A0A077ZJB5_TRITR Loading...

Small ribosomal subunit protein uS11c

AlphaFold DB , UniProt , Accession A0A077ZJB5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 129 aa.

						>A0A077ZJB5_TRITR|A0A077ZJB5
MVAKKVNRKRRVKKNIETGIAHIHSTFNNTIVMITDASGNAVAWSSAGSLGFKGSKKSTPFAAQMAAETATKAAMEHGLKSVEVTVKGPGSGREAAIRSLQATGLEVTAIRDVTPVPHNGCRPPKRRRV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	67.5	Low	247 Å²	247	188.1 Å²	188.1	100%	1.217	89%	0.885	S	S	*	*				0	104.6	0	-150.7	176.5	-157	0	0	107.8
2	V	70	Confident	67.6	Low	147 Å²	147	182.3 Å²	182.3	89%	0.891	87%	0.871	S	S	*	*			trans	-83.3	118.2	-175.7	176.4	0	0	0	0	109.3	K4	V2-K4 PolarHBondContact O-N 3.14Å
3	A	73.1	Confident	67.5	Low	96 Å²	96	181.8 Å²	181.8	79%	0.793	86%	0.863	S	S	*	*			trans	-67.2	115.6	177	0	0	0	0	0	110.6	K5	A3-K5 PolarHBondContact O-N 2.95Å; A3-K5 VanDerWaalsContact O-N 3.16Å
4	K	71.6	Confident	67.9	Low	195 Å²	195	175.7 Å²	175.7	85%	0.848	83%	0.831	S	S	*	*			trans	-64.8	112.1	176.2	-167.1	174.3	-175.6	175	0	109.3	V2 V6	V2-K4 PolarHBondContact O-N 3.14Å; K4-V6 PolarHBondContact O-N 3.07Å
5	K	66	Low	68.9	Low	205 Å²	205	172.7 Å²	172.7	89%	0.891	82%	0.823	S	S	*	*			trans	-63.6	104.3	176.8	-144.6	178.3	-170.9	179	0	108.6	A3 N7	A3-K5 PolarHBondContact O-N 2.95Å; A3-K5 VanDerWaalsContact O-N 3.16Å; K5-N7 PolarHBondContact O-N 3.5Å; K5-N7 VanDerWaalsContact O-N 3.07Å
6	V	74.4	Confident	70	Confident	121 Å²	121	163.4 Å²	163.4	73%	0.733	78%	0.779	S	S	*	*			trans	-69.4	105.7	176.9	-178.3	0	0	0	0	108	K4 R8	K4-V6 PolarHBondContact O-N 3.07Å; V6-R8 PolarHBondContact O-N 3.44Å
7	N	69.5	Low	71.2	Confident	161 Å²	161	159.4 Å²	159.4	86%	0.861	76%	0.759	S	S	*	*			trans	-70.3	93.8	176.4	-157.8	15.6	0	0	0	108.8	K5 K9	K5-N7 PolarHBondContact O-N 3.5Å; K5-N7 VanDerWaalsContact O-N 3.07Å; N7-K9 PolarHBondContact O-N 2.83Å
8	R	68.8	Low	72.4	Confident	223 Å²	223	155.1 Å²	155.1	84%	0.842	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-68.7	119.2	176.9	-76.4	-177.7	176.9	171.6	-0.3	108.7	V6 R10	V6-R8 PolarHBondContact O-N 3.44Å; R8-R10 PolarHBondContact O-N 3.24Å
9	K	68	Low	73.5	Confident	201 Å²	201	147.3 Å²	147.3	87%	0.874	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-50.4	131.8	171.5	-74.2	-177.2	176.7	-178.9	0	109.4	N7 R11	N7-K9 PolarHBondContact O-N 2.83Å; K9-R11 PolarHBondContact O-N 2.92Å
10	R	63.1	Low	74.6	Confident	241 Å²	241	141.9 Å²	141.9	91%	0.909	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-56.4	127.8	174	-75	-176.8	177.7	176.5	-0.7	108.5	R8 V12	R8-R10 PolarHBondContact O-N 3.24Å; R10-V12 PolarHBondContact O-N 3.39Å
11	R	65.2	Low	75.7	Confident	232 Å²	232	135.1 Å²	135.1	88%	0.875	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-63.8	121.6	174.1	-70.3	-176.9	177.8	-178.8	-1.4	107.8	K9 K13	K9-R11 PolarHBondContact O-N 2.92Å; R11-K13 PolarHBondContact O-N 3.26Å
12	V	68.8	Low	77.8	Confident	119 Å²	119	126.1 Å²	126.1	72%	0.721	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-64.2	120	175.4	179.7	0	0	0	0	107.4	R10 K14	R10-V12 PolarHBondContact O-N 3.39Å; V12-K14 PolarHBondContact O-N 3.35Å; V12-K14 VanDerWaalsContact O-N 3.13Å
13	K	66	Low	79.1	Confident	175 Å²	175	119.2 Å²	119.2	76%	0.761	56%	0.564	S	S	*	*			trans	-71.3	105.8	169.3	-66.8	-173.8	177.6	-171.3	0	107	R11	R11-K13 PolarHBondContact O-N 3.26Å
14	K	73.7	Confident	80.2	Confident	97 Å²	97	118.1 Å²	118.1	42%	0.422	54%	0.542	S	S	.	.			trans	-71.9	140.2	165	-57.7	-177.5	178.7	-177.5	0	107.3	V12 I16 H77	V12-K14 PolarHBondContact O-N 3.35Å; V12-K14 VanDerWaalsContact O-N 3.13Å; K14-I16 HydrophobicContact CB-CD1 3.66Å; K14-I16 HydrophobicContact CB-CG1 3.85Å; K14-I16 HydrophobicContact CD-CD1 3.91Å; K14-I16 HydrophobicContact CG-CD1 4.45Å; K14-H77 CarbonylContact O-C 3.56Å; K14-H77 WeakPolarHBondContact O-CA 3.38Å
15	N	82.7	Confident	81.3	Confident	131 Å²	131	108.8 Å²	108.8	70%	0.701	50%	0.502	S	S	*	.			trans	-102.4	87.6	173.4	-174.9	64.4	0	0	0	107.6
16	I	85.7	Confident	82.7	Confident	23 Å²	23	101.2 Å²	101.2	12%	0.118	47%	0.473	C	S	.	.			trans	-110.1	109.5	-175.1	-60.3	161.7	0	0	0	106.7	K14 T18 D36 V42 H77 G78 L79	K14-I16 HydrophobicContact CB-CD1 3.66Å; K14-I16 HydrophobicContact CB-CG1 3.85Å; K14-I16 HydrophobicContact CD-CD1 3.91Å; K14-I16 HydrophobicContact CG-CD1 4.45Å; I16-T18 WeakPolarHBondContact CG2-O 3.38Å; I16-D36 HydrophobicContact CD1-CB 4.18Å; I16-D36 HydrophobicContact CG2-CB 4.04Å; I16-V42 HydrophobicContact CD1-CG1 4.45Å; I16-V42 HydrophobicContact CD1-CG2 3.43Å; I16-V42 VanDerWaalsContact CD1-CG2 3.43Å; I16-H77 PolarHBondContact N-O 3.24Å; I16-G78 CarbonylContact O-C 3.55Å; I16-G78 VanDerWaalsContact O-O 3.08Å; I16-L79 HydrophobicContact CB-CD2 4.44Å; I16-L79 HydrophobicContact CB-CG 4.46Å; I16-L79 HydrophobicContact CG2-CD2 3.82Å; I16-L79 HydrophobicContact CG2-CG 4.33Å; I16-L79 WeakPolarHBondContact O-CA 3.35Å; I16-L79 WeakPolarHBondContact O-CG 3.47Å; I16-L79 PolarHBondContact O-N 2.91Å
17	E	90.9	Very high	83.6	Confident	96 Å²	96	102.4 Å²	102.4	45%	0.449	47%	0.468	S	S	.	.			trans	-81.5	-37.5	-177.8	-58.7	-162.5	125.3	0	0	112.6	K80 S81	E17-K80 PolarHBondContact O-N 2.74Å; E17-K80 IonicContact OE1-NZ 2.83Å; E17-K80 PolarHBondContact OE1-NZ 3.29Å; E17-S81 PolarHBondContact O-N 3.31Å
18	T	92.9	Very high	84.8	Confident	82 Å²	82	100.8 Å²	100.8	50%	0.503	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	139.4	-176.6	56.2	0	0	0	0	110.7	I16 S81	I16-T18 WeakPolarHBondContact CG2-O 3.38Å; T18-S81 WeakPolarHBondContact CA-O 3.43Å; T18-S81 VanDerWaalsContact CG2-OG 3.23Å; T18-S81 WeakPolarHBondContact CG2-OG 3.49Å
19	G	94.2	Very high	86	Confident	7 Å²	7	91.2 Å²	91.2	7%	0.072	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.3	-176.1	-179.1	0	0	0	0	0	114.3	T35 S81 V82 E83	G19-T35 CarbonylContact C-O 3.53Å; G19-T35 WeakPolarHBondContact CA-O 3.34Å; G19-S81 PolarHBondContact N-O 3.08Å; G19-V82 VanDerWaalsContact O-CA 3.31Å; G19-V82 WeakPolarHBondContact O-CA 3.21Å; G19-E83 PolarHBondContact O-N 2.99Å
