Å; R32-Q37 PolarHBondContact O-NE2 3.36Å
33	T	73.3	Confident	62.5	Low	76 Å²	76	113.3 Å²	113.3	47%	0.466	57%	0.572	S	S	.	*			trans	-57.7	154.1	173.7	63.2	0	0	0	0	110.3	Q35 E36 Q37	T33-Q35 PolarHBondContact O-N 3.09Å; T33-Q35 VanDerWaalsContact O-N 3.08Å; T33-E36 WeakPolarHBondContact CG2-OE1 3.41Å; T33-E36 PolarHBondContact N-OE2 2.95Å; T33-E36 VanDerWaalsContact N-OE2 3.16Å; T33-E36 PolarHBondContact O-N 2.92Å; T33-E36 VanDerWaalsContact OG1-CG 3.25Å; T33-E36 WeakPolarHBondContact OG1-CG 3.5Å; T33-E36 PolarHBondContact OG1-N 3.44Å; T33-E36 PolarHBondContact OG1-OE1 3.43Å; T33-Q37 PolarHBondContact O-N 3.42Å
34	K	76.1	Confident	63.2	Low	190 Å²	190	109 Å²	109	83%	0.826	56%	0.555	S	S	*	*	H	α-helix	trans	-54.2	-32.7	178.9	-74.1	-174.6	179.2	178.3	0	112.2	H38	K34-H38 PolarHBondContact O-N 3.04Å; K34-H38 VanDerWaalsContact O-N 3.15Å
35	Q	73.9	Confident	64.2	Low	136 Å²	136	114.8 Å²	114.8	64%	0.636	59%	0.59	S	S	*	*	H	α-helix	trans	-68.1	-50.4	175.9	-176.2	177.1	-26.8	0	0	111.6	T33 Q37 H38 E39	T33-Q35 PolarHBondContact O-N 3.09Å; T33-Q35 VanDerWaalsContact O-N 3.08Å; Q35-Q37 VanDerWaalsContact C-N 3.29Å; Q35-Q37 PolarHBondContact O-N 3.24Å; Q35-H38 WeakPolarHBondContact O-CB 3.4Å; Q35-H38 PolarHBondContact O-N 2.9Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.28Å; Q35-E39 PolarHBondContact NE2-OE1 3.01Å; Q35-E39 WeakPolarHBondContact O-CG 3.42Å; Q35-E39 PolarHBondContact O-N 3.26Å
36	E	71.7	Confident	65.3	Low	79 Å²	79	115.4 Å²	115.4	37%	0.369	60%	0.595	S	S	.	*	H	α-helix	trans	-57.2	-42.5	175.7	-75	157.3	-139.7	0	0	111.8	R32 T33 H38 E39 H40	R32-E36 VanDerWaalsContact CA-OE2 3.26Å; R32-E36 WeakPolarHBondContact CA-OE2 3.41Å; R32-E36 HydrophobicContact CB-CB 3.97Å; R32-E36 WeakPolarHBondContact CB-OE2 3.29Å; T33-E36 WeakPolarHBondContact CG2-OE1 3.41Å; T33-E36 PolarHBondContact N-OE2 2.95Å; T33-E36 VanDerWaalsContact N-OE2 3.16Å; T33-E36 PolarHBondContact O-N 2.92Å; T33-E36 VanDerWaalsContact OG1-CG 3.25Å; T33-E36 WeakPolarHBondContact OG1-CG 3.5Å; T33-E36 PolarHBondContact OG1-N 3.44Å; T33-E36 PolarHBondContact OG1-OE1 3.43Å; E36-H38 VanDerWaalsContact C-N 3.29Å; E36-H38 PolarHBondContact O-N 3.33Å; E36-E39 PolarHBondContact O-N 3.44Å; E36-H40 PolarHBondContact O-CD2 3.4Å; E36-H40 PolarHBondContact O-N 3.26Å; E36-H40 VanDerWaalsContact O-N 3.11Å
37	Q	73.2	Confident	66.2	Low	72 Å²	72	113.5 Å²	113.5	34%	0.336	58%	0.575	S	S	.	*	H	α-helix	trans	-60.4	-37.7	175.2	-68.1	-178.5	16.2	0	0	112.7	G29 R32 T33 Q35 K41	G29-Q37 PolarHBondContact O-NE2 3.36Å; R32-Q37 HydrophobicContact CB-CG 3.84Å; R32-Q37 PolarHBondContact O-NE2 3.36Å; T33-Q37 PolarHBondContact O-N 3.42Å; Q35-Q37 VanDerWaalsContact C-N 3.29Å; Q35-Q37 PolarHBondContact O-N 3.24Å; Q37-K41 WeakPolarHBondContact O-CG 3.4Å
