A0A077ZJ94_TRITR Loading...

Protein phosphatase 1 regulatory subunit 14B

AlphaFold DB , UniProt , Accession A0A077ZJ94, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 65 aa.

						>A0A077ZJ94_TRITR|A0A077ZJ94
MDCFRKIRFSSRDDYENERNRILTVKYGKEQMALIRKRLQVEMWLLDQLEGLCDKEVNACCFFYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.4	Low	74.2	Confident	228 Å²	228	163.5 Å²	163.5	100%	1.123	78%	0.781	S	S	*	*				0	89.7	0	-85.5	-70	-176.4	0	0	106.5	C3	M1-C3 PolarHBondContact O-N 3.48Å; M1-C3 VanDerWaalsContact O-N 3.12Å
2	D	65.7	Low	75.3	Confident	153 Å²	153	165.8 Å²	165.8	82%	0.818	78%	0.777	S	S	*	*			trans	-68.4	110.1	175.9	-64.4	-65.1	0	0	0	108.1	F4	D2-F4 VanDerWaalsContact C-N 3.26Å; D2-F4 PolarHBondContact O-N 3.41Å
3	C	70.3	Confident	76.3	Confident	115 Å²	115	161.4 Å²	161.4	78%	0.777	76%	0.761	S	S	*	*			trans	-62.9	94.7	171.2	-61.7	0	0	0	0	107.2	M1 R5	M1-C3 PolarHBondContact O-N 3.48Å; M1-C3 VanDerWaalsContact O-N 3.12Å; C3-R5 VanDerWaalsContact C-N 3.32Å; C3-R5 PolarHBondContact O-N 3.05Å
4	F	64.8	Low	77.2	Confident	203 Å²	203	156 Å²	156	89%	0.89	74%	0.74	S	S	*	*			trans	-50.3	97.5	170.9	-98.6	-93.4	0	0	0	108.3	D2 K6	D2-F4 VanDerWaalsContact C-N 3.26Å; D2-F4 PolarHBondContact O-N 3.41Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.49Å
5	R	74	Confident	77.9	Confident	235 Å²	235	155.7 Å²	155.7	89%	0.887	73%	0.73	S	S	*	*			trans	-71.4	94	174.7	-72.2	-172.8	-165.5	171.9	4.8	107	C3 I7	C3-R5 VanDerWaalsContact C-N 3.32Å; C3-R5 PolarHBondContact O-N 3.05Å; R5-I7 PolarHBondContact O-N 3.12Å
6	K	79.6	Confident	78.6	Confident	183 Å²	183	150.6 Å²	150.6	80%	0.796	71%	0.706	S	S	*	*			trans	-61.8	109.6	168.4	-174.9	172.2	-176.2	172.3	0	107.9	F4 R8	F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.49Å; K6-R8 PolarHBondContact O-N 2.99Å; K6-R8 VanDerWaalsContact O-N 3.14Å
7	I	77.9	Confident	79.2	Confident	135 Å²	135	147.8 Å²	147.8	69%	0.692	70%	0.697	S	S	*	*			trans	-62.4	115.1	170.7	-62.8	172.8	0	0	0	106.6	R5 F9	R5-I7 PolarHBondContact O-N 3.12Å; I7-F9 HydrophobicContact CG2-CE1 4.37Å; I7-F9 HydrophobicContact CG2-CE2 4.14Å; I7-F9 HydrophobicContact CG2-CZ 4.02Å
8	R	77.3	Confident	79.8	Confident	219 Å²	219	144.6 Å²	144.6	83%	0.826	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-97.2	122.2	170.3	-65.8	-148.7	-156.9	-164.5	10.1	108.3	K6	K6-R8 PolarHBondContact O-N 2.99Å; K6-R8 VanDerWaalsContact O-N 3.14Å
9	F	81	Confident	80.3	Confident	192 Å²	192	144.5 Å²	144.5	84%	0.842	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-79.8	117.6	164.7	-62.3	-79.9	0	0	0	107.3	I7	I7-F9 HydrophobicContact CG2-CE1 4.37Å; I7-F9 HydrophobicContact CG2-CE2 4.14Å; I7-F9 HydrophobicContact CG2-CZ 4.02Å
10	S	81.8	Confident	80.7	Confident	82 Å²	82	141.4 Å²	141.4	57%	0.573	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-87.3	143.4	170.3	51.2	0	0	0	0	109.2
11	S	87.1	Confident	81.1	Confident	53 Å²	53	142.7 Å²	142.7	37%	0.371	66%	0.661	S	S	.	*	P	Polyproline II helix	trans	-67.5	166.2	171.7	68.2	0	0	0	0	110.8	D13 D14 Y15	S11-D13 VanDerWaalsContact C-N 3.26Å; S11-D13 PolarHBondContact O-N 3.27Å; S11-D14 WeakPolarHBondContact CB-OD2 3.06Å; S11-D14 PolarHBondContact N-OD2 2.73Å; S11-D14 PolarHBondContact O-N 3.41Å; S11-D14 PolarHBondContact OG-N 3.22Å; S11-D14 VanDerWaalsContact OG-N 3.14Å; S11-D14 PolarHBondContact OG-OD2 3.08Å; S11-Y15 PolarHBondContact O-N 3.15Å; S11-Y15 VanDerWaalsContact O-N 3.14Å
12	R	87.4	Confident	82.8	Confident	192 Å²	192	135.2 Å²	135.2	73%	0.725	63%	0.625	S	S	*	*	H	α-helix	trans	-58.6	-41.9	173.5	179.8	178.3	172.3	174	-0.2	111.1	D14 Y15 E16	R12-D14 VanDerWaalsContact C-N 3.34Å; R12-D14 PolarHBondContact O-N 3.45Å; R12-Y15 WeakPolarHBondContact O-CB 3.13Å; R12-Y15 PolarHBondContact O-N 3.28Å; R12-E16 IonicContact CZ-OE1 2.92Å; R12-E16 IonicContact NE-OE1 3.9Å; R12-E16 PolarHBondContact NE-OE1 3.37Å; R12-E16 IonicContact NH2-OE1 3.39Å; R12-E16 PolarHBondContact NH2-OE1 2.72Å; R12-E16 WeakPolarHBondContact O-CG 3.46Å; R12-E16 PolarHBondContact O-N 2.62Å