20	I	95.7	Very high	87.4	Confident	38 Å²	38	81.7 Å²	81.7	20%	0.195	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	127.2	177.3	-50.6	173.7	0	0	0	108.7	I34 T35 E83 T85	I20-I34 WeakPolarHBondContact O-CA 3.42Å; I20-T35 PolarHBondContact N-O 3.03Å; I20-T35 PolarHBondContact O-N 3.13Å; I20-T35 PolarHBondContact O-OG1 2.95Å; I20-T35 VanDerWaalsContact O-OG1 3.08Å; I20-E83 CarbonylContact C-O 3.37Å; I20-E83 VanDerWaalsContact CA-O 3.28Å; I20-E83 WeakPolarHBondContact CA-O 3.37Å; I20-E83 WeakPolarHBondContact CG2-O 3.49Å; I20-T85 HydrophobicContact CG2-CG2 3.9Å
21	A	96.4	Very high	89	Confident	0 Å²	0	73.2 Å²	73.2	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	112.7	171.1	0	0	0	0	0	109.4	M33 I34 V82 E83 V84 T85 L100	A21-M33 CarbonylContact C-O 3.55Å; A21-I34 HydrophobicContact CB-CG1 4.38Å; A21-V82 HydrophobicContact CB-CG1 3.41Å; A21-V82 VanDerWaalsContact CB-CG1 3.41Å; A21-E83 PolarHBondContact N-O 2.85Å; A21-V84 HydrophobicContact CB-CG2 4.33Å; A21-V84 WeakPolarHBondContact O-CA 3.13Å; A21-T85 PolarHBondContact O-N 2.93Å; A21-T85 PolarHBondContact O-OG1 3.02Å; A21-L100 HydrophobicContact CB-CD1 3.61Å
22	H	97	Very high	90.4	Very high	59 Å²	59	62.2 Å²	62.2	27%	0.273	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	111.9	172.8	-57.8	-77.7	0	0	0	109.8	V32 M33 T35 T85	H22-V32 WeakPolarHBondContact O-CA 3.35Å; H22-M33 HydrophobicContact CB-CB 4.4Å; H22-M33 HydrophobicContact CB-CE 4.22Å; H22-M33 PolarHBondContact N-O 2.98Å; H22-M33 PolarHBondContact O-N 2.96Å; H22-T35 PolarHBondContact CD2-OG1 2.94Å; H22-T35 VanDerWaalsContact CD2-OG1 3.29Å; H22-T35 PolarHBondContact NE2-OG1 3.24Å; H22-T85 WeakPolarHBondContact CA-O 3.33Å; H22-T85 PolarHBondContact ND1-OG1 3.12Å
23	I	96.5	Very high	91.8	Very high	2 Å²	2	59.9 Å²	59.9	1%	0.01	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	105.8	175.6	-59	170.7	0	0	0	108.1	T30 V84 T85 V86 K87 A96 I97 L100	I23-T30 HydrophobicContact CG2-CG2 4.14Å; I23-V84 HydrophobicContact CD1-CG1 3.52Å; I23-V84 HydrophobicContact CG1-CG1 4.24Å; I23-T85 PolarHBondContact N-O 2.97Å; I23-V86 HydrophobicContact CD1-CG2 4.45Å; I23-V86 CarbonylContact O-C 3.48Å; I23-V86 WeakPolarHBondContact O-CA 3.17Å; I23-K87 PolarHBondContact O-N 3.26Å; I23-A96 HydrophobicContact CD1-CB 3.8Å; I23-A96 HydrophobicContact CG1-CB 4.26Å; I23-A96 HydrophobicContact CG2-CB 3.85Å; I23-I97 HydrophobicContact CD1-CG1 3.68Å; I23-L100 HydrophobicContact CD1-CD1 4.02Å
24	H	96.6	Very high	93.2	Very high	72 Å²	72	51.5 Å²	51.5	33%	0.333	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	103.6	172.1	-171.7	41.6	0	0	0	110.6	T26 T30 I31 K87	H24-T26 WeakPolarHBondContact NE2-CG2 3.39Å; H24-T30 CarbonylContact O-C 3.55Å; H24-T30 WeakPolarHBondContact O-CA 3.44Å; H24-I31 HydrophobicContact CB-CB 4.38Å; H24-I31 PolarHBondContact N-O 2.99Å; H24-I31 PolarHBondContact O-N 2.98Å; H24-K87 CarbonylContact C-O 3.58Å; H24-K87 WeakPolarHBondContact CA-O 3.34Å; H24-K87 PolarHBondContact ND1-O 3.33Å
25	S	95.5	Very high	94.2	Very high	0 Å²	0	47 Å²	47	0%	0	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	107.4	-177.6	-165.7	0	0	0	0	110.7	K87 G88 G90 G92	S25-K87 PolarHBondContact N-O 3.45Å; S25-G88 CarbonylContact O-C 2.88Å; S25-G88 VanDerWaalsContact O-CA 3.3Å; S25-G88 WeakPolarHBondContact O-CA 3.45Å; S25-G90 PolarHBondContact O-N 2.8Å; S25-G90 WeakPolarHBondContact OG-CA 3.48Å; S25-G90 PolarHBondContact OG-O 2.83Å; S25-G92 PolarHBondContact OG-N 2.65Å
26	T	94.9	Very high	94.7	Very high	46 Å²	46	41.7 Å²	41.7	28%	0.282	21%	0.213	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	169.7	172.5	67	0	0	0	0	110	H24 N28 N29	H24-T26 WeakPolarHBondContact NE2-CG2 3.39Å; T26-N28 PolarHBondContact O-N 3.37Å; T26-N28 VanDerWaalsContact O-N 3.14Å; T26-N28 PolarHBondContact OG1-N 3.37Å; T26-N29 PolarHBondContact N-O 2.8Å; T26-N29 PolarHBondContact OG1-N 3.37Å; T26-N29 VanDerWaalsContact OG1-N 3.12Å; T26-N29 PolarHBondContact OG1-O 3.39Å
27	F	93.6	Very high	94.9	Very high	145 Å²	145	44.4 Å²	44.4	64%	0.636	24%	0.238	S	C	*	.	T	Hydrogen-bonded Turn	trans	-62.4	-19.2	176	-62.4	-65.3	0	0	0	114.2	S58 P89	F27-S58 WeakPolarHBondContact O-CB 3.47Å; F27-P89 HydrophobicContact CE1-CB 4.37Å; F27-P89 HydrophobicContact CE1-CG 4.04Å; F27-P89 HydrophobicContact CE2-CG 3.71Å; F27-P89 HydrophobicContact CZ-CB 4.06Å; F27-P89 HydrophobicContact CZ-CG 3.43Å; F27-P89 VanDerWaalsContact CZ-CG 3.43Å
28	N	94.5	Very high	94.9	Very high	128 Å²	128	44.8 Å²	44.8	68%	0.684	25%	0.251	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.9	-11.7	-173.3	-62.3	-26.4	0	0	0	113.4	T26 K57	T26-N28 PolarHBondContact O-N 3.37Å; T26-N28 VanDerWaalsContact O-N 3.14Å; T26-N28 PolarHBondContact OG1-N 3.37Å; N28-K57 WeakPolarHBondContact O-CG 3.48Å
29	N	94.8	Very high	94.8	Very high	22 Å²	22	43.2 Å²	43.2	12%	0.118	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.5	151.1	-174.6	-165.2	18.7	0	0	0	112.2	T26 K57	T26-N29 PolarHBondContact N-O 2.8Å; T26-N29 PolarHBondContact OG1-N 3.37Å; T26-N29 VanDerWaalsContact OG1-N 3.12Å; T26-N29 PolarHBondContact OG1-O 3.39Å; N29-K57 HydrophobicContact CB-CD 4.42Å; N29-K57 HydrophobicContact CB-CG 4.4Å; N29-K57 WeakPolarHBondContact ND2-CE 3.36Å; N29-K57 PolarHBondContact ND2-NZ 3.33Å; N29-K57 WeakPolarHBondContact OD1-CE 3.28Å
30	T	96.1	Very high	94.7	Very high	1 Å²	1	46.9 Å²	46.9	1%	0.006	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	130.8	164	-52.9	0	0	0	0	109.9	I23 H24 V32 S46 A47 A63	I23-T30 HydrophobicContact CG2-CG2 4.14Å; H24-T30 CarbonylContact O-C 3.55Å; H24-T30 WeakPolarHBondContact O-CA 3.44Å; T30-V32 HydrophobicContact CG2-CG2 4.3Å; T30-S46 WeakPolarHBondContact O-CA 3.5Å; T30-A47 PolarHBondContact O-N 3.04Å; T30-A47 VanDerWaalsContact O-N 3.08Å; T30-A63 HydrophobicContact CG2-CB 3.93Å
31	I	96.6	Very high	94.6	Very high	63 Å²	63	47.8 Å²	47.8	32%	0.323	28%	0.283	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	129.3	174.9	-56	172.5	0	0	0	107	H24	H24-I31 HydrophobicContact CB-CB 4.38Å; H24-I31 PolarHBondContact N-O 2.99Å; H24-I31 PolarHBondContact O-N 2.98Å