38	H	70.8	Confident	67.5	Low	130 Å²	130	110.6 Å²	110.6	60%	0.602	57%	0.565	S	S	*	*	H	α-helix	trans	-73	-39.1	178.2	-173.6	-92.1	0	0	0	111.7	K34 Q35 E36 H40 K41 K42	K34-H38 PolarHBondContact O-N 3.04Å; K34-H38 VanDerWaalsContact O-N 3.15Å; Q35-H38 WeakPolarHBondContact O-CB 3.4Å; Q35-H38 PolarHBondContact O-N 2.9Å; E36-H38 VanDerWaalsContact C-N 3.29Å; E36-H38 PolarHBondContact O-N 3.33Å; H38-H40 VanDerWaalsContact C-N 3.3Å; H38-H40 PolarHBondContact O-N 3Å; H38-K41 WeakPolarHBondContact O-CB 3.25Å; H38-K41 PolarHBondContact O-N 3.11Å; H38-K42 PolarHBondContact O-N 2.9Å
39	E	67.9	Low	68.6	Low	88 Å²	88	110.3 Å²	110.3	41%	0.411	56%	0.559	S	S	.	*	H	α-helix	trans	-61.5	-38.4	176.9	-71.9	178.1	-169.3	0	0	112.2	Q35 E36 K41 K42	Q35-E39 WeakPolarHBondContact CG-OE1 3.28Å; Q35-E39 PolarHBondContact NE2-OE1 3.01Å; Q35-E39 WeakPolarHBondContact O-CG 3.42Å; Q35-E39 PolarHBondContact O-N 3.26Å; E36-E39 PolarHBondContact O-N 3.44Å; E39-K41 PolarHBondContact O-N 3.3Å; E39-K42 WeakPolarHBondContact O-CB 3.41Å; E39-K42 WeakPolarHBondContact O-CG 3.4Å; E39-K42 PolarHBondContact O-N 3.02Å
40	H	65.8	Low	69.6	Low	117 Å²	117	115.9 Å²	115.9	54%	0.542	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	-68.3	-14.9	173.6	-66.8	-54	0	0	0	114.5	E36 H38	E36-H40 PolarHBondContact O-CD2 3.4Å; E36-H40 PolarHBondContact O-N 3.26Å; E36-H40 VanDerWaalsContact O-N 3.11Å; H38-H40 VanDerWaalsContact C-N 3.3Å; H38-H40 PolarHBondContact O-N 3Å
41	K	68.7	Low	70.6	Confident	162 Å²	162	115.8 Å²	115.8	70%	0.704	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.9	-3.4	175.2	-69.1	-178.8	-177.8	-175.4	0	113.1	Q37 H38 E39 P43	Q37-K41 WeakPolarHBondContact O-CG 3.4Å; H38-K41 WeakPolarHBondContact O-CB 3.25Å; H38-K41 PolarHBondContact O-N 3.11Å; E39-K41 PolarHBondContact O-N 3.3Å; K41-P43 WeakPolarHBondContact O-CD 3.48Å; K41-P43 VanDerWaalsContact O-N 3.12Å
42	K	69.8	Low	71.5	Confident	115 Å²	115	113.8 Å²	113.8	50%	0.5	56%	0.559	S	S	.	*	S	Bend	trans	-56.5	121.7	177.9	-74	176.1	178.7	174.4	0	108.3	H38 E39 H44	H38-K42 PolarHBondContact O-N 2.9Å; E39-K42 WeakPolarHBondContact O-CB 3.41Å; E39-K42 WeakPolarHBondContact O-CG 3.4Å; E39-K42 PolarHBondContact O-N 3.02Å; K42-H44 PolarHBondContact O-N 3.15Å
43	P	67.2	Low	72.5	Confident	119 Å²	119	112.9 Å²	112.9	77%	0.773	57%	0.565	S	S	*	*			trans	-60.8	123.9	174.1	24.8	-31.5	0	0	0	107.7	K41 P45	K41-P43 WeakPolarHBondContact O-CD 3.48Å; K41-P43 VanDerWaalsContact O-N 3.12Å; P43-P45 WeakPolarHBondContact O-CD 3.48Å