13	D	88.7	Confident	84.1	Confident	108 Å²	108	129.9 Å²	129.9	58%	0.578	60%	0.596	S	S	*	*	H	α-helix	trans	-63.1	-40.7	178.6	-61.7	-52.3	0	0	0	111.7	S11 Y15 E16 N17	S11-D13 VanDerWaalsContact C-N 3.26Å; S11-D13 PolarHBondContact O-N 3.27Å; D13-Y15 VanDerWaalsContact C-N 3.3Å; D13-Y15 PolarHBondContact O-N 2.93Å; D13-E16 PolarHBondContact O-N 2.74Å; D13-N17 WeakPolarHBondContact O-CB 3.22Å; D13-N17 VanDerWaalsContact O-CG 3.25Å; D13-N17 PolarHBondContact O-N 2.96Å; D13-N17 PolarHBondContact O-ND2 3.48Å; D13-N17 VanDerWaalsContact O-ND2 3.15Å
14	D	88.6	Confident	85.1	Confident	86 Å²	86	127.4 Å²	127.4	46%	0.46	58%	0.578	S	S	.	*	H	α-helix	trans	-60.5	-41.2	174.9	-64.6	-41.8	0	0	0	111.6	S11 R12 E18	S11-D14 WeakPolarHBondContact CB-OD2 3.06Å; S11-D14 PolarHBondContact N-OD2 2.73Å; S11-D14 PolarHBondContact O-N 3.41Å; S11-D14 PolarHBondContact OG-N 3.22Å; S11-D14 VanDerWaalsContact OG-N 3.14Å; S11-D14 PolarHBondContact OG-OD2 3.08Å; R12-D14 VanDerWaalsContact C-N 3.34Å; R12-D14 PolarHBondContact O-N 3.45Å; D14-E18 WeakPolarHBondContact O-CB 3.23Å; D14-E18 PolarHBondContact O-N 3.15Å
15	Y	88.5	Confident	86.5	Confident	152 Å²	152	123.4 Å²	123.4	60%	0.596	57%	0.57	S	S	*	*	H	α-helix	trans	-66.5	-43.7	177.7	178.2	-93.9	0	0	0	112.1	S11 R12 D13 N17 E18 R19	S11-Y15 PolarHBondContact O-N 3.15Å; S11-Y15 VanDerWaalsContact O-N 3.14Å; R12-Y15 WeakPolarHBondContact O-CB 3.13Å; R12-Y15 PolarHBondContact O-N 3.28Å; D13-Y15 VanDerWaalsContact C-N 3.3Å; D13-Y15 PolarHBondContact O-N 2.93Å; Y15-N17 VanDerWaalsContact C-N 3.33Å; Y15-N17 PolarHBondContact O-N 3.3Å; Y15-E18 PolarHBondContact O-N 3.21Å; Y15-R19 VanDerWaalsContact O-CB 3.24Å; Y15-R19 WeakPolarHBondContact O-CB 3.26Å; Y15-R19 PolarHBondContact O-N 3.12Å
16	E	89.1	Confident	87.4	Confident	73 Å²	73	119.3 Å²	119.3	34%	0.341	56%	0.558	S	S	.	*	H	α-helix	trans	-64.1	-40.2	177.9	-71.2	-176.7	-173.4	0	0	111.3	R12 D13 R19 N20	R12-E16 IonicContact CZ-OE1 2.92Å; R12-E16 IonicContact NE-OE1 3.9Å; R12-E16 PolarHBondContact NE-OE1 3.37Å; R12-E16 IonicContact NH2-OE1 3.39Å; R12-E16 PolarHBondContact NH2-OE1 2.72Å; R12-E16 WeakPolarHBondContact O-CG 3.46Å; R12-E16 PolarHBondContact O-N 2.62Å; D13-E16 PolarHBondContact O-N 2.74Å; E16-R19 PolarHBondContact O-N 3.48Å; E16-N20 WeakPolarHBondContact O-CB 3.32Å; E16-N20 PolarHBondContact O-N 3.46Å; E16-N20 PolarHBondContact O-ND2 3.49Å
17	N	88.7	Confident	88	Confident	104 Å²	104	116.7 Å²	116.7	56%	0.556	54%	0.544	S	S	*	.	H	α-helix	trans	-64.6	-47.5	175.5	-73.9	-30.9	0	0	0	112.5	D13 Y15 R19 N20 R21	D13-N17 WeakPolarHBondContact O-CB 3.22Å; D13-N17 VanDerWaalsContact O-CG 3.25Å; D13-N17 PolarHBondContact O-N 2.96Å; D13-N17 PolarHBondContact O-ND2 3.48Å; D13-N17 VanDerWaalsContact O-ND2 3.15Å; Y15-N17 VanDerWaalsContact C-N 3.33Å; Y15-N17 PolarHBondContact O-N 3.3Å; N17-R19 VanDerWaalsContact C-N 3.35Å; N17-R19 PolarHBondContact O-N 2.93Å; N17-N20 PolarHBondContact O-N 2.78Å; N17-R21 PolarHBondContact O-N 2.8Å
18	E	88.9	Confident	88.7	Confident	89 Å²	89	111.6 Å²	111.6	42%	0.416	53%	0.525	S	S	.	.	H	α-helix	trans	-65.3	-40.2	178.3	-176.9	57.3	-160.7	0	0	111.2	D14 Y15 N20 R21 I22	D14-E18 WeakPolarHBondContact O-CB 3.23Å; D14-E18 PolarHBondContact O-N 3.15Å; Y15-E18 PolarHBondContact O-N 3.21Å; E18-N20 PolarHBondContact O-N 3.24Å; E18-R21 WeakPolarHBondContact O-CB 3.43Å; E18-R21 PolarHBondContact O-N 2.74Å; E18-R21 IonicContact OE2-NH1 3.46Å; E18-I22 HydrophobicContact CG-CD1 3.93Å; E18-I22 HydrophobicContact CG-CG1 4.49Å; E18-I22 VanDerWaalsContact O-CG1 3.3Å; E18-I22 WeakPolarHBondContact O-CG1 3.43Å; E18-I22 PolarHBondContact O-N 3.46Å