32	V	96.3	Very high	94.4	Very high	0 Å²	0	49.1 Å²	49.1	0%	0	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	122.9	177.2	-175.8	0	0	0	0	107.7	H22 T30 W44 S45 A67 A70 A96	H22-V32 WeakPolarHBondContact O-CA 3.35Å; T30-V32 HydrophobicContact CG2-CG2 4.3Å; V32-W44 CarbonylContact O-C 3.58Å; V32-W44 VanDerWaalsContact O-CA 3.26Å; V32-W44 WeakPolarHBondContact O-CA 3.45Å; V32-S45 PolarHBondContact N-O 3.39Å; V32-S45 PolarHBondContact O-N 3.05Å; V32-S45 VanDerWaalsContact O-O 3.07Å; V32-A67 HydrophobicContact CG2-CB 4.12Å; V32-A70 HydrophobicContact CB-CB 4.24Å; V32-A70 HydrophobicContact CG1-CB 4.03Å; V32-A96 HydrophobicContact CG2-CB 4.39Å
33	M	96.7	Very high	94.2	Very high	70 Å²	70	46.7 Å²	46.7	35%	0.345	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	132.7	178.6	179.4	177.3	71.1	0	0	108.8	A21 H22 T35 A41 W44	A21-M33 CarbonylContact C-O 3.55Å; H22-M33 HydrophobicContact CB-CB 4.4Å; H22-M33 HydrophobicContact CB-CE 4.22Å; H22-M33 PolarHBondContact N-O 2.98Å; H22-M33 PolarHBondContact O-N 2.96Å; M33-T35 HydrophobicContact CE-CG2 3.88Å; M33-T35 HydrophobicContact CG-CG2 4.16Å; M33-T35 HydrophobicContact SD-CG2 4.32Å; M33-A41 HydrophobicContact SD-CB 4.26Å; M33-W44 HydrophobicContact CB-CB 4.18Å; M33-W44 HydrophobicContact CG-CB 4.19Å
34	I	95.1	Very high	94.1	Very high	0 Å²	0	54.7 Å²	54.7	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	126.4	178	-59.9	169	0	0	0	107.8	I20 A21 V42 A43 A70 A74 L79	I20-I34 WeakPolarHBondContact O-CA 3.42Å; A21-I34 HydrophobicContact CB-CG1 4.38Å; I34-V42 WeakPolarHBondContact O-CB 3.38Å; I34-V42 PolarHBondContact O-N 3.17Å; I34-A43 PolarHBondContact N-O 3.26Å; I34-A43 PolarHBondContact O-N 3.34Å; I34-A70 HydrophobicContact CD1-CB 4.15Å; I34-A74 HydrophobicContact CB-CB 4.15Å; I34-A74 HydrophobicContact CD1-CB 3.49Å; I34-A74 VanDerWaalsContact CD1-CB 3.49Å; I34-A74 HydrophobicContact CG1-CB 4.42Å; I34-A74 HydrophobicContact CG2-CB 3.98Å; I34-L79 HydrophobicContact CG2-CD1 3.49Å; I34-L79 VanDerWaalsContact CG2-CD1 3.49Å
35	T	95.3	Very high	94.1	Very high	1 Å²	1	51.7 Å²	51.7	1%	0.006	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	161.5	-176.4	52.3	0	0	0	0	110.8	G19 I20 H22 M33 N40	G19-T35 CarbonylContact C-O 3.53Å; G19-T35 WeakPolarHBondContact CA-O 3.34Å; I20-T35 PolarHBondContact N-O 3.03Å; I20-T35 PolarHBondContact O-N 3.13Å; I20-T35 PolarHBondContact O-OG1 2.95Å; I20-T35 VanDerWaalsContact O-OG1 3.08Å; H22-T35 PolarHBondContact CD2-OG1 2.94Å; H22-T35 VanDerWaalsContact CD2-OG1 3.29Å; H22-T35 PolarHBondContact NE2-OG1 3.24Å; M33-T35 HydrophobicContact CE-CG2 3.88Å; M33-T35 HydrophobicContact CG-CG2 4.16Å; M33-T35 HydrophobicContact SD-CG2 4.32Å; T35-N40 WeakPolarHBondContact CA-O 3.39Å; T35-N40 WeakPolarHBondContact CB-O 3.12Å
36	D	93	Very high	94.1	Very high	21 Å²	21	52.3 Å²	52.3	11%	0.112	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	174.1	162.9	64	18.5	0	0	0	111.2	I16 S38 G39 N40	I16-D36 HydrophobicContact CD1-CB 4.18Å; I16-D36 HydrophobicContact CG2-CB 4.04Å; D36-S38 PolarHBondContact O-N 3.43Å; D36-S38 VanDerWaalsContact O-N 3.12Å; D36-S38 WeakPolarHBondContact OD1-CA 3.45Å; D36-S38 WeakPolarHBondContact OD1-CB 3.37Å; D36-S38 PolarHBondContact OD1-N 3.19Å; D36-G39 PolarHBondContact O-N 3.02Å; D36-G39 PolarHBondContact OD1-N 3.28Å; D36-N40 PolarHBondContact N-O 2.69Å; D36-N40 VanDerWaalsContact N-O 3.07Å; D36-N40 PolarHBondContact OD1-N 3.42Å; D36-N40 PolarHBondContact OD1-ND2 2.92Å; D36-N40 WeakPolarHBondContact OD2-CB 3.31Å; D36-N40 PolarHBondContact OD2-ND2 3.07Å
37	A	90.1	Very high	94.1	Very high	79 Å²	79	50.1 Å²	50.1	65%	0.653	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.6	-19.2	176.8	0	0	0	0	0	113.8
38	S	91.4	Very high	94.2	Very high	104 Å²	104	44.6 Å²	44.6	73%	0.727	27%	0.273	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.4	-3.4	176.1	-55.5	0	0	0	0	113.2	D36	D36-S38 PolarHBondContact O-N 3.43Å; D36-S38 VanDerWaalsContact O-N 3.12Å; D36-S38 WeakPolarHBondContact OD1-CA 3.45Å; D36-S38 WeakPolarHBondContact OD1-CB 3.37Å; D36-S38 PolarHBondContact OD1-N 3.19Å
39	G	90.7	Very high	94.2	Very high	49 Å²	49	41.7 Å²	41.7	51%	0.505	26%	0.263	S	S	.	.			trans	86.1	8.4	-179.7	0	0	0	0	0	115	D36	D36-G39 PolarHBondContact O-N 3.02Å; D36-G39 PolarHBondContact OD1-N 3.28Å
40	N	92.5	Very high	94.1	Very high	85 Å²	85	43.7 Å²	43.7	46%	0.455	27%	0.273	S	S	.	.			trans	-75.7	128.7	175.3	-53.8	-63.9	0	0	0	110.3	T35 D36 V42	T35-N40 WeakPolarHBondContact CA-O 3.39Å; T35-N40 WeakPolarHBondContact CB-O 3.12Å; D36-N40 PolarHBondContact N-O 2.69Å; D36-N40 VanDerWaalsContact N-O 3.07Å; D36-N40 PolarHBondContact OD1-N 3.42Å; D36-N40 PolarHBondContact OD1-ND2 2.92Å; D36-N40 WeakPolarHBondContact OD2-CB 3.31Å; D36-N40 PolarHBondContact OD2-ND2 3.07Å; N40-V42 PolarHBondContact O-N 2.89Å
41	A	92.7	Very high	94	Very high	57 Å²	57	46 Å²	46	47%	0.471	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.7	124.8	177.7	0	0	0	0	0	111.7	M33	M33-A41 HydrophobicContact SD-CB 4.26Å
42	V	92	Very high	94	Very high	27 Å²	27	45.2 Å²	45.2	16%	0.164	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	-56.8	175	-179.4	0	0	0	0	109.4	I16 I34 N40 H77 L79	I16-V42 HydrophobicContact CD1-CG1 4.45Å; I16-V42 HydrophobicContact CD1-CG2 3.43Å; I16-V42 VanDerWaalsContact CD1-CG2 3.43Å; I34-V42 WeakPolarHBondContact O-CB 3.38Å; I34-V42 PolarHBondContact O-N 3.17Å; N40-V42 PolarHBondContact O-N 2.89Å; V42-H77 HydrophobicContact CG1-CB 3.84Å; V42-H77 WeakPolarHBondContact CG1-CD2 3.45Å; V42-L79 HydrophobicContact CG1-CD1 4.38Å
43	A	93	Very high	93.9	Very high	9 Å²	9	53.5 Å²	53.5	7%	0.074	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	152.5	179.7	0	0	0	0	0	110.1	I34 A73 A74	I34-A43 PolarHBondContact N-O 3.26Å; I34-A43 PolarHBondContact O-N 3.34Å; A43-A73 HydrophobicContact CB-CB 3.89Å; A43-A74 HydrophobicContact CB-CB 4.07Å