44	H	67.6	Low	73	Confident	96 Å²	96	113.5 Å²	113.5	44%	0.444	57%	0.565	S	S	.	*			trans	-73.2	111.4	174.5	-68.8	-71.5	0	0	0	108.3	K42 E46 G47 R50	K42-H44 PolarHBondContact O-N 3.15Å; H44-E46 VanDerWaalsContact C-N 3.27Å; H44-E46 PolarHBondContact O-N 2.95Å; H44-G47 PolarHBondContact O-N 2.95Å; H44-G47 VanDerWaalsContact O-N 3.11Å; H44-R50 PolarHBondContact NE2-NH2 3.06Å
45	P	68.1	Low	73.5	Confident	132 Å²	132	108.7 Å²	108.7	86%	0.857	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-30.6	-176.4	27	-34	0	0	0	112.2	P43 G47	P43-P45 WeakPolarHBondContact O-CD 3.48Å; P45-G47 PolarHBondContact O-N 3.42Å
46	E	68.7	Low	74.1	Confident	188 Å²	188	106.3 Å²	106.3	88%	0.879	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	1.7	176.6	-62.5	179.2	176.6	0	0	113.1	H44	H44-E46 VanDerWaalsContact C-N 3.27Å; H44-E46 PolarHBondContact O-N 2.95Å
47	G	65.9	Low	75	Confident	40 Å²	40	106.5 Å²	106.5	41%	0.412	56%	0.562	S	S	.	*			trans	81.2	144.8	-171.1	0	0	0	0	0	111.9	H44 P45 T49	H44-G47 PolarHBondContact O-N 2.95Å; H44-G47 VanDerWaalsContact O-N 3.11Å; P45-G47 PolarHBondContact O-N 3.42Å; G47-T49 PolarHBondContact O-N 2.94Å
48	D	74	Confident	75.8	Confident	47 Å²	47	107.4 Å²	107.4	25%	0.251	57%	0.566	S	S	.	*			trans	-79.1	87	175.4	-171.5	12.7	0	0	0	109.4	R50 K51	D48-R50 PolarHBondContact O-N 2.96Å; D48-R50 VanDerWaalsContact O-N 3.1Å; D48-R50 VanDerWaalsContact OD1-CB 3.28Å; D48-R50 WeakPolarHBondContact OD1-CB 3.47Å; D48-R50 IonicContact OD1-CZ 3.68Å; D48-R50 PolarHBondContact OD1-N 2.93Å; D48-R50 IonicContact OD1-NE 2.97Å; D48-R50 PolarHBondContact OD1-NE 3.45Å; D48-R50 IonicContact OD1-NH2 3.68Å; D48-K51 HydrophobicContact CB-CD 4.25Å; D48-K51 HydrophobicContact CB-CG 4.14Å; D48-K51 WeakPolarHBondContact O-CB 3.44Å; D48-K51 PolarHBondContact O-N 3.23Å
49	T	78.2	Confident	76.5	Confident	89 Å²	89	101.4 Å²	101.4	55%	0.546	54%	0.539	S	S	.	.	H	α-helix	trans	-57.2	-23.5	178	55.4	0	0	0	0	112.3	G47 K51 I52 V53	G47-T49 PolarHBondContact O-N 2.94Å; T49-K51 PolarHBondContact O-N 2.95Å; T49-I52 WeakPolarHBondContact O-CB 3.47Å; T49-I52 PolarHBondContact O-N 3.22Å; T49-V53 PolarHBondContact O-N 3.36Å
50	R	76.8	Confident	77.4	Confident	145 Å²	145	103.4 Å²	103.4	55%	0.547	55%	0.549	S	S	.	.	