19	R	89.4	Confident	89.4	Confident	144 Å²	144	109.3 Å²	109.3	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-58.5	-48	172.8	-177.7	-172.8	175.6	-155	-0.3	111.1	Y15 E16 N17 R21 I22 L23	Y15-R19 VanDerWaalsContact O-CB 3.24Å; Y15-R19 WeakPolarHBondContact O-CB 3.26Å; Y15-R19 PolarHBondContact O-N 3.12Å; E16-R19 PolarHBondContact O-N 3.48Å; N17-R19 VanDerWaalsContact C-N 3.35Å; N17-R19 PolarHBondContact O-N 2.93Å; R19-R21 VanDerWaalsContact C-N 3.29Å; R19-R21 PolarHBondContact O-N 2.94Å; R19-I22 PolarHBondContact O-N 3.19Å; R19-L23 HydrophobicContact CG-CD1 3.89Å; R19-L23 HydrophobicContact CG-CG 4.33Å; R19-L23 WeakPolarHBondContact O-CB 3.26Å; R19-L23 VanDerWaalsContact O-CG 3.25Å; R19-L23 WeakPolarHBondContact O-CG 3.39Å; R19-L23 PolarHBondContact O-N 2.96Å
20	N	88.9	Confident	90	Very high	82 Å²	82	107.4 Å²	107.4	44%	0.439	52%	0.515	S	S	.	.	H	α-helix	trans	-61	-39.3	178.7	-74.8	-21.2	0	0	0	111.9	E16 N17 E18 T24	E16-N20 WeakPolarHBondContact O-CB 3.32Å; E16-N20 PolarHBondContact O-N 3.46Å; E16-N20 PolarHBondContact O-ND2 3.49Å; N17-N20 PolarHBondContact O-N 2.78Å; E18-N20 PolarHBondContact O-N 3.24Å; N20-T24 WeakPolarHBondContact O-CB 3.34Å; N20-T24 PolarHBondContact O-N 3.35Å; N20-T24 PolarHBondContact O-OG1 3.33Å
21	R	89.3	Confident	90.7	Very high	168 Å²	168	108.3 Å²	108.3	63%	0.634	51%	0.51	S	S	*	.	H	α-helix	trans	-62.2	-53	174.5	-174.7	-174.7	-179	-172.9	2	111.2	N17 E18 R19 L23 T24 V25	N17-R21 PolarHBondContact O-N 2.8Å; E18-R21 WeakPolarHBondContact O-CB 3.43Å; E18-R21 PolarHBondContact O-N 2.74Å; E18-R21 IonicContact OE2-NH1 3.46Å; R19-R21 VanDerWaalsContact C-N 3.29Å; R19-R21 PolarHBondContact O-N 2.94Å; R21-L23 VanDerWaalsContact C-N 3.31Å; R21-L23 PolarHBondContact O-N 2.98Å; R21-T24 PolarHBondContact O-N 2.88Å; R21-V25 WeakPolarHBondContact O-CG2 3.34Å; R21-V25 PolarHBondContact O-N 3.5Å
22	I	92.4	Very high	91	Very high	71 Å²	71	106.4 Å²	106.4	36%	0.364	50%	0.495	S	S	.	.	H	α-helix	trans	-58.4	-45.1	-179.8	-69.2	166.9	0	0	0	110.7	E18 R19 V25 K26	E18-I22 HydrophobicContact CG-CD1 3.93Å; E18-I22 HydrophobicContact CG-CG1 4.49Å; E18-I22 VanDerWaalsContact O-CG1 3.3Å; E18-I22 WeakPolarHBondContact O-CG1 3.43Å; E18-I22 PolarHBondContact O-N 3.46Å; R19-I22 PolarHBondContact O-N 3.19Å; I22-V25 PolarHBondContact O-N 3.28Å; I22-K26 HydrophobicContact CG2-CD 4.1Å; I22-K26 HydrophobicContact CG2-CG 4.47Å; I22-K26 WeakPolarHBondContact O-CB 3.31Å; I22-K26 WeakPolarHBondContact O-CG 3.37Å; I22-K26 PolarHBondContact O-N 3.02Å
23	L	92.6	Very high	91.3	Very high	41 Å²	41	98.9 Å²	98.9	22%	0.215	47%	0.474	C	S	.	.	H	α-helix	trans	-65.7	-40.5	179.4	-70.7	175.9	0	0	0	112.1	R19 R21 V25 K26 Y27 M32	R19-L23 HydrophobicContact CG-CD1 3.89Å; R19-L23 HydrophobicContact CG-CG 4.33Å; R19-L23 WeakPolarHBondContact O-CB 3.26Å; R19-L23 VanDerWaalsContact O-CG 3.25Å; R19-L23 WeakPolarHBondContact O-CG 3.39Å; R19-L23 PolarHBondContact O-N 2.96Å; R21-L23 VanDerWaalsContact C-N 3.31Å; R21-L23 PolarHBondContact O-N 2.98Å; L23-V25 VanDerWaalsContact C-N 3.3Å; L23-V25 PolarHBondContact O-N 3.33Å; L23-K26 PolarHBondContact O-N 3.27Å; L23-Y27 HydrophobicContact CD2-CD2 4.06Å; L23-Y27 HydrophobicContact CD2-CE2 3.67Å; L23-Y27 WeakPolarHBondContact O-CD2 3.42Å; L23-Y27 PolarHBondContact O-N 2.99Å; L23-M32 HydrophobicContact CB-CE 4.24Å; L23-M32 HydrophobicContact CB-SD 3.71Å; L23-M32 HydrophobicContact CD1-SD 4.37Å
24	T	92.1	Very high	91.7	Very high	63 Å²	63	97.7 Å²	97.7	39%	0.387	47%	0.468	S	S	.	.	H	α-helix	trans	-63.7	-38.4	176.5	-58.4	0	0	0	0	111.4	N20 R21 G28	N20-T24 WeakPolarHBondContact O-CB 3.34Å; N20-T24 PolarHBondContact O-N 3.35Å; N20-T24 PolarHBondContact O-OG1 3.33Å; R21-T24 PolarHBondContact O-N 2.88Å; T24-G28 WeakPolarHBondContact O-CA 3.41Å; T24-G28 PolarHBondContact O-N 3.47Å
25	V	92.8	Very high	92	Very high	120 Å²	120	97.7 Å²	97.7	73%	0.727	47%	0.467	S	S	*	.	H	α-helix	trans	-66	-42.1	174	172.1	0	0	0	0	111.5	R21 I22 L23	R21-V25 WeakPolarHBondContact O-CG2 3.34Å; R21-V25 PolarHBondContact O-N 3.5Å; I22-V25 PolarHBondContact O-N 3.28Å; L23-V25 VanDerWaalsContact C-N 3.3Å; L23-V25 PolarHBondContact O-N 3.33Å