44	W	95.3	Very high	93.7	Very high	170 Å²	170	53.1 Å²	53.1	64%	0.644	34%	0.342	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-148.9	151.7	173.4	65.8	-85.4	0	0	0	110.1	V32 M33	V32-W44 CarbonylContact O-C 3.58Å; V32-W44 VanDerWaalsContact O-CA 3.26Å; V32-W44 WeakPolarHBondContact O-CA 3.45Å; M33-W44 HydrophobicContact CB-CB 4.18Å; M33-W44 HydrophobicContact CG-CB 4.19Å
45	S	96.1	Very high	93.5	Very high	8 Å²	8	57.9 Å²	57.9	6%	0.056	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150	162.2	173.1	-170.7	0	0	0	0	109.4	V32 A66 T69	V32-S45 PolarHBondContact N-O 3.39Å; V32-S45 PolarHBondContact O-N 3.05Å; V32-S45 VanDerWaalsContact O-O 3.07Å; S45-A66 WeakPolarHBondContact CB-O 3.02Å; S45-T69 WeakPolarHBondContact CB-OG1 3.39Å; S45-T69 PolarHBondContact OG-OG1 3.42Å
46	S	96.3	Very high	93.4	Very high	13 Å²	13	64.5 Å²	64.5	9%	0.091	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	158.3	177.9	66.9	0	0	0	0	110	T30 G48 S49 L50	T30-S46 WeakPolarHBondContact O-CA 3.5Å; S46-G48 PolarHBondContact O-N 3.22Å; S46-S49 PolarHBondContact N-OG 3.29Å; S46-S49 PolarHBondContact O-N 2.82Å; S46-S49 VanDerWaalsContact O-N 3.13Å; S46-S49 PolarHBondContact O-OG 3.24Å; S46-S49 WeakPolarHBondContact OG-CB 3.32Å; S46-S49 PolarHBondContact OG-N 2.96Å; S46-S49 PolarHBondContact OG-OG 3.09Å; S46-S49 VanDerWaalsContact OG-OG 3.06Å; S46-L50 PolarHBondContact O-N 3.41Å
47	A	95.1	Very high	93.5	Very high	0 Å²	0	66.3 Å²	66.3	0%	0	41%	0.411	C	S	.	.	T	Hydrogen-bonded Turn	trans	-55.3	-36.3	172.1	0	0	0	0	0	111.4	T30 F52 K57 A62	T30-A47 PolarHBondContact O-N 3.04Å; T30-A47 VanDerWaalsContact O-N 3.08Å; A47-F52 WeakPolarHBondContact O-CB 3.23Å; A47-F52 WeakPolarHBondContact O-CD2 3.39Å; A47-F52 PolarHBondContact O-N 2.96Å; A47-K57 HydrophobicContact CB-CG 3.8Å; A47-K57 WeakPolarHBondContact CB-O 3.44Å; A47-A62 HydrophobicContact CB-CB 3.75Å
48	G	94.7	Very high	93.6	Very high	29 Å²	29	64.2 Å²	64.2	30%	0.299	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.7	-37.5	177.5	0	0	0	0	0	114.7	S46 L50 G51	S46-G48 PolarHBondContact O-N 3.22Å; G48-L50 VanDerWaalsContact C-N 3.25Å; G48-L50 PolarHBondContact O-N 3.27Å; G48-G51 PolarHBondContact O-N 2.97Å; G48-G51 VanDerWaalsContact O-N 3.14Å
49	S	93.6	Very high	93.8	Very high	67 Å²	67	61.4 Å²	61.4	47%	0.469	37%	0.37	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.9	-23.2	-179.2	53.1	0	0	0	0	112.7	S46 G51	S46-S49 PolarHBondContact N-OG 3.29Å; S46-S49 PolarHBondContact O-N 2.82Å; S46-S49 VanDerWaalsContact O-N 3.13Å; S46-S49 PolarHBondContact O-OG 3.24Å; S46-S49 WeakPolarHBondContact OG-CB 3.32Å; S46-S49 PolarHBondContact OG-N 2.96Å; S46-S49 PolarHBondContact OG-OG 3.09Å; S46-S49 VanDerWaalsContact OG-OG 3.06Å; S49-G51 PolarHBondContact O-N 3.36Å
50	L	94	Very high	94	Very high	65 Å²	65	62.3 Å²	62.3	34%	0.34	37%	0.367	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82	1.6	173.2	-62.3	178.7	0	0	0	113.8	S46 G48 F52 M65 A66 T69	S46-L50 PolarHBondContact O-N 3.41Å; G48-L50 VanDerWaalsContact C-N 3.25Å; G48-L50 PolarHBondContact O-N 3.27Å; L50-F52 HydrophobicContact CB-CD2 3.97Å; L50-F52 HydrophobicContact CB-CE2 4.06Å; L50-F52 HydrophobicContact CD1-CE2 4.37Å; L50-M65 HydrophobicContact CD1-CB 3.64Å; L50-M65 WeakPolarHBondContact CD1-O 3.31Å; L50-A66 HydrophobicContact CD1-CB 4.2Å; L50-A66 VanDerWaalsContact CD1-N 3.32Å; L50-T69 HydrophobicContact CD1-CG2 4.2Å; L50-T69 HydrophobicContact CD2-CG2 3.59Å
51	G	94.1	Very high	94.2	Very high	50 Å²	50	63.8 Å²	63.8	52%	0.515	37%	0.37	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.9	4.1	178.7	0	0	0	0	0	114.9	G48 S49 K53	G48-G51 PolarHBondContact O-N 2.97Å; G48-G51 VanDerWaalsContact O-N 3.14Å; S49-G51 PolarHBondContact O-N 3.36Å; G51-K53 PolarHBondContact O-N 3.01Å
52	F	95.3	Very high	94.3	Very high	45 Å²	45	61.1 Å²	61.1	20%	0.197	35%	0.347	C	S	.	.			trans	-70.9	117.4	170.9	-61.7	-76.7	0	0	0	110.3	A47 L50 K56 K57 F61 A62 M65	A47-F52 WeakPolarHBondContact O-CB 3.23Å; A47-F52 WeakPolarHBondContact O-CD2 3.39Å; A47-F52 PolarHBondContact O-N 2.96Å; L50-F52 HydrophobicContact CB-CD2 3.97Å; L50-F52 HydrophobicContact CB-CE2 4.06Å; L50-F52 HydrophobicContact CD1-CE2 4.37Å; F52-K56 HydrophobicContact CD1-CB 4.23Å; F52-K57 HydrophobicContact CB-CB 4.5Å; F52-F61 HydrophobicContact CE1-CD1 4.18Å; F52-F61 HydrophobicContact CE1-CE1 4.19Å; F52-F61 HydrophobicContact CZ-CD1 4.05Å; F52-F61 AromaticContact CZ-CE1 3.89Å; F52-F61 HydrophobicContact CZ-CE1 3.89Å; F52-A62 HydrophobicContact CB-CB 4.2Å; F52-A62 HydrophobicContact CD1-CB 4.2Å; F52-A62 HydrophobicContact CD2-CB 3.62Å; F52-A62 HydrophobicContact CE2-CB 3.98Å; F52-A62 HydrophobicContact CG-CB 3.75Å; F52-A62 HydrophobicContact CZ-CB 4.41Å; F52-M65 HydrophobicContact CE2-CB 4.14Å; F52-M65 HydrophobicContact CE2-CG 4.38Å; F52-M65 HydrophobicContact CZ-CG 4.35Å
53	K	94.1	Very high	94.5	Very high	174 Å²	174	59.8 Å²	59.8	76%	0.757	34%	0.339	S	S	*	.			trans	-112.3	155.3	-179.6	-64.3	-178.5	-178.2	-179.8	0	111.3	G51 K56	G51-K53 PolarHBondContact O-N 3.01Å; K53-K56 PolarHBondContact O-N 3.32Å
54	G	92.9	Very high	94.6	Very high	63 Å²	63	62.9 Å²	62.9	65%	0.649	35%	0.352	S	S	*	.	G	3₁₀ helix	trans	59.3	-137.3	175	0	0	0	0	0	113.3	K56 K57	G54-K56 PolarHBondContact O-N 3.24Å; G54-K57 VanDerWaalsContact O-CB 3.25Å; G54-K57 WeakPolarHBondContact O-CB 3.34Å; G54-K57 PolarHBondContact O-N 2.94Å; G54-K57 VanDerWaalsContact O-N 3.16Å
55	S	92.3	Very high	94.7	Very high	100 Å²	100	56.9 Å²	56.9	70%	0.699	33%	0.332	S	S	*	.	G	3₁₀ helix	trans	-61.1	-25.7	-179.1	53.7	0	0	0	0	114.2	K57 S58	S55-K57 PolarHBondContact O-N 3.45Å; S55-S58 PolarHBondContact O-N 3.45Å; S55-S58 PolarHBondContact O-OG 2.93Å