H	α-helix	trans	-59.8	-34.1	172.9	-63.3	175.6	-76.7	177.7	-12.5	111.9	H44 D48 I52 V53 N54	H44-R50 PolarHBondContact NE2-NH2 3.06Å; D48-R50 PolarHBondContact O-N 2.96Å; D48-R50 VanDerWaalsContact O-N 3.1Å; D48-R50 VanDerWaalsContact OD1-CB 3.28Å; D48-R50 WeakPolarHBondContact OD1-CB 3.47Å; D48-R50 IonicContact OD1-CZ 3.68Å; D48-R50 PolarHBondContact OD1-N 2.93Å; D48-R50 IonicContact OD1-NE 2.97Å; D48-R50 PolarHBondContact OD1-NE 3.45Å; D48-R50 IonicContact OD1-NH2 3.68Å; R50-I52 VanDerWaalsContact C-N 3.35Å; R50-V53 PolarHBondContact O-N 3.33Å; R50-N54 VanDerWaalsContact O-CB 3.25Å; R50-N54 WeakPolarHBondContact O-CB 3.44Å; R50-N54 PolarHBondContact O-N 3.08Å; R50-N54 PolarHBondContact O-ND2 2.76Å; R50-N54 PolarHBondContact O-OD1 3.14Å
51	K	77.3	Confident	78.5	Confident	143 Å²	143	103.5 Å²	103.5	62%	0.622	55%	0.549	S	S	*	.	H	α-helix	trans	-63.5	-42.6	174.4	-69.1	-177	-178.2	-179.2	0	111.4	D48 T49 N54 V55	D48-K51 HydrophobicContact CB-CD 4.25Å; D48-K51 HydrophobicContact CB-CG 4.14Å; D48-K51 WeakPolarHBondContact O-CB 3.44Å; D48-K51 PolarHBondContact O-N 3.23Å; T49-K51 PolarHBondContact O-N 2.95Å; K51-N54 PolarHBondContact O-N 3.18Å; K51-V55 WeakPolarHBondContact O-CB 3.35Å; K51-V55 VanDerWaalsContact O-CG2 3.24Å; K51-V55 WeakPolarHBondContact O-CG2 3.5Å; K51-V55 PolarHBondContact O-N 3.47Å
52	I	83.8	Confident	79.4	Confident	124 Å²	124	99.2 Å²	99.2	64%	0.636	53%	0.534	S	S	*	.	H	α-helix	trans	-63.1	-48.4	179.4	-57.6	174.6	0	0	0	109.6	T49 R50 N54 V55 A56	T49-I52 WeakPolarHBondContact O-CB 3.47Å; T49-I52 PolarHBondContact O-N 3.22Å; R50-I52 VanDerWaalsContact C-N 3.35Å; I52-N54 PolarHBondContact O-N 2.95Å; I52-V55 PolarHBondContact O-N 2.96Å; I52-A56 WeakPolarHBondContact O-CB 3.4Å; I52-A56 PolarHBondContact O-N 3.34Å
53	V	84.4	Confident	80.3	Confident	83 Å²	83	100.3 Å²	100.3	50%	0.503	54%	0.535	S	S	.	.	H	α-helix	trans	-61.8	-44.4	178.2	176.7	0	0	0	0	111.2	T49 R50 V55 A56 T57	T49-V53 PolarHBondContact O-N 3.36Å; R50-V53 PolarHBondContact O-N 3.33Å; V53-V55 VanDerWaalsContact C-N 3.34Å; V53-V55 PolarHBondContact O-N 3.06Å; V53-A56 PolarHBondContact O-N 2.84Å; V53-T57 HydrophobicContact CG1-CG2 4.31Å; V53-T57 WeakPolarHBondContact O-CB 3.34Å; V53-T57 WeakPolarHBondContact O-CG2 3.32Å; V53-T57 PolarHBondContact O-N 3.16Å; V53-T57 PolarHBondContact O-OG1 3.16Å
54	N	83.8	Confident	81.4	Confident	89 Å²	89	101.3 Å²	101.3	48%	0.476	53%	0.527	S	S	.	.	H	α-helix	trans	-63.9	-38.9	178.8	-73.8	-8.3	0	0	0	112.1	R50 K51 I52 T57 H58 G59	R50-N54 VanDerWaalsContact O-CB 3.25Å; R50-N54 WeakPolarHBondContact O-CB 3.44Å; R50-N54 PolarHBondContact O-N 3.08Å; R50-N54 PolarHBondContact O-ND2 2.76Å; R50-N54 PolarHBondContact O-OD1 3.14Å; K51-N54 PolarHBondContact O-N 3.18Å; I52-N54 PolarHBondContact O-N 2.95Å; N54-T57 WeakPolarHBondContact CA-OG1 3.25Å; N54-T57 PolarHBondContact O-OG1 3.31Å; N54-H58 WeakPolarHBondContact O-CA 3.14Å; N54-H58 PolarHBondContact O-N 2.95Å; N54-G59 PolarHBondContact O-N 2.88Å