26	K	93.3	Very high	92.3	Very high	148 Å²	148	96.6 Å²	96.6	64%	0.643	46%	0.461	S	S	*	.	H	α-helix	trans	-71.8	-40.9	-176.3	-78	-176.2	177.3	-173.2	0	114.3	I22 L23	I22-K26 HydrophobicContact CG2-CD 4.1Å; I22-K26 HydrophobicContact CG2-CG 4.47Å; I22-K26 WeakPolarHBondContact O-CB 3.31Å; I22-K26 WeakPolarHBondContact O-CG 3.37Å; I22-K26 PolarHBondContact O-N 3.02Å; L23-K26 PolarHBondContact O-N 3.27Å
27	Y	93.1	Very high	92.7	Very high	128 Å²	128	99.4 Å²	99.4	50%	0.502	47%	0.472	S	S	.	.	H	α-helix	trans	-117.8	-16.3	-169.3	-57	-81.4	0	0	0	112.9	L23 Q31 M32	L23-Y27 HydrophobicContact CD2-CD2 4.06Å; L23-Y27 HydrophobicContact CD2-CE2 3.67Å; L23-Y27 WeakPolarHBondContact O-CD2 3.42Å; L23-Y27 PolarHBondContact O-N 2.99Å; Y27-Q31 WeakPolarHBondContact O-CB 3.49Å; Y27-Q31 WeakPolarHBondContact O-CG 3.34Å; Y27-M32 VanDerWaalsContact CB-CE 3.46Å; Y27-M32 HydrophobicContact CD2-CE 3.38Å; Y27-M32 HydrophobicContact CE2-CE 4.26Å; Y27-M32 HydrophobicContact CG-CE 3.57Å
28	G	92.5	Very high	93.1	Very high	28 Å²	28	102 Å²	102	29%	0.289	48%	0.475	S	S	.	.	H	α-helix	trans	84.1	159.9	-175	0	0	0	0	0	113.3	T24 E30 M32	T24-G28 WeakPolarHBondContact O-CA 3.41Å; T24-G28 PolarHBondContact O-N 3.47Å; G28-E30 PolarHBondContact O-N 3.42Å; G28-M32 WeakPolarHBondContact O-CB 3.22Å; G28-M32 VanDerWaalsContact O-CG 3.31Å; G28-M32 WeakPolarHBondContact O-CG 3.17Å; G28-M32 PolarHBondContact O-N 3.24Å
29	K	91.2	Very high	93.5	Very high	171 Å²	171	102 Å²	102	74%	0.743	48%	0.477	S	S	*	.	H	α-helix	trans	-62.5	-40.2	-175.5	-174.4	-179.8	179	-177.5	0	112.7	A33	K29-A33 PolarHBondContact O-N 3.4Å
30	E	94	Very high	93.9	Very high	152 Å²	152	101.5 Å²	101.5	71%	0.71	48%	0.481	S	S	*	.	H	α-helix	trans	-68.9	-50	-177.6	-173.9	175.6	178.3	0	0	111.9	G28 M32 A33 L34	G28-E30 PolarHBondContact O-N 3.42Å; E30-M32 VanDerWaalsContact C-N 3.3Å; E30-M32 PolarHBondContact O-N 3.08Å; E30-A33 WeakPolarHBondContact O-CA 3.36Å; E30-A33 WeakPolarHBondContact O-CB 3.44Å; E30-A33 PolarHBondContact O-N 3.39Å; E30-L34 PolarHBondContact O-N 3.16Å
31	Q	95.6	Very high	94.3	Very high	101 Å²	101	102 Å²	102	47%	0.472	49%	0.486	S	S	.	.	H	α-helix	trans	-59.8	-41.8	175.2	-66.3	-68.4	-40.9	0	0	111.4	Y27 A33 L34 I35	Y27-Q31 WeakPolarHBondContact O-CB 3.49Å; Y27-Q31 WeakPolarHBondContact O-CG 3.34Å; Q31-A33 VanDerWaalsContact C-N 3.26Å; Q31-A33 PolarHBondContact O-N 3.3Å; Q31-L34 WeakPolarHBondContact O-CB 3.38Å; Q31-L34 PolarHBondContact O-N 2.91Å; Q31-L34 VanDerWaalsContact O-N 3.12Å; Q31-I35 WeakPolarHBondContact O-CG1 3.34Å; Q31-I35 PolarHBondContact O-N 3.01Å
32	M	94	Very high	94.7	Very high	13 Å²	13	97.6 Å²	97.6	6%	0.064	47%	0.473	C	S	.	.	H	α-helix	trans	-59.5	-37.2	173.6	-80.5	-61.3	111.3	0	0	112.8	L23 Y27 G28 E30 I35 R36	L23-M32 HydrophobicContact CB-CE 4.24Å; L23-M32 HydrophobicContact CB-SD 3.71Å; L23-M32 HydrophobicContact CD1-SD 4.37Å; Y27-M32 VanDerWaalsContact CB-CE 3.46Å; Y27-M32 HydrophobicContact CD2-CE 3.38Å; Y27-M32 HydrophobicContact CE2-CE 4.26Å; Y27-M32 HydrophobicContact CG-CE 3.57Å; G28-M32 WeakPolarHBondContact O-CB 3.22Å; G28-M32 VanDerWaalsContact O-CG 3.31Å; G28-M32 WeakPolarHBondContact O-CG 3.17Å; G28-M32 PolarHBondContact O-N 3.24Å; E30-M32 VanDerWaalsContact C-N 3.3Å; E30-M32 PolarHBondContact O-N 3.08Å; M32-I35 HydrophobicContact CE-CD1 3.55Å; M32-R36 WeakPolarHBondContact O-CG 3.35Å; M32-R36 PolarHBondContact O-N 3.39Å; M32-R36 VanDerWaalsContact O-N 3.08Å
33	A	94.3	Very high	94.9	Very high	34 Å²	34	99.9 Å²	99.9	28%	0.281	48%	0.484	S	S	.	.	H	α-helix	trans	-67.5	-40.9	174.3	0	0	0	0	0	111.8	K29 E30 Q31 R36 K37	K29-A33 PolarHBondContact O-N 3.4Å; E30-A33 WeakPolarHBondContact O-CA 3.36Å; E30-A33 WeakPolarHBondContact O-CB 3.44Å; E30-A33 PolarHBondContact O-N 3.39Å; Q31-A33 VanDerWaalsContact C-N 3.26Å; Q31-A33 PolarHBondContact O-N 3.3Å; A33-R36 PolarHBondContact O-N 2.75Å; A33-K37 WeakPolarHBondContact O-CG 3.49Å; A33-K37 PolarHBondContact O-N 3.38Å