56	K	93.4	Very high	94.7	Very high	140 Å²	140	56.5 Å²	56.5	61%	0.609	33%	0.329	S	S	*	.	G	3₁₀ helix	trans	-67	-24.7	178.5	-63.2	-175.8	179.1	-177.8	0	112.3	F52 K53 G54 S58 T59 A62	F52-K56 HydrophobicContact CD1-CB 4.23Å; K53-K56 PolarHBondContact O-N 3.32Å; G54-K56 PolarHBondContact O-N 3.24Å; K56-S58 VanDerWaalsContact C-N 3.3Å; K56-S58 PolarHBondContact O-N 3.49Å; K56-T59 WeakPolarHBondContact O-CB 3.34Å; K56-T59 WeakPolarHBondContact O-CG2 3.43Å; K56-T59 PolarHBondContact O-N 3.25Å; K56-T59 PolarHBondContact O-OG1 2.85Å; K56-A62 WeakPolarHBondContact O-CB 3.36Å
57	K	94.9	Very high	94.6	Very high	58 Å²	58	55.9 Å²	55.9	25%	0.252	33%	0.325	S	S	.	.	G	3₁₀ helix	trans	-69.7	-23.7	-176.3	-167.9	174.7	168.2	179.7	0	113.7	N28 N29 A47 F52 G54 S55	N28-K57 WeakPolarHBondContact O-CG 3.48Å; N29-K57 HydrophobicContact CB-CD 4.42Å; N29-K57 HydrophobicContact CB-CG 4.4Å; N29-K57 WeakPolarHBondContact ND2-CE 3.36Å; N29-K57 PolarHBondContact ND2-NZ 3.33Å; N29-K57 WeakPolarHBondContact OD1-CE 3.28Å; A47-K57 HydrophobicContact CB-CG 3.8Å; A47-K57 WeakPolarHBondContact CB-O 3.44Å; F52-K57 HydrophobicContact CB-CB 4.5Å; G54-K57 VanDerWaalsContact O-CB 3.25Å; G54-K57 WeakPolarHBondContact O-CB 3.34Å; G54-K57 PolarHBondContact O-N 2.94Å; G54-K57 VanDerWaalsContact O-N 3.16Å; S55-K57 PolarHBondContact O-N 3.45Å
58	S	92.4	Very high	94.6	Very high	35 Å²	35	57.8 Å²	57.8	25%	0.245	33%	0.334	C	S	.	.	G	3₁₀ helix	trans	-95.8	11	178	56.8	0	0	0	0	113.6	F27 S55 K56 S91	F27-S58 WeakPolarHBondContact O-CB 3.47Å; S55-S58 PolarHBondContact O-N 3.45Å; S55-S58 PolarHBondContact O-OG 2.93Å; K56-S58 VanDerWaalsContact C-N 3.3Å; K56-S58 PolarHBondContact O-N 3.49Å; S58-S91 PolarHBondContact O-OG 3.01Å
59	T	95.2	Very high	94.7	Very high	46 Å²	46	58.9 Å²	58.9	28%	0.282	34%	0.335	S	S	.	.	S	Bend	trans	-85.3	148.4	-179.8	64.1	0	0	0	0	111.5	K56 F61 A62 A63	K56-T59 WeakPolarHBondContact O-CB 3.34Å; K56-T59 WeakPolarHBondContact O-CG2 3.43Å; K56-T59 PolarHBondContact O-N 3.25Å; K56-T59 PolarHBondContact O-OG1 2.85Å; T59-F61 PolarHBondContact O-N 3.23Å; T59-A62 PolarHBondContact O-N 2.9Å; T59-A62 VanDerWaalsContact O-N 3.17Å; T59-A62 WeakPolarHBondContact OG1-CB 3.36Å; T59-A62 PolarHBondContact OG1-N 2.87Å; T59-A63 PolarHBondContact O-N 2.92Å
60	P	95.3	Very high	94.7	Very high	68 Å²	68	55.8 Å²	55.8	44%	0.442	31%	0.313	S	S	.	.	H	α-helix	trans	-60.6	-31.4	174.5	23.6	-33.3	0	0	0	112.4	A63 Q64 A95	P60-A63 WeakPolarHBondContact O-CB 3.21Å; P60-A63 PolarHBondContact O-N 3.45Å; P60-Q64 PolarHBondContact O-N 2.92Å; P60-A95 HydrophobicContact CB-CB 3.68Å; P60-A95 WeakPolarHBondContact O-CB 3.35Å
61	F	95.4	Very high	94.7	Very high	116 Å²	116	52.7 Å²	52.7	51%	0.509	30%	0.297	S	S	.	.	H	α-helix	trans	-61.9	-44.2	174.9	-178.7	-105.4	0	0	0	112.2	F52 T59 A63 Q64 M65	F52-F61 HydrophobicContact CE1-CD1 4.18Å; F52-F61 HydrophobicContact CE1-CE1 4.19Å; F52-F61 HydrophobicContact CZ-CD1 4.05Å; F52-F61 AromaticContact CZ-CE1 3.89Å; F52-F61 HydrophobicContact CZ-CE1 3.89Å; T59-F61 PolarHBondContact O-N 3.23Å; F61-A63 VanDerWaalsContact C-N 3.29Å; F61-A63 PolarHBondContact O-N 3.08Å; F61-Q64 WeakPolarHBondContact O-CB 3.49Å; F61-Q64 PolarHBondContact O-N 2.98Å; F61-M65 HydrophobicContact CE1-CG 4.17Å; F61-M65 HydrophobicContact CE2-CG 4.44Å; F61-M65 HydrophobicContact CZ-CG 4.1Å; F61-M65 HydrophobicContact CZ-SD 4.32Å; F61-M65 WeakPolarHBondContact O-CG 3.48Å; F61-M65 PolarHBondContact O-N 3.21Å; F61-M65 VanDerWaalsContact O-N 3.09Å
62	A	95.8	Very high	94.7	Very high	0 Å²	0	55.6 Å²	55.6	0%	0	30%	0.296	C	S	.	.	H	α-helix	trans	-65.1	-35.2	176.6	0	0	0	0	0	112.1	A47 F52 K56 T59 A66	A47-A62 HydrophobicContact CB-CB 3.75Å; F52-A62 HydrophobicContact CB-CB 4.2Å; F52-A62 HydrophobicContact CD1-CB 4.2Å; F52-A62 HydrophobicContact CD2-CB 3.62Å; F52-A62 HydrophobicContact CE2-CB 3.98Å; F52-A62 HydrophobicContact CG-CB 3.75Å; F52-A62 HydrophobicContact CZ-CB 4.41Å; K56-A62 WeakPolarHBondContact O-CB 3.36Å; T59-A62 PolarHBondContact O-N 2.9Å; T59-A62 VanDerWaalsContact O-N 3.17Å; T59-A62 WeakPolarHBondContact OG1-CB 3.36Å; T59-A62 PolarHBondContact OG1-N 2.87Å; A62-A66 WeakPolarHBondContact O-CB 3.34Å; A62-A66 PolarHBondContact O-N 3.41Å
63	A	95.8	Very high	94.5	Very high	0 Å²	0	55.3 Å²	55.3	0%	0	30%	0.301	C	S	.	.	H	α-helix	trans	-66.4	-41.4	174	0	0	0	0	0	112.5	T30 T59 P60 F61 A66 A67 G92	T30-A63 HydrophobicContact CG2-CB 3.93Å; T59-A63 PolarHBondContact O-N 2.92Å; P60-A63 WeakPolarHBondContact O-CB 3.21Å; P60-A63 PolarHBondContact O-N 3.45Å; F61-A63 VanDerWaalsContact C-N 3.29Å; F61-A63 PolarHBondContact O-N 3.08Å; A63-A66 PolarHBondContact O-N 3.37Å; A63-A67 WeakPolarHBondContact O-CB 3.4Å; A63-A67 PolarHBondContact O-N 2.77Å; A63-G92 VanDerWaalsContact CB-CA 3.49Å
64	Q	95.7	Very high	94.4	Very high	73 Å²	73	47 Å²	47	34%	0.341	27%	0.265	S	S	.	.	H	α-helix	trans	-58.4	-50.3	175.2	179.9	-169.9	-24.8	0	0	111.1	P60 F61 A66 A67 E68 S99	P60-Q64 PolarHBondContact O-N 2.92Å; F61-Q64 WeakPolarHBondContact O-CB 3.49Å; F61-Q64 PolarHBondContact O-N 2.98Å; Q64-A66 VanDerWaalsContact C-N 3.33Å; Q64-A66 PolarHBondContact O-N 3.05Å; Q64-A67 PolarHBondContact O-N 2.99Å; Q64-E68 PolarHBondContact NE2-OE1 3.01Å; Q64-E68 PolarHBondContact O-N 2.79Å; Q64-S99 PolarHBondContact O-OG 3.24Å
65	M	95.9	Very high	94.3	Very high	45 Å²	45	47.9 Å²	47.9	22%	0.222	25%	0.253	C	S	.	.	H	α-helix	trans	-63.1	-39.9	179	-65.2	-68.3	97.1	0	0	111.7	L50 F52 F61 A67 E68 T69	L50-M65 HydrophobicContact CD1-CB 3.64Å; L50-M65 WeakPolarHBondContact CD1-O 3.31Å; F52-M65 HydrophobicContact CE2-CB 4.14Å; F52-M65 HydrophobicContact CE2-CG 4.38Å; F52-M65 HydrophobicContact CZ-CG 4.35Å; F61-M65 HydrophobicContact CE1-CG 4.17Å; F61-M65 HydrophobicContact CE2-CG 4.44Å; F61-M65 HydrophobicContact CZ-CG 4.1Å; F61-M65 HydrophobicContact CZ-SD 4.32Å; F61-M65 WeakPolarHBondContact O-CG 3.48Å; F61-M65 PolarHBondContact O-N 3.21Å; F61-M65 VanDerWaalsContact O-N 3.09Å; M65-A67 PolarHBondContact O-N 3.36Å; M65-E68 VanDerWaalsContact CE-CD 3.46Å; M65-E68 WeakPolarHBondContact CE-OE1 3.35Å; M65-E68 WeakPolarHBondContact CE-OE2 3.48Å; M65-E68 PolarHBondContact O-N 2.83Å; M65-T69 WeakPolarHBondContact O-CG2 3.47Å; M65-T69 PolarHBondContact O-N 3.07Å; M65-T69 PolarHBondContact O-OG1 3.46Å