55	V	85.6	Confident	82.5	Confident	89 Å²	89	101.7 Å²	101.7	54%	0.539	53%	0.529	S	S	.	.	H	α-helix	trans	-67.2	-39.6	174.9	170.4	0	0	0	0	111	K51 I52 V53 G59	K51-V55 WeakPolarHBondContact O-CB 3.35Å; K51-V55 VanDerWaalsContact O-CG2 3.24Å; K51-V55 WeakPolarHBondContact O-CG2 3.5Å; K51-V55 PolarHBondContact O-N 3.47Å; I52-V55 PolarHBondContact O-N 2.96Å; V53-V55 VanDerWaalsContact C-N 3.34Å; V53-V55 PolarHBondContact O-N 3.06Å; V55-G59 WeakPolarHBondContact O-CA 3.47Å; V55-G59 PolarHBondContact O-N 2.75Å
56	A	86.7	Confident	83.6	Confident	86 Å²	86	101.7 Å²	101.7	71%	0.711	52%	0.518	S	S	*	.	H	α-helix	trans	-67.5	-38	178	0	0	0	0	0	112.8	I52 V53	I52-A56 WeakPolarHBondContact O-CB 3.4Å; I52-A56 PolarHBondContact O-N 3.34Å; V53-A56 PolarHBondContact O-N 2.84Å
57	T	90.3	Very high	84.6	Confident	82 Å²	82	98.3 Å²	98.3	50%	0.503	50%	0.502	S	S	.	.	H	α-helix	trans	-87.8	-41.2	-174.9	47.8	0	0	0	0	113.4	V53 N54	V53-T57 HydrophobicContact CG1-CG2 4.31Å; V53-T57 WeakPolarHBondContact O-CB 3.34Å; V53-T57 WeakPolarHBondContact O-CG2 3.32Å; V53-T57 PolarHBondContact O-N 3.16Å; V53-T57 PolarHBondContact O-OG1 3.16Å; N54-T57 WeakPolarHBondContact CA-OG1 3.25Å; N54-T57 PolarHBondContact O-OG1 3.31Å
58	H	89.4	Confident	85.9	Confident	91 Å²	91	102.8 Å²	102.8	42%	0.421	51%	0.51	S	S	.	.	H	α-helix	trans	-123	-2.9	-172.1	-54.5	91.2	0	0	0	113	N54 E60 Q61 N62	N54-H58 WeakPolarHBondContact O-CA 3.14Å; N54-H58 PolarHBondContact O-N 2.95Å; H58-E60 VanDerWaalsContact C-N 3.3Å; H58-E60 PolarHBondContact O-N 2.94Å; H58-Q61 PolarHBondContact O-N 3.05Å; H58-Q61 VanDerWaalsContact O-N 3.16Å; H58-N62 WeakPolarHBondContact O-CB 3.47Å; H58-N62 VanDerWaalsContact O-CG 3.24Å; H58-N62 PolarHBondContact O-N 3.04Å; H58-N62 PolarHBondContact O-ND2 2.76Å
59	G	86.3	Confident	86.7	Confident	4 Å²	4	106.9 Å²	106.9	4%	0.041	53%	0.525	C	S	.	.	H	α-helix	trans	-62.7	-33.1	-173.3	0	0	0	0	0	113.8	N54 V55 R63	N54-G59 PolarHBondContact O-N 2.88Å; V55-G59 WeakPolarHBondContact O-CA 3.47Å; V55-G59 PolarHBondContact O-N 2.75Å; G59-R63 WeakPolarHBondContact O-CB 3.43Å; G59-R63 VanDerWaalsContact O-CG 3.27Å; G59-R63 WeakPolarHBondContact O-CG 3.22Å; G59-R63 PolarHBondContact O-N 2.87Å; G59-R63 PolarHBondContact O-NH1 3.18Å
60	E	86.5	Confident	87.2	Confident	131 Å²	131	110.3 Å²	110.3	61%	0.612	53%	0.528	S	S	*	.	H	α-helix	trans	-66.3	-44.2	174.1	-76.5	-170.7	179.2	0	0	112.8	H58 R63 K64	H58-E60 VanDerWaalsContact C-N 3.3Å; H58-E60 PolarHBondContact O-N 2.94Å; E60-R63 PolarHBondContact O-N 3.19Å; E60-K64 WeakPolarHBondContact O-CG 3.29Å; E60-K64 PolarHBondContact O-N 3.32Å; E60-K64 VanDerWaalsContact O-N 3.1Å