34	L	97.2	Very high	95.1	Very high	84 Å²	84	105.3 Å²	105.3	44%	0.44	50%	0.501	S	S	.	.	H	α-helix	trans	-63.1	-43.1	175.7	-67.6	174.4	0	0	0	112	E30 Q31 R36 K37 R38	E30-L34 PolarHBondContact O-N 3.16Å; Q31-L34 WeakPolarHBondContact O-CB 3.38Å; Q31-L34 PolarHBondContact O-N 2.91Å; Q31-L34 VanDerWaalsContact O-N 3.12Å; L34-R36 PolarHBondContact O-N 3.01Å; L34-K37 PolarHBondContact O-N 3.08Å; L34-R38 WeakPolarHBondContact O-CB 3.49Å; L34-R38 PolarHBondContact O-N 3.27Å
35	I	94.8	Very high	95.3	Very high	85 Å²	85	106.7 Å²	106.7	44%	0.436	51%	0.506	S	S	.	.	H	α-helix	trans	-62	-44.3	176.7	-69.7	170.7	0	0	0	110.8	Q31 M32 K37 R38 L39	Q31-I35 WeakPolarHBondContact O-CG1 3.34Å; Q31-I35 PolarHBondContact O-N 3.01Å; M32-I35 HydrophobicContact CE-CD1 3.55Å; I35-K37 PolarHBondContact O-N 2.87Å; I35-R38 PolarHBondContact O-N 2.86Å; I35-L39 WeakPolarHBondContact O-CB 3.34Å; I35-L39 PolarHBondContact O-N 3.29Å
36	R	94.7	Very high	95.4	Very high	129 Å²	129	106.3 Å²	106.3	49%	0.487	50%	0.499	S	S	.	.	H	α-helix	trans	-60.6	-44.1	175.6	-77.3	-173.5	-70.8	-90.8	-0.9	112.1	M32 A33 L34 L39 Q40	M32-R36 WeakPolarHBondContact O-CG 3.35Å; M32-R36 PolarHBondContact O-N 3.39Å; M32-R36 VanDerWaalsContact O-N 3.08Å; A33-R36 PolarHBondContact O-N 2.75Å; L34-R36 PolarHBondContact O-N 3.01Å; R36-L39 PolarHBondContact O-N 3.34Å; R36-Q40 WeakPolarHBondContact O-CG 3.43Å; R36-Q40 PolarHBondContact O-N 3.48Å; R36-Q40 VanDerWaalsContact O-N 3.08Å
37	K	97.2	Very high	95.4	Very high	132 Å²	132	103.7 Å²	103.7	57%	0.574	49%	0.492	S	S	*	.	H	α-helix	trans	-61.4	-44.7	175.8	-73.1	175.9	178.6	-175.9	0	111.7	A33 L34 I35 Q40 V41	A33-K37 WeakPolarHBondContact O-CG 3.49Å; A33-K37 PolarHBondContact O-N 3.38Å; L34-K37 PolarHBondContact O-N 3.08Å; I35-K37 PolarHBondContact O-N 2.87Å; K37-Q40 WeakPolarHBondContact O-CB 3.44Å; K37-Q40 PolarHBondContact O-N 3.26Å; K37-V41 PolarHBondContact O-N 3.28Å
38	R	96.9	Very high	95.4	Very high	159 Å²	159	101.7 Å²	101.7	60%	0.6	49%	0.487	S	S	*	.	H	α-helix	trans	-61.4	-45.9	178.2	-175.6	172.4	-178.3	-72.5	-14.4	111.4	L34 I35 Q40 V41 E42	L34-R38 WeakPolarHBondContact O-CB 3.49Å; L34-R38 PolarHBondContact O-N 3.27Å; I35-R38 PolarHBondContact O-N 2.86Å; R38-Q40 VanDerWaalsContact C-N 3.31Å; R38-Q40 PolarHBondContact O-N 3.15Å; R38-V41 PolarHBondContact O-N 3.14Å; R38-V41 VanDerWaalsContact O-N 3.16Å; R38-E42 IonicContact CZ-OE1 2.67Å; R38-E42 IonicContact NE-OE1 3.98Å; R38-E42 VanDerWaalsContact NH1-CD 3.34Å; R38-E42 IonicContact NH1-OE1 3.61Å; R38-E42 PolarHBondContact NH1-OE1 3.41Å; R38-E42 IonicContact NH1-OE2 2.95Å; R38-E42 PolarHBondContact NH1-OE2 3.42Å; R38-E42 IonicContact NH2-OE1 2.75Å; R38-E42 PolarHBondContact NH2-OE1 2.91Å; R38-E42 PolarHBondContact O-N 3.12Å
39	L	97.4	Very high	95.4	Very high	89 Å²	89	104.3 Å²	104.3	47%	0.466	50%	0.495	S	S	.	.	H	α-helix	trans	-59.2	-41.7	177.3	-179.5	63.5	0	0	0	111.9	I35 R36 V41 E42 M43	I35-L39 WeakPolarHBondContact O-CB 3.34Å; I35-L39 PolarHBondContact O-N 3.29Å; R36-L39 PolarHBondContact O-N 3.34Å; L39-V41 VanDerWaalsContact C-N 3.3Å; L39-V41 PolarHBondContact O-N 3.48Å; L39-E42 PolarHBondContact O-N 3.46Å; L39-M43 HydrophobicContact CD1-CG 4.29Å; L39-M43 HydrophobicContact CD1-SD 4.46Å; L39-M43 HydrophobicContact CG-CG 4.45Å; L39-M43 HydrophobicContact CG-SD 4.18Å; L39-M43 WeakPolarHBondContact O-CG 3.43Å; L39-M43 PolarHBondContact O-N 2.67Å
40	Q	97.5	Very high	95.3	Very high	134 Å²	134	101.9 Å²	101.9	63%	0.626	49%	0.486	S	S	*	.	H	α-helix	trans	-59.6	-40.7	176.5	-73.9	173.8	-38.7	0	0	112.3	R36 K37 R38 W44	R36-Q40 WeakPolarHBondContact O-CG 3.43Å; R36-Q40 PolarHBondContact O-N 3.48Å; R36-Q40 VanDerWaalsContact O-N 3.08Å; K37-Q40 WeakPolarHBondContact O-CB 3.44Å; K37-Q40 PolarHBondContact O-N 3.26Å; R38-Q40 VanDerWaalsContact C-N 3.31Å; R38-Q40 PolarHBondContact O-N 3.15Å; Q40-W44 WeakPolarHBondContact O-CB 3.46Å; Q40-W44 PolarHBondContact O-N 2.92Å
41	V	98.1	Very high	95	Very high	91 Å²	91	96 Å²	96	55%	0.552	47%	0.466	S	S	*	.	H	α-helix	trans	-68.5	-42.2	177.1	176.7	0	0	0	0	111.4	K37 R38 L39 W44 L45	K37-V41 PolarHBondContact O-N 3.28Å; R38-V41 PolarHBondContact O-N 3.14Å; R38-V41 VanDerWaalsContact O-N 3.16Å; L39-V41 VanDerWaalsContact C-N 3.3Å; L39-V41 PolarHBondContact O-N 3.48Å; V41-W44 PolarHBondContact O-N 3.19Å; V41-L45 WeakPolarHBondContact O-CB 3.34Å; V41-L45 PolarHBondContact O-N 3.37Å