66	A	95.9	Very high	94.2	Very high	0 Å²	0	50.3 Å²	50.3	0%	0	25%	0.254	C	S	.	.	H	α-helix	trans	-61.5	-43.3	175.6	0	0	0	0	0	111.8	S45 L50 A62 A63 Q64 T69 A70	S45-A66 WeakPolarHBondContact CB-O 3.02Å; L50-A66 HydrophobicContact CD1-CB 4.2Å; L50-A66 VanDerWaalsContact CD1-N 3.32Å; A62-A66 WeakPolarHBondContact O-CB 3.34Å; A62-A66 PolarHBondContact O-N 3.41Å; A63-A66 PolarHBondContact O-N 3.37Å; Q64-A66 VanDerWaalsContact C-N 3.33Å; Q64-A66 PolarHBondContact O-N 3.05Å; A66-T69 PolarHBondContact O-OG1 3.14Å; A66-A70 WeakPolarHBondContact O-CB 3.28Å; A66-A70 PolarHBondContact O-N 3.38Å; A66-A70 VanDerWaalsContact O-N 3.08Å
67	A	95.9	Very high	94	Very high	0 Å²	0	45.5 Å²	45.5	0%	0	23%	0.233	C	C	.	.	H	α-helix	trans	-64.9	-48.3	176.1	0	0	0	0	0	112	V32 A63 Q64 M65 T69 A70 T71 A96 S99 L100	V32-A67 HydrophobicContact CG2-CB 4.12Å; A63-A67 WeakPolarHBondContact O-CB 3.4Å; A63-A67 PolarHBondContact O-N 2.77Å; Q64-A67 PolarHBondContact O-N 2.99Å; M65-A67 PolarHBondContact O-N 3.36Å; A67-T69 VanDerWaalsContact C-N 3.31Å; A67-T69 PolarHBondContact O-N 3.29Å; A67-A70 PolarHBondContact O-N 3.4Å; A67-T71 WeakPolarHBondContact O-CB 3.15Å; A67-T71 PolarHBondContact O-N 2.86Å; A67-T71 PolarHBondContact O-OG1 3.04Å; A67-A96 HydrophobicContact CB-CB 4.12Å; A67-S99 WeakPolarHBondContact CB-OG 3.31Å; A67-L100 HydrophobicContact CB-CD2 4.3Å
68	E	95.2	Very high	93.7	Very high	39 Å²	39	43.9 Å²	43.9	18%	0.182	23%	0.233	C	C	.	.	H	α-helix	trans	-55.9	-45.4	177.7	-93	170.9	-131.9	0	0	111.9	Q64 M65 T71 K72 S99	Q64-E68 PolarHBondContact NE2-OE1 3.01Å; Q64-E68 PolarHBondContact O-N 2.79Å; M65-E68 VanDerWaalsContact CE-CD 3.46Å; M65-E68 WeakPolarHBondContact CE-OE1 3.35Å; M65-E68 WeakPolarHBondContact CE-OE2 3.48Å; M65-E68 PolarHBondContact O-N 2.83Å; E68-T71 PolarHBondContact O-N 3.16Å; E68-K72 WeakPolarHBondContact O-CB 3.41Å; E68-K72 VanDerWaalsContact O-CG 3.28Å; E68-K72 WeakPolarHBondContact O-CG 3.42Å; E68-K72 PolarHBondContact O-N 3.06Å; E68-K72 IonicContact OE2-NZ 3.91Å; E68-S99 WeakPolarHBondContact CG-OG 3.15Å; E68-S99 PolarHBondContact N-OG 3.24Å
69	T	95.4	Very high	93.6	Very high	53 Å²	53	42.5 Å²	42.5	33%	0.325	22%	0.223	S	C	.	.	H	α-helix	trans	-68	-39.9	-179.9	54	0	0	0	0	112.8	S45 L50 M65 A66 A67 A73	S45-T69 WeakPolarHBondContact CB-OG1 3.39Å; S45-T69 PolarHBondContact OG-OG1 3.42Å; L50-T69 HydrophobicContact CD1-CG2 4.2Å; L50-T69 HydrophobicContact CD2-CG2 3.59Å; M65-T69 WeakPolarHBondContact O-CG2 3.47Å; M65-T69 PolarHBondContact O-N 3.07Å; M65-T69 PolarHBondContact O-OG1 3.46Å; A66-T69 PolarHBondContact O-OG1 3.14Å; A67-T69 VanDerWaalsContact C-N 3.31Å; A67-T69 PolarHBondContact O-N 3.29Å; T69-A73 PolarHBondContact O-N 2.92Å
70	A	94.8	Very high	93.4	Very high	1 Å²	1	46.2 Å²	46.2	1%	0.008	24%	0.235	C	C	.	.	H	α-helix	trans	-63.7	-46.2	173.9	0	0	0	0	0	111.1	V32 I34 A66 A67 A73 A74	V32-A70 HydrophobicContact CB-CB 4.24Å; V32-A70 HydrophobicContact CG1-CB 4.03Å; I34-A70 HydrophobicContact CD1-CB 4.15Å; A66-A70 WeakPolarHBondContact O-CB 3.28Å; A66-A70 PolarHBondContact O-N 3.38Å; A66-A70 VanDerWaalsContact O-N 3.08Å; A67-A70 PolarHBondContact O-N 3.4Å; A70-A73 PolarHBondContact O-N 3.13Å; A70-A74 WeakPolarHBondContact O-CB 3.47Å; A70-A74 PolarHBondContact O-N 2.72Å
71	T	93.8	Very high	93.3	Very high	0 Å²	0	44 Å²	44	0%	0	22%	0.221	C	C	.	.	H	α-helix	trans	-62.4	-47.9	-179.4	-60.9	0	0	0	0	112.4	A67 E68 A73 A74 M75 L100 T103 L105	A67-T71 WeakPolarHBondContact O-CB 3.15Å; A67-T71 PolarHBondContact O-N 2.86Å; A67-T71 PolarHBondContact O-OG1 3.04Å; E68-T71 PolarHBondContact O-N 3.16Å; T71-A73 VanDerWaalsContact C-N 3.3Å; T71-A73 PolarHBondContact O-N 3.17Å; T71-A74 CarbonylContact O-C 3.59Å; T71-A74 WeakPolarHBondContact O-CA 3.46Å; T71-A74 WeakPolarHBondContact O-CB 3.39Å; T71-A74 PolarHBondContact O-N 3.31Å; T71-M75 HydrophobicContact CG2-CG 4.1Å; T71-M75 HydrophobicContact CG2-SD 3.93Å; T71-M75 WeakPolarHBondContact O-CG 3.36Å; T71-M75 PolarHBondContact O-N 2.84Å; T71-L100 WeakPolarHBondContact OG1-CD2 3.49Å; T71-T103 HydrophobicContact CG2-CG2 3.59Å; T71-L105 HydrophobicContact CG2-CD1 3.33Å; T71-L105 HydrophobicContact CG2-CD2 4.49Å; T71-L105 HydrophobicContact CG2-CG 3.57Å
72	K	93.4	Very high	93.3	Very high	112 Å²	112	38.6 Å²	38.6	49%	0.487	20%	0.198	S	C	.	.	H	α-helix	trans	-57.3	-44.8	178.5	-74.3	170.8	-178.1	169.1	0	111.5	E68 A74 M75 E76 T103	E68-K72 WeakPolarHBondContact O-CB 3.41Å; E68-K72 VanDerWaalsContact O-CG 3.28Å; E68-K72 WeakPolarHBondContact O-CG 3.42Å; E68-K72 PolarHBondContact O-N 3.06Å; E68-K72 IonicContact OE2-NZ 3.91Å; K72-A74 VanDerWaalsContact C-N 3.28Å; K72-A74 PolarHBondContact O-N 3.17Å; K72-M75 PolarHBondContact O-N 2.87Å; K72-E76 PolarHBondContact O-N 3.33Å; K72-T103 HydrophobicContact CG-CG2 4Å
73	A	92	Very high	93.3	Very high	39 Å²	39	40.5 Å²	40.5	32%	0.322	21%	0.207	S	C	.	.	H	α-helix	trans	-64.3	-32.9	175.6	0	0	0	0	0	112.7	A43 T69 A70 T71 H77	A43-A73 HydrophobicContact CB-CB 3.89Å; T69-A73 PolarHBondContact O-N 2.92Å; A70-A73 PolarHBondContact O-N 3.13Å; T71-A73 VanDerWaalsContact C-N 3.3Å; T71-A73 PolarHBondContact O-N 3.17Å; A73-H77 PolarHBondContact O-CD2 2.81Å; A73-H77 VanDerWaalsContact O-CD2 3.26Å
74	A	92	Very high	93.3	Very high	0 Å²	0	40.5 Å²	40.5	0%	0	21%	0.207	C	C	.	.	H	α-helix	trans	-76.5	-34.7	178.5	0	0	0	0	0	112.5	I34 A43 A70 T71 K72 E76 H77 L79	I34-A74 HydrophobicContact CB-CB 4.15Å; I34-A74 HydrophobicContact CD1-CB 3.49Å; I34-A74 VanDerWaalsContact CD1-CB 3.49Å; I34-A74 HydrophobicContact CG1-CB 4.42Å; I34-A74 HydrophobicContact CG2-CB 3.98Å; A43-A74 HydrophobicContact CB-CB 4.07Å; A70-A74 WeakPolarHBondContact O-CB 3.47Å; A70-A74 PolarHBondContact O-N 2.72Å; T71-A74 CarbonylContact O-C 3.59Å; T71-A74 WeakPolarHBondContact O-CA 3.46Å; T71-A74 WeakPolarHBondContact O-CB 3.39Å; T71-A74 PolarHBondContact O-N 3.31Å; K72-A74 VanDerWaalsContact C-N 3.28Å; K72-A74 PolarHBondContact O-N 3.17Å; A74-E76 VanDerWaalsContact C-N 3.26Å; A74-E76 PolarHBondContact O-N 2.86Å; A74-H77 WeakPolarHBondContact O-CA 3.26Å; A74-H77 WeakPolarHBondContact O-CB 3.33Å; A74-H77 PolarHBondContact O-N 3.29Å; A74-L79 HydrophobicContact CB-CD1 3.51Å