61	Q	89.5	Confident	87.8	Confident	118 Å²	118	107.4 Å²	107.4	55%	0.551	52%	0.524	S	S	*	.	H	α-helix	trans	-64.1	-47.3	177.4	-69	177.7	-25.3	0	0	110.4	H58 R63 K64 E65	H58-Q61 PolarHBondContact O-N 3.05Å; H58-Q61 VanDerWaalsContact O-N 3.16Å; Q61-R63 VanDerWaalsContact C-N 3.33Å; Q61-R63 PolarHBondContact O-N 2.98Å; Q61-K64 PolarHBondContact O-N 3.37Å; Q61-K64 VanDerWaalsContact O-N 3.15Å; Q61-E65 PolarHBondContact O-N 3.38Å
62	N	87.9	Confident	88.4	Confident	72 Å²	72	104.4 Å²	104.4	39%	0.385	51%	0.512	S	S	.	.	H	α-helix	trans	-58.3	-43.9	177.6	-66.7	-15.1	0	0	0	111.8	H58 K64 E65 E66	H58-N62 WeakPolarHBondContact O-CB 3.47Å; H58-N62 VanDerWaalsContact O-CG 3.24Å; H58-N62 PolarHBondContact O-N 3.04Å; H58-N62 PolarHBondContact O-ND2 2.76Å; N62-K64 PolarHBondContact O-N 2.96Å; N62-E65 PolarHBondContact O-N 3.25Å; N62-E66 WeakPolarHBondContact O-CB 3.26Å; N62-E66 VanDerWaalsContact O-CG 3.29Å; N62-E66 WeakPolarHBondContact O-CG 3.31Å; N62-E66 PolarHBondContact O-N 3.47Å
63	R	88.5	Confident	88.6	Confident	138 Å²	138	105.6 Å²	105.6	52%	0.521	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-43.1	176.4	-77.9	-172.3	-60.5	-92.7	7.7	112.4	G59 E60 Q61 E66 E67	G59-R63 WeakPolarHBondContact O-CB 3.43Å; G59-R63 VanDerWaalsContact O-CG 3.27Å; G59-R63 WeakPolarHBondContact O-CG 3.22Å; G59-R63 PolarHBondContact O-N 2.87Å; G59-R63 PolarHBondContact O-NH1 3.18Å; E60-R63 PolarHBondContact O-N 3.19Å; Q61-R63 VanDerWaalsContact C-N 3.33Å; Q61-R63 PolarHBondContact O-N 2.98Å; R63-E66 PolarHBondContact O-N 2.98Å; R63-E67 WeakPolarHBondContact O-CB 3.4Å; R63-E67 PolarHBondContact O-N 3.06Å
64	K	91	Very high	88.7	Confident	140 Å²	140	106.8 Å²	106.8	61%	0.609	51%	0.512	S	S	*	.	H	α-helix	trans	-63.8	-42.8	177.4	-73.5	175.5	180	175.5	0	111.8	E60 Q61 N62 E67 K68	E60-K64 WeakPolarHBondContact O-CG 3.29Å; E60-K64 PolarHBondContact O-N 3.32Å; E60-K64 VanDerWaalsContact O-N 3.1Å; Q61-K64 PolarHBondContact O-N 3.37Å; Q61-K64 VanDerWaalsContact O-N 3.15Å; N62-K64 PolarHBondContact O-N 2.96Å; K64-E67 PolarHBondContact O-N 2.79Å; K64-K68 WeakPolarHBondContact O-CB 3.39Å; K64-K68 PolarHBondContact O-N 3.07Å
65	E	90.4	Very high	88.4	Confident	105 Å²	105	110.4 Å²	110.4	49%	0.491	53%	0.526	S	S	.	.	H	α-helix	trans	-66.7	-40.4	177.6	-72.5	-174.9	-169.5	0	0	112.7	Q61 N62 K68 K69	Q61-E65 PolarHBondContact O-N 3.38Å; N62-E65 PolarHBondContact O-N 3.25Å; E65-K68 PolarHBondContact O-N 2.91Å; E65-K69 WeakPolarHBondContact O-CB 3.45Å; E65-K69 WeakPolarHBondContact O-CG 3.46Å; E65-K69 PolarHBondContact O-N 3.06Å