42	E	97.7	Very high	94.5	Very high	77 Å²	77	96 Å²	96	36%	0.36	47%	0.469	S	S	.	.	H	α-helix	trans	-61.7	-44.1	176.4	-71.3	-179.8	154.3	0	0	111.5	R38 L39 L45 L46	R38-E42 IonicContact CZ-OE1 2.67Å; R38-E42 IonicContact NE-OE1 3.98Å; R38-E42 VanDerWaalsContact NH1-CD 3.34Å; R38-E42 IonicContact NH1-OE1 3.61Å; R38-E42 PolarHBondContact NH1-OE1 3.41Å; R38-E42 IonicContact NH1-OE2 2.95Å; R38-E42 PolarHBondContact NH1-OE2 3.42Å; R38-E42 IonicContact NH2-OE1 2.75Å; R38-E42 PolarHBondContact NH2-OE1 2.91Å; R38-E42 PolarHBondContact O-N 3.12Å; L39-E42 PolarHBondContact O-N 3.46Å; E42-L45 PolarHBondContact O-N 3.01Å; E42-L46 WeakPolarHBondContact O-CG 3.48Å; E42-L46 PolarHBondContact O-N 3.05Å
43	M	96.5	Very high	93.9	Very high	119 Å²	119	98.7 Å²	98.7	59%	0.586	49%	0.488	S	S	*	.	H	α-helix	trans	-63.6	-42.8	175.4	-70.9	-178.5	68.7	0	0	112	L39 L45 L46 D47	L39-M43 HydrophobicContact CD1-CG 4.29Å; L39-M43 HydrophobicContact CD1-SD 4.46Å; L39-M43 HydrophobicContact CG-CG 4.45Å; L39-M43 HydrophobicContact CG-SD 4.18Å; L39-M43 WeakPolarHBondContact O-CG 3.43Å; L39-M43 PolarHBondContact O-N 2.67Å; M43-L45 VanDerWaalsContact C-N 3.35Å; M43-L45 PolarHBondContact O-N 2.94Å; M43-L46 PolarHBondContact O-N 3.43Å; M43-D47 PolarHBondContact O-N 3.4Å
44	W	96.6	Very high	92.9	Very high	154 Å²	154	101.1 Å²	101.1	58%	0.583	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-44.4	175	173.1	75.9	0	0	0	111.5	Q40 V41 L46 D47 Q48	Q40-W44 WeakPolarHBondContact O-CB 3.46Å; Q40-W44 PolarHBondContact O-N 2.92Å; V41-W44 PolarHBondContact O-N 3.19Å; W44-L46 VanDerWaalsContact C-N 3.35Å; W44-L46 PolarHBondContact O-N 2.75Å; W44-D47 WeakPolarHBondContact O-CB 3.42Å; W44-D47 PolarHBondContact O-N 2.66Å; W44-Q48 HydrophobicContact CD2-CG 4.1Å; W44-Q48 HydrophobicContact CH2-CG 4.22Å; W44-Q48 HydrophobicContact CZ2-CG 3.72Å; W44-Q48 WeakPolarHBondContact O-CG 3.31Å; W44-Q48 PolarHBondContact O-N 3.46Å
45	L	96.1	Very high	91.4	Very high	92 Å²	92	104.2 Å²	104.2	48%	0.482	51%	0.506	S	S	.	.	H	α-helix	trans	-62.7	-41.8	177.9	-179.1	64.6	0	0	0	111.9	V41 E42 M43 D47 Q48 L49	V41-L45 WeakPolarHBondContact O-CB 3.34Å; V41-L45 PolarHBondContact O-N 3.37Å; E42-L45 PolarHBondContact O-N 3.01Å; M43-L45 VanDerWaalsContact C-N 3.35Å; M43-L45 PolarHBondContact O-N 2.94Å; L45-D47 VanDerWaalsContact C-N 3.35Å; L45-Q48 PolarHBondContact O-N 3.26Å; L45-L49 HydrophobicContact CG-CD1 4.22Å; L45-L49 WeakPolarHBondContact O-CG 3.39Å; L45-L49 PolarHBondContact O-N 2.9Å
46	L	94.9	Very high	89.7	Confident	112 Å²	112	107.3 Å²	107.3	59%	0.586	52%	0.519	S	S	*	.	H	α-helix	trans	-60.5	-44.3	175.6	-73.5	169.1	0	0	0	111.5	E42 M43 W44 Q48 L49 E50	E42-L46 WeakPolarHBondContact O-CG 3.48Å; E42-L46 PolarHBondContact O-N 3.05Å; M43-L46 PolarHBondContact O-N 3.43Å; W44-L46 VanDerWaalsContact C-N 3.35Å; W44-L46 PolarHBondContact O-N 2.75Å; L46-Q48 PolarHBondContact O-N 2.91Å; L46-L49 PolarHBondContact O-N 3.3Å; L46-E50 WeakPolarHBondContact O-CB 3.17Å; L46-E50 PolarHBondContact O-N 2.88Å
47	D	94.1	Very high	87.9	Confident	94 Å²	94	104.7 Å²	104.7	50%	0.503	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-41.2	175.7	176.3	76.3	0	0	0	112.1	M43 W44 L45 L49 E50 G51	M43-D47 PolarHBondContact O-N 3.4Å; W44-D47 WeakPolarHBondContact O-CB 3.42Å; W44-D47 PolarHBondContact O-N 2.66Å; L45-D47 VanDerWaalsContact C-N 3.35Å; D47-L49 PolarHBondContact O-N 3.49Å; D47-E50 PolarHBondContact O-N 3.24Å; D47-G51 PolarHBondContact O-N 2.93Å