75	M	90.5	Very high	93.4	Very high	80 Å²	80	37.8 Å²	37.8	39%	0.394	20%	0.195	S	C	.	.	H	α-helix	trans	-64.5	-29.1	175	-71.2	177.8	80.2	0	0	112.4	T71 K72 H77 G78 T103 L105	T71-M75 HydrophobicContact CG2-CG 4.1Å; T71-M75 HydrophobicContact CG2-SD 3.93Å; T71-M75 WeakPolarHBondContact O-CG 3.36Å; T71-M75 PolarHBondContact O-N 2.84Å; K72-M75 PolarHBondContact O-N 2.87Å; M75-H77 PolarHBondContact O-N 2.81Å; M75-H77 VanDerWaalsContact O-N 3.14Å; M75-G78 PolarHBondContact O-N 3.31Å; M75-T103 HydrophobicContact SD-CG2 4.13Å; M75-L105 HydrophobicContact CG-CD2 4.11Å
76	E	90	Very high	93.4	Very high	151 Å²	151	35.9 Å²	35.9	71%	0.706	19%	0.186	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-19	170.9	-66.9	-178.3	-172.7	0	0	113.2	K72 A74	K72-E76 PolarHBondContact O-N 3.33Å; A74-E76 VanDerWaalsContact C-N 3.26Å; A74-E76 PolarHBondContact O-N 2.86Å
77	H	88	Confident	93.5	Very high	39 Å²	39	40.5 Å²	40.5	18%	0.181	21%	0.206	C	C	.	.	T	Hydrogen-bonded Turn	trans	-96.6	9.6	174.6	-63.7	-66.9	0	0	0	113.5	K14 I16 V42 A73 A74 M75	K14-H77 CarbonylContact O-C 3.56Å; K14-H77 WeakPolarHBondContact O-CA 3.38Å; I16-H77 PolarHBondContact N-O 3.24Å; V42-H77 HydrophobicContact CG1-CB 3.84Å; V42-H77 WeakPolarHBondContact CG1-CD2 3.45Å; A73-H77 PolarHBondContact O-CD2 2.81Å; A73-H77 VanDerWaalsContact O-CD2 3.26Å; A74-H77 WeakPolarHBondContact O-CA 3.26Å; A74-H77 WeakPolarHBondContact O-CB 3.33Å; A74-H77 PolarHBondContact O-N 3.29Å; M75-H77 PolarHBondContact O-N 2.81Å; M75-H77 VanDerWaalsContact O-N 3.14Å
78	G	88.4	Confident	93.4	Very high	24 Å²	24	40.9 Å²	40.9	25%	0.247	21%	0.21	C	C	.	.	T	Hydrogen-bonded Turn	trans	84.9	13.6	173.4	0	0	0	0	0	115.7	I16 M75 K80	I16-G78 CarbonylContact O-C 3.55Å; I16-G78 VanDerWaalsContact O-O 3.08Å; M75-G78 PolarHBondContact O-N 3.31Å; G78-K80 PolarHBondContact O-N 3.21Å
79	L	90.8	Very high	93.4	Very high	6 Å²	6	42.4 Å²	42.4	3%	0.031	22%	0.224	C	C	.	.			trans	-65.5	128.6	177.9	-83.8	161.1	0	0	0	111.8	I16 I34 V42 A74 V82 L105	I16-L79 HydrophobicContact CB-CD2 4.44Å; I16-L79 HydrophobicContact CB-CG 4.46Å; I16-L79 HydrophobicContact CG2-CD2 3.82Å; I16-L79 HydrophobicContact CG2-CG 4.33Å; I16-L79 WeakPolarHBondContact O-CA 3.35Å; I16-L79 WeakPolarHBondContact O-CG 3.47Å; I16-L79 PolarHBondContact O-N 2.91Å; I34-L79 HydrophobicContact CG2-CD1 3.49Å; I34-L79 VanDerWaalsContact CG2-CD1 3.49Å; V42-L79 HydrophobicContact CG1-CD1 4.38Å; A74-L79 HydrophobicContact CB-CD1 3.51Å; L79-V82 HydrophobicContact CD2-CG2 4.44Å; L79-L105 HydrophobicContact CB-CD2 4.18Å; L79-L105 WeakPolarHBondContact O-CD2 3.25Å
80	K	91.5	Very high	93.2	Very high	124 Å²	124	40 Å²	40	54%	0.539	21%	0.209	S	C	.	.			trans	-116.6	-48.1	179.8	-64.4	173.5	-174.2	162.3	0	111.3	E17 G78 E106	E17-K80 PolarHBondContact O-N 2.74Å; E17-K80 IonicContact OE1-NZ 2.83Å; E17-K80 PolarHBondContact OE1-NZ 3.29Å; G78-K80 PolarHBondContact O-N 3.21Å; K80-E106 PolarHBondContact O-N 2.78Å
81	S	93.8	Very high	93.1	Very high	22 Å²	22	43.4 Å²	43.4	15%	0.154	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	142.3	-176	59.8	0	0	0	0	112.1	E17 T18 G19 E106	E17-S81 PolarHBondContact O-N 3.31Å; T18-S81 WeakPolarHBondContact CA-O 3.43Å; T18-S81 VanDerWaalsContact CG2-OG 3.23Å; T18-S81 WeakPolarHBondContact CG2-OG 3.49Å; G19-S81 PolarHBondContact N-O 3.08Å; S81-E106 CarbonylContact C-O 3.08Å; S81-E106 VanDerWaalsContact CA-O 3.32Å; S81-E106 WeakPolarHBondContact CA-O 3.32Å
82	V	94.9	Very high	93.1	Very high	2 Å²	2	43.4 Å²	43.4	1%	0.012	23%	0.233	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	134.4	-173.1	177.2	0	0	0	0	112.1	G19 A21 L79 L105 E106 V107 T108	G19-V82 VanDerWaalsContact O-CA 3.31Å; G19-V82 WeakPolarHBondContact O-CA 3.21Å; A21-V82 HydrophobicContact CB-CG1 3.41Å; A21-V82 VanDerWaalsContact CB-CG1 3.41Å; L79-V82 HydrophobicContact CD2-CG2 4.44Å; V82-L105 HydrophobicContact CG2-CD1 3.83Å; V82-L105 HydrophobicContact CG2-CD2 4.29Å; V82-L105 HydrophobicContact CG2-CG 4.49Å; V82-E106 PolarHBondContact N-O 2.56Å; V82-V107 WeakPolarHBondContact O-CA 3.42Å; V82-T108 PolarHBondContact O-N 2.88Å; V82-T108 PolarHBondContact O-OG1 3.07Å
83	E	95.6	Very high	93.1	Very high	41 Å²	41	41.1 Å²	41.1	19%	0.192	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	131.1	163.3	-179.4	177.9	156.1	0	0	109.9	G19 I20 A21 A109 R111	G19-E83 PolarHBondContact O-N 2.99Å; I20-E83 CarbonylContact C-O 3.37Å; I20-E83 VanDerWaalsContact CA-O 3.28Å; I20-E83 WeakPolarHBondContact CA-O 3.37Å; I20-E83 WeakPolarHBondContact CG2-O 3.49Å; A21-E83 PolarHBondContact N-O 2.85Å; E83-A109 HydrophobicContact CG-CB 4.14Å; E83-R111 WeakPolarHBondContact OE1-CD 3.36Å; E83-R111 IonicContact OE1-CZ 3.78Å; E83-R111 IonicContact OE1-NE 3.75Å; E83-R111 PolarHBondContact OE1-NE 3.37Å; E83-R111 VanDerWaalsContact OE1-NE 3.14Å; E83-R111 IonicContact OE1-NH1 3.98Å; E83-R111 PolarHBondContact OE1-NH1 2.76Å; E83-R111 IonicContact OE1-NH2 3.48Å; E83-R111 IonicContact OE2-CZ 2.65Å; E83-R111 IonicContact OE2-NH1 3.14Å
84	V	96.4	Very high	93.2	Very high	0 Å²	0	44.9 Å²	44.9	0%	0	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-101	122.5	-178.2	-176.1	0	0	0	0	110.5	A21 I23 V86 I97 L100 V107 A109 I110 R111	A21-V84 HydrophobicContact CB-CG2 4.33Å; A21-V84 WeakPolarHBondContact O-CA 3.13Å; I23-V84 HydrophobicContact CD1-CG1 3.52Å; I23-V84 HydrophobicContact CG1-CG1 4.24Å; V84-V86 HydrophobicContact CG1-CG2 4.05Å; V84-I97 HydrophobicContact CG1-CG1 4.1Å; V84-L100 HydrophobicContact CG1-CD1 4.27Å; V84-L100 HydrophobicContact CG2-CD1 3.74Å; V84-V107 HydrophobicContact CG2-CG1 3.73Å; V84-V107 HydrophobicContact CG2-CG2 4.04Å; V84-A109 PolarHBondContact N-O 2.83Å; V84-I110 HydrophobicContact CB-CG1 4.45Å; V84-I110 CarbonylContact O-C 3.53Å; V84-I110 WeakPolarHBondContact O-CA 3.2Å; V84-R111 PolarHBondContact O-N 3.41Å