66	E	90.1	Very high	88.1	Confident	132 Å²	132	116.6 Å²	116.6	62%	0.617	54%	0.54	S	S	*	.	H	α-helix	trans	-63.6	-42.3	175.3	-76.6	176	-174.1	0	0	111.6	N62 R63 K69 R70	N62-E66 WeakPolarHBondContact O-CB 3.26Å; N62-E66 VanDerWaalsContact O-CG 3.29Å; N62-E66 WeakPolarHBondContact O-CG 3.31Å; N62-E66 PolarHBondContact O-N 3.47Å; R63-E66 PolarHBondContact O-N 2.98Å; E66-K69 PolarHBondContact O-N 3.24Å; E66-R70 WeakPolarHBondContact O-CB 3.49Å; E66-R70 PolarHBondContact O-N 3.48Å
67	E	90.5	Very high	87	Confident	117 Å²	117	123.4 Å²	123.4	55%	0.547	55%	0.554	S	S	.	*	H	α-helix	trans	-62.5	-46.7	175	-175.1	171.8	-154.8	0	0	111.3	R63 K64 K69 R70 L71	R63-E67 WeakPolarHBondContact O-CB 3.4Å; R63-E67 PolarHBondContact O-N 3.06Å; K64-E67 PolarHBondContact O-N 2.79Å; E67-K69 PolarHBondContact O-N 2.89Å; E67-R70 WeakPolarHBondContact O-CB 3.43Å; E67-R70 PolarHBondContact O-N 3.46Å; E67-R70 VanDerWaalsContact O-N 3.09Å; E67-L71 HydrophobicContact CG-CD1 4.33Å; E67-L71 WeakPolarHBondContact O-CG 3.3Å; E67-L71 PolarHBondContact O-N 3.25Å
68	K	92.1	Very high	86.8	Confident	133 Å²	133	125.5 Å²	125.5	58%	0.578	56%	0.556	S	S	*	*	H	α-helix	trans	-56.3	-49.3	175	-176.4	-179.5	176	-175.4	0	111.6	K64 E65 R70 L71 E72	K64-K68 WeakPolarHBondContact O-CB 3.39Å; K64-K68 PolarHBondContact O-N 3.07Å; E65-K68 PolarHBondContact O-N 2.91Å; K68-R70 VanDerWaalsContact C-N 3.26Å; K68-R70 PolarHBondContact O-N 3.03Å; K68-L71 PolarHBondContact O-N 3.03Å; K68-E72 WeakPolarHBondContact CE-OE1 3.35Å; K68-E72 WeakPolarHBondContact O-CG 3.4Å; K68-E72 PolarHBondContact O-N 3.25Å
69	K	90.6	Very high	86.7	Confident	133 Å²	133	127.3 Å²	127.3	58%	0.578	56%	0.563	S	S	*	*	H	α-helix	trans	-61.4	-34.7	176.8	-75.4	171.6	-178.9	163.9	0	112.3	E65 E66 E67 K73	E65-K69 WeakPolarHBondContact O-CB 3.45Å; E65-K69 WeakPolarHBondContact O-CG 3.46Å; E65-K69 PolarHBondContact O-N 3.06Å; E66-K69 PolarHBondContact O-N 3.24Å; E67-K69 PolarHBondContact O-N 2.89Å; K69-K73 WeakPolarHBondContact O-CB 3.2Å; K69-K73 PolarHBondContact O-N 2.91Å
70	R	90.3	Very high	86.7	Confident	161 Å²	161	134.2 Å²	134.2	61%	0.608	59%	0.592	S	S	*	*	H	α-helix	trans	-67.8	-43.5	177.3	-163.3	-175.7	101.1	-176.2	3	111.4	E66 E67 K68 K73 Q74	E66-R70 WeakPolarHBondContact O-CB 3.49Å; E66-R70 PolarHBondContact O-N 3.48Å; E67-R70 WeakPolarHBondContact O-CB 3.43Å; E67-R70 PolarHBondContact O-N 3.46Å; E67-R70 VanDerWaalsContact O-N 3.09Å; K68-R70 VanDerWaalsContact C-N 3.26Å; K68-R70 PolarHBondContact O-N 3.03Å; R70-K73 PolarHBondContact O-N 2.98Å; R70-Q74 WeakPolarHBondContact O-CG 3.28Å; R70-Q74 PolarHBondContact O-N 3.04Å