48	Q	93.1	Very high	85.8	Confident	85 Å²	85	103.2 Å²	103.2	40%	0.397	52%	0.515	S	S	.	.	H	α-helix	trans	-63.8	-40.7	173.8	-63.9	-50.3	-82.5	0	0	112.3	W44 L45 L46 L52	W44-Q48 HydrophobicContact CD2-CG 4.1Å; W44-Q48 HydrophobicContact CH2-CG 4.22Å; W44-Q48 HydrophobicContact CZ2-CG 3.72Å; W44-Q48 WeakPolarHBondContact O-CG 3.31Å; W44-Q48 PolarHBondContact O-N 3.46Å; L45-Q48 PolarHBondContact O-N 3.26Å; L46-Q48 PolarHBondContact O-N 2.91Å; Q48-L52 VanDerWaalsContact O-CG 3.31Å; Q48-L52 WeakPolarHBondContact O-CG 3.45Å; Q48-L52 PolarHBondContact O-N 2.97Å; Q48-L52 VanDerWaalsContact O-N 3.15Å
49	L	90.9	Very high	83.8	Confident	84 Å²	84	98.2 Å²	98.2	44%	0.44	51%	0.508	S	S	.	.	H	α-helix	trans	-68.4	-42.7	177.6	-73.2	170.8	0	0	0	111.7	L45 L46 D47 G51 L52 C53	L45-L49 HydrophobicContact CG-CD1 4.22Å; L45-L49 WeakPolarHBondContact O-CG 3.39Å; L45-L49 PolarHBondContact O-N 2.9Å; L46-L49 PolarHBondContact O-N 3.3Å; D47-L49 PolarHBondContact O-N 3.49Å; L49-G51 VanDerWaalsContact C-N 3.33Å; L49-G51 PolarHBondContact O-N 3.5Å; L49-L52 PolarHBondContact O-N 3.44Å; L49-L52 VanDerWaalsContact O-N 3.12Å; L49-C53 WeakPolarHBondContact O-CB 3.35Å; L49-C53 PolarHBondContact O-N 2.97Å
50	E	88.8	Confident	81.4	Confident	120 Å²	120	98 Å²	98	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-58.9	-46	174.5	-174.7	169.3	-160.1	0	0	110.3	L46 D47 L52 C53 D54	L46-E50 WeakPolarHBondContact O-CB 3.17Å; L46-E50 PolarHBondContact O-N 2.88Å; D47-E50 PolarHBondContact O-N 3.24Å; E50-L52 PolarHBondContact O-N 2.94Å; E50-C53 CarbonylContact O-C 3.59Å; E50-C53 PolarHBondContact O-N 3.14Å; E50-D54 WeakPolarHBondContact O-CB 3.38Å; E50-D54 PolarHBondContact O-N 2.96Å
51	G	88.1	Confident	78.9	Confident	29 Å²	29	95.7 Å²	95.7	30%	0.299	51%	0.511	S	S	.	.	H	α-helix	trans	-65.5	-20	175.5	0	0	0	0	0	115.3	D47 L49 K55	D47-G51 PolarHBondContact O-N 2.93Å; L49-G51 VanDerWaalsContact C-N 3.33Å; L49-G51 PolarHBondContact O-N 3.5Å; G51-K55 VanDerWaalsContact O-CD 3.23Å; G51-K55 WeakPolarHBondContact O-CD 3.39Å; G51-K55 VanDerWaalsContact O-CE 3.22Å; G51-K55 WeakPolarHBondContact O-CE 3.19Å; G51-K55 VanDerWaalsContact O-CG 3.26Å; G51-K55 WeakPolarHBondContact O-CG 3.34Å
52	L	86.4	Confident	76.7	Confident	101 Å²	101	99.3 Å²	99.3	53%	0.529	52%	0.519	S	S	.	.	H	α-helix	trans	-86.7	-43.6	171.7	-69.8	172.1	0	0	0	111.2	Q48 L49 E50 K55 E56	Q48-L52 VanDerWaalsContact O-CG 3.31Å; Q48-L52 WeakPolarHBondContact O-CG 3.45Å; Q48-L52 PolarHBondContact O-N 2.97Å; Q48-L52 VanDerWaalsContact O-N 3.15Å; L49-L52 PolarHBondContact O-N 3.44Å; L49-L52 VanDerWaalsContact O-N 3.12Å; E50-L52 PolarHBondContact O-N 2.94Å; L52-K55 WeakPolarHBondContact O-CB 3.24Å; L52-K55 PolarHBondContact O-N 3.49Å; L52-K55 VanDerWaalsContact O-N 3.12Å; L52-E56 PolarHBondContact O-N 3.33Å
53	C	80.2	Confident	74.6	Confident	69 Å²	69	104 Å²	104	47%	0.466	54%	0.539	S	S	.	.	H	α-helix	trans	-61.8	-41.7	174.6	-79	0	0	0	0	111	L49 E50 K55 E56 V57	L49-C53 WeakPolarHBondContact O-CB 3.35Å; L49-C53 PolarHBondContact O-N 2.97Å; E50-C53 CarbonylContact O-C 3.59Å; E50-C53 PolarHBondContact O-N 3.14Å; C53-K55 PolarHBondContact O-N 2.96Å; C53-E56 CarbonylContact O-C 3.51Å; C53-E56 PolarHBondContact O-N 2.94Å; C53-E56 VanDerWaalsContact O-N 3.08Å; C53-V57 WeakPolarHBondContact O-CA 3.39Å; C53-V57 WeakPolarHBondContact O-CB 3.36Å; C53-V57 WeakPolarHBondContact O-CG2 3.25Å; C53-V57 PolarHBondContact O-N 3.33Å
54	D	73.8	Confident	72.5	Confident	84 Å²	84	108.6 Å²	108.6	45%	0.449	55%	0.551	S	S	.	*	H	α-helix	trans	-62.5	-33.4	175.7	-76.3	-20.3	0	0	0	111.1	E50 N58	E50-D54 WeakPolarHBondContact O-CB 3.38Å; E50-D54 PolarHBondContact O-N 2.96Å; D54-N58 WeakPolarHBondContact O-CB 3.39Å; D54-N58 VanDerWaalsContact O-CG 3.31Å; D54-N58 PolarHBondContact O-N 2.9Å; D54-N58 PolarHBondContact O-ND2 3.14Å
55	K	65.1	Low	70	Confident	150 Å²	150	109.6 Å²	109.6	65%	0.652	58%	0.582	S	S	*	*	H	α-helix	trans	-68.5	-39.3	173.7	-66.4	168.1	-171.2	163.3	0	111.7	G51 L52 C53 A59	G51-K55 VanDerWaalsContact O-CD 3.23Å; G51-K55 WeakPolarHBondContact O-CD 3.39Å; G51-K55 VanDerWaalsContact O-CE 3.22Å; G51-K55 WeakPolarHBondContact O-CE 3.19Å; G51-K55 VanDerWaalsContact O-CG 3.26Å; G51-K55 WeakPolarHBondContact O-CG 3.34Å; L52-K55 WeakPolarHBondContact O-CB 3.24Å; L52-K55 PolarHBondContact O-N 3.49Å; L52-K55 VanDerWaalsContact O-N 3.12Å; C53-K55 PolarHBondContact O-N 2.96Å; K55-A59 PolarHBondContact O-N 3.23Å