71	L	89.4	Confident	86.7	Confident	85 Å²	85	134.4 Å²	134.4	45%	0.445	59%	0.591	S	S	.	*	H	α-helix	trans	-64.5	-47.6	176.7	-67.5	171.4	0	0	0	111	E67 K68 K73 Q74 E75	E67-L71 HydrophobicContact CG-CD1 4.33Å; E67-L71 WeakPolarHBondContact O-CG 3.3Å; E67-L71 PolarHBondContact O-N 3.25Å; K68-L71 PolarHBondContact O-N 3.03Å; L71-K73 PolarHBondContact O-N 3.29Å; L71-Q74 WeakPolarHBondContact O-CA 3.49Å; L71-Q74 WeakPolarHBondContact O-CB 3.27Å; L71-Q74 PolarHBondContact O-N 3.41Å; L71-E75 PolarHBondContact O-N 2.83Å
72	E	89.7	Confident	86.6	Confident	80 Å²	80	135.4 Å²	135.4	37%	0.374	59%	0.594	S	S	.	*	H	α-helix	trans	-57.6	-36.4	175.3	-73	175.5	-175.6	0	0	112.3	K68 R76	K68-E72 WeakPolarHBondContact CE-OE1 3.35Å; K68-E72 WeakPolarHBondContact O-CG 3.4Å; K68-E72 PolarHBondContact O-N 3.25Å; E72-R76 WeakPolarHBondContact O-CG 3.39Å; E72-R76 PolarHBondContact O-N 3.34Å
73	K	88.6	Confident	86.5	Confident	148 Å²	148	139.6 Å²	139.6	64%	0.643	61%	0.607	S	S	*	*	H	α-helix	trans	-73.6	-27.7	176.3	-170.4	174.6	-178.1	178.6	0	113	K69 R70 L71	K69-K73 WeakPolarHBondContact O-CB 3.2Å; K69-K73 PolarHBondContact O-N 2.91Å; R70-K73 PolarHBondContact O-N 2.98Å; L71-K73 PolarHBondContact O-N 3.29Å
74	Q	84.9	Confident	86.3	Confident	108 Å²	108	139.7 Å²	139.7	51%	0.505	61%	0.614	S	S	.	*	H	α-helix	trans	-76.3	-38.5	174.5	-74.9	-179.1	-7.3	0	0	111.4	R70 L71 R76 K77	R70-Q74 WeakPolarHBondContact O-CG 3.28Å; R70-Q74 PolarHBondContact O-N 3.04Å; L71-Q74 WeakPolarHBondContact O-CA 3.49Å; L71-Q74 WeakPolarHBondContact O-CB 3.27Å; L71-Q74 PolarHBondContact O-N 3.41Å; Q74-R76 VanDerWaalsContact C-N 3.29Å; Q74-R76 PolarHBondContact O-N 3.19Å; Q74-K77 PolarHBondContact O-N 3.33Å
75	E	78.9	Confident	86	Confident	165 Å²	165	139.7 Å²	139.7	77%	0.771	61%	0.614	S	S	*	*	H	α-helix	trans	-67.9	-27.9	175.9	-70	-179.5	170.7	0	0	113.2	L71 K77	L71-E75 PolarHBondContact O-N 2.83Å; E75-K77 VanDerWaalsContact C-N 3.29Å
76	R	79	Confident	85.6	Confident	219 Å²	219	142.6 Å²	142.6	83%	0.826	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.1	-2.9	175.7	-72.4	-178.3	-176.1	-163.5	3.4	114.4	E72 Q74	E72-R76 WeakPolarHBondContact O-CG 3.39Å; E72-R76 PolarHBondContact O-N 3.34Å; Q74-R76 VanDerWaalsContact C-N 3.29Å; Q74-R76 PolarHBondContact O-N 3.19Å
77	K	63.4	Low	85.2	Confident	230 Å²	230	143.5 Å²	143.5	100%	1	63%	0.625	S	S	*	*			trans	-102.3	0	177.1	-88	-168.6	172.8	-167.8	0	110.7	Q74 E75	Q74-K77 PolarHBondContact O-N 3.33Å; E75-K77 VanDerWaalsContact C-N 3.29Å

Retrieved 77 of 77 residues in 63.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).