56	E	60.1	Low	68.7	Low	150 Å²	150	110.5 Å²	110.5	70%	0.701	59%	0.587	S	S	*	*	H	α-helix	trans	-84.3	-31	-179.6	-66.4	-152.6	165.7	0	0	114.4	L52 C53 A59 C60	L52-E56 PolarHBondContact O-N 3.33Å; C53-E56 CarbonylContact O-C 3.51Å; C53-E56 PolarHBondContact O-N 2.94Å; C53-E56 VanDerWaalsContact O-N 3.08Å; E56-A59 CarbonylContact O-C 3.43Å; E56-A59 WeakPolarHBondContact O-CA 3.44Å; E56-A59 VanDerWaalsContact O-CB 3.32Å; E56-A59 WeakPolarHBondContact O-CB 3.3Å; E56-A59 PolarHBondContact O-N 3.06Å; E56-C60 WeakPolarHBondContact O-CB 3.15Å; E56-C60 PolarHBondContact O-N 3.44Å
57	V	57.3	Low	67.4	Low	73 Å²	73	110.4 Å²	110.4	44%	0.442	59%	0.587	S	S	.	*	H	α-helix	trans	-80.1	-34.9	176.7	175.6	0	0	0	0	109.5	C53 A59 C60 C61	C53-V57 WeakPolarHBondContact O-CA 3.39Å; C53-V57 WeakPolarHBondContact O-CB 3.36Å; C53-V57 WeakPolarHBondContact O-CG2 3.25Å; C53-V57 PolarHBondContact O-N 3.33Å; V57-A59 PolarHBondContact O-N 2.91Å; V57-C60 PolarHBondContact O-N 2.98Å; V57-C60 VanDerWaalsContact O-N 3.15Å; V57-C61 VanDerWaalsContact O-CB 3.26Å; V57-C61 WeakPolarHBondContact O-CB 3.5Å; V57-C61 PolarHBondContact O-N 3.21Å; V57-C61 PolarHBondContact O-SG 2.95Å
58	N	52.8	Low	65.9	Low	101 Å²	101	111.3 Å²	111.3	54%	0.54	59%	0.591	S	S	.	*	H	α-helix	trans	-60.6	-38.5	163.4	-79.6	-70	0	0	0	109.9	D54 C60 F62	D54-N58 WeakPolarHBondContact O-CB 3.39Å; D54-N58 VanDerWaalsContact O-CG 3.31Å; D54-N58 PolarHBondContact O-N 2.9Å; D54-N58 PolarHBondContact O-ND2 3.14Å; N58-C60 PolarHBondContact O-N 3.38Å; N58-F62 WeakPolarHBondContact O-CD2 3.44Å; N58-F62 PolarHBondContact O-N 2.89Å
59	A	54.7	Low	64.3	Low	55 Å²	55	112.8 Å²	112.8	46%	0.455	60%	0.603	S	S	.	*	H	α-helix	trans	-65.8	-35.5	172.9	0	0	0	0	0	113.1	K55 E56 V57 F63	K55-A59 PolarHBondContact O-N 3.23Å; E56-A59 CarbonylContact O-C 3.43Å; E56-A59 WeakPolarHBondContact O-CA 3.44Å; E56-A59 VanDerWaalsContact O-CB 3.32Å; E56-A59 WeakPolarHBondContact O-CB 3.3Å; E56-A59 PolarHBondContact O-N 3.06Å; V57-A59 PolarHBondContact O-N 2.91Å; A59-F63 WeakPolarHBondContact O-CD2 3.4Å
60	C	47.4	Very low	62.6	Low	83 Å²	83	114.6 Å²	114.6	56%	0.561	61%	0.613	S	S	*	*	H	α-helix	trans	-81.7	-32	-177.3	-149.5	0	0	0	0	112.7	E56 V57 N58 F62 F63	E56-C60 WeakPolarHBondContact O-CB 3.15Å; E56-C60 PolarHBondContact O-N 3.44Å; V57-C60 PolarHBondContact O-N 2.98Å; V57-C60 VanDerWaalsContact O-N 3.15Å; N58-C60 PolarHBondContact O-N 3.38Å; C60-F62 PolarHBondContact O-N 2.77Å; C60-F63 PolarHBondContact O-N 2.81Å
61	C	45.3	Very low	60.9	Low	87 Å²	87	114.3 Å²	114.3	59%	0.588	62%	0.617	S	S	*	*	H	α-helix	trans	-70.7	-17.2	173.4	-75.4	0	0	0	0	112.8	V57 F63	V57-C61 VanDerWaalsContact O-CB 3.26Å; V57-C61 WeakPolarHBondContact O-CB 3.5Å; V57-C61 PolarHBondContact O-N 3.21Å; V57-C61 PolarHBondContact O-SG 2.95Å; C61-F63 VanDerWaalsContact C-N 3.26Å; C61-F63 PolarHBondContact O-N 3.12Å
62	F	50.7	Low	58.9	Low	166 Å²	166	120.4 Å²	120.4	73%	0.728	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.8	-11.8	167.4	-84.2	-67.8	0	0	0	113.9	N58 C60	N58-F62 WeakPolarHBondContact O-CD2 3.44Å; N58-F62 PolarHBondContact O-N 2.89Å; C60-F62 PolarHBondContact O-N 2.77Å
63	F	53.1	Low	56.8	Low	176 Å²	176	121.8 Å²	121.8	77%	0.772	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.9	-2.7	-179.5	-87.4	-84.6	0	0	0	115	A59 C60 C61	A59-F63 WeakPolarHBondContact O-CD2 3.4Å; C60-F63 PolarHBondContact O-N 2.81Å; C61-F63 VanDerWaalsContact C-N 3.26Å; C61-F63 PolarHBondContact O-N 3.12Å
64	Y	52.3	Low	54.9	Low	215 Å²	215	126.3 Å²	126.3	84%	0.843	66%	0.663	S	S	*	*			trans	-118.5	31.3	179.3	-94.8	-81.8	0	0	0	114.3
65	S	46	Very low	53.1	Low	175 Å²	175	130.1 Å²	130.1	100%	1.224	68%	0.682	S	S	*	*			trans	-133.9	0	160.9	-71.6	0	0	0	0	109.7

Retrieved 65 of 65 residues in 72 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).