85	T	96.5	Very high	93.4	Very high	15 Å²	15	45.6 Å²	45.6	9%	0.092	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	124.6	172.8	59.5	0	0	0	0	110.1	I20 A21 H22 I23 R111	I20-T85 HydrophobicContact CG2-CG2 3.9Å; A21-T85 PolarHBondContact O-N 2.93Å; A21-T85 PolarHBondContact O-OG1 3.02Å; H22-T85 WeakPolarHBondContact CA-O 3.33Å; H22-T85 PolarHBondContact ND1-OG1 3.12Å; I23-T85 PolarHBondContact N-O 2.97Å; T85-R111 CarbonylContact C-O 3.59Å; T85-R111 WeakPolarHBondContact CA-O 3.38Å
86	V	96.7	Very high	93.6	Very high	6 Å²	6	41.8 Å²	41.8	4%	0.036	22%	0.219	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	129.8	-174.3	-175.5	0	0	0	0	109.5	I23 V84 R93 I97 R111 D112 V113	I23-V86 HydrophobicContact CD1-CG2 4.45Å; I23-V86 CarbonylContact O-C 3.48Å; I23-V86 WeakPolarHBondContact O-CA 3.17Å; V84-V86 HydrophobicContact CG1-CG2 4.05Å; V86-R93 HydrophobicContact CG1-CB 4.23Å; V86-R93 HydrophobicContact CG1-CG 3.63Å; V86-I97 HydrophobicContact CG2-CD1 3.86Å; V86-I97 HydrophobicContact CG2-CG1 4.3Å; V86-R111 PolarHBondContact N-O 3.12Å; V86-D112 VanDerWaalsContact O-OD1 3.08Å; V86-V113 VanDerWaalsContact O-CG2 3.32Å; V86-V113 WeakPolarHBondContact O-CG2 3.49Å; V86-V113 PolarHBondContact O-N 2.88Å
87	K	97	Very high	93.8	Very high	96 Å²	96	35.8 Å²	35.8	42%	0.417	19%	0.191	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-130	121.8	-179.5	-175.1	179.1	178.1	176.9	0	112	I23 H24 S25 V113	I23-K87 PolarHBondContact O-N 3.26Å; H24-K87 CarbonylContact C-O 3.58Å; H24-K87 WeakPolarHBondContact CA-O 3.34Å; H24-K87 PolarHBondContact ND1-O 3.33Å; S25-K87 PolarHBondContact N-O 3.45Å; K87-V113 HydrophobicContact CB-CG2 4.1Å
88	G	94.5	Very high	94.2	Very high	8 Å²	8	41.2 Å²	41.2	8%	0.082	21%	0.21	C	C	.	.	S	Bend	trans	91.6	153	171	0	0	0	0	0	113.2	S25 G90 R93 T114	S25-G88 CarbonylContact O-C 2.88Å; S25-G88 VanDerWaalsContact O-CA 3.3Å; S25-G88 WeakPolarHBondContact O-CA 3.45Å; G88-G90 PolarHBondContact O-N 2.82Å; G88-R93 PolarHBondContact O-NE 3.39Å; G88-R93 PolarHBondContact O-NH2 2.78Å; G88-T114 PolarHBondContact N-OG1 2.81Å
89	P	94.5	Very high	94.4	Very high	72 Å²	72	40.2 Å²	40.2	47%	0.468	20%	0.199	S	C	.	.			trans	-81.9	4.9	-161.8	34	-39.7	0	0	0	116.8	F27	F27-P89 HydrophobicContact CE1-CB 4.37Å; F27-P89 HydrophobicContact CE1-CG 4.04Å; F27-P89 HydrophobicContact CE2-CG 3.71Å; F27-P89 HydrophobicContact CZ-CB 4.06Å; F27-P89 HydrophobicContact CZ-CG 3.43Å; F27-P89 VanDerWaalsContact CZ-CG 3.43Å
90	G	93.1	Very high	94.5	Very high	2 Å²	2	40 Å²	40	2%	0.021	20%	0.198	C	C	.	.			trans	-62.4	154.3	-171.2	0	0	0	0	0	114.3	S25 G88 G92 R93	S25-G90 PolarHBondContact O-N 2.8Å; S25-G90 WeakPolarHBondContact OG-CA 3.48Å; S25-G90 PolarHBondContact OG-O 2.83Å; G88-G90 PolarHBondContact O-N 2.82Å; G90-G92 PolarHBondContact O-N 3.14Å; G90-R93 VanDerWaalsContact O-CG 3.31Å; G90-R93 WeakPolarHBondContact O-CG 3.45Å; G90-R93 PolarHBondContact O-N 3.38Å
91	S	92.8	Very high	94.6	Very high	72 Å²	72	38.8 Å²	38.8	50%	0.503	20%	0.195	S	C	.	.	T	Hydrogen-bonded Turn	trans	-55.9	-22.6	178.7	51.6	0	0	0	0	115	S58 R93	S58-S91 PolarHBondContact O-OG 3.01Å; S91-R93 PolarHBondContact O-N 3.26Å
92	G	93.2	Very high	94.6	Very high	0 Å²	0	41.9 Å²	41.9	0%	0	22%	0.221	C	C	.	.	H	α-helix	trans	-73.9	-2	-178.3	0	0	0	0	0	116	S25 A63 G90 A96	S25-G92 PolarHBondContact OG-N 2.65Å; A63-G92 VanDerWaalsContact CB-CA 3.49Å; G90-G92 PolarHBondContact O-N 3.14Å; G92-A96 VanDerWaalsContact O-CB 3.25Å; G92-A96 WeakPolarHBondContact O-CB 3.43Å; G92-A96 PolarHBondContact O-N 3.16Å
93	R	94	Very high	94.4	Very high	65 Å²	65	43 Å²	43	25%	0.245	23%	0.229	C	C	.	.	H	α-helix	trans	-55.6	-66.8	-176.1	-76.1	174.8	165.7	-171.8	-8.5	112.5	V86 G88 G90 S91 A95 A96 I97 D112 T114	V86-R93 HydrophobicContact CG1-CB 4.23Å; V86-R93 HydrophobicContact CG1-CG 3.63Å; G88-R93 PolarHBondContact O-NE 3.39Å; G88-R93 PolarHBondContact O-NH2 2.78Å; G90-R93 VanDerWaalsContact O-CG 3.31Å; G90-R93 WeakPolarHBondContact O-CG 3.45Å; G90-R93 PolarHBondContact O-N 3.38Å; S91-R93 PolarHBondContact O-N 3.26Å; R93-A95 VanDerWaalsContact C-N 3.34Å; R93-A95 PolarHBondContact O-N 3.29Å; R93-A96 PolarHBondContact O-N 3.3Å; R93-I97 WeakPolarHBondContact O-CG1 3.37Å; R93-I97 PolarHBondContact O-N 3.24Å; R93-D112 IonicContact CZ-OD2 3.88Å; R93-D112 IonicContact NH1-OD2 3.91Å; R93-D112 IonicContact NH2-OD1 3Å; R93-D112 IonicContact NH2-OD2 3.52Å; R93-D112 PolarHBondContact NH2-OD2 3.22Å; R93-T114 PolarHBondContact NH2-OG1 3.03Å
94	E	93.4	Very high	94	Very high	118 Å²	118	43.8 Å²	43.8	55%	0.551	25%	0.247	S	C	*	.	H	α-helix	trans	-66.2	-39.4	-174.5	-64.3	-179.7	-167.5	0	0	111.8	A96 I97 R98	E94-A96 VanDerWaalsContact C-N 3.31Å; E94-A96 PolarHBondContact O-N 3.39Å; E94-I97 PolarHBondContact O-N 3.02Å; E94-R98 WeakPolarHBondContact O-CB 2.94Å; E94-R98 WeakPolarHBondContact O-CG 2.98Å; E94-R98 PolarHBondContact O-N 3.49Å; E94-R98 IonicContact OE2-CZ 3.56Å; E94-R98 IonicContact OE2-NH1 3.66Å; E94-R98 IonicContact OE2-NH2 2.79Å; E94-R98 PolarHBondContact OE2-NH2 2.72Å
95	A	95	Very high	93.7	Very high	14 Å²	14	44.1 Å²	44.1	12%	0.116	25%	0.249	C	C	.	.	H	α-helix	trans	-61.3	-40.7	179.6	0	0	0	0	0	111.8	P60 R93 S99	P60-A95 HydrophobicContact CB-CB 3.68Å; P60-A95 WeakPolarHBondContact O-CB 3.35Å; R93-A95 VanDerWaalsContact C-N 3.34Å; R93-A95 PolarHBondContact O-N 3.29Å; A95-S99 WeakPolarHBondContact O-CB 3.34Å; A95-S99 PolarHBondContact O-N 2.89Å
96	A	95	Very high	93.6	Very high	0 Å²	0	49.7 Å²	49.7	0%	0	27%	0.274	C	S	.	.	H	α-helix	trans	-66.8	-43.6	175.3	0	0	0	0	0	111.8	I23 V32 A67 G92 R93 E94 S99 L100	I23-A96 HydrophobicContact CD1-CB 3.8Å; I23-A96 HydrophobicContact CG1-CB 4.26Å; I23-A96 HydrophobicContact CG2-CB 3.85Å; V32-A96 HydrophobicContact CG2-CB 4.39Å; A67-A96 HydrophobicContact CB-CB 4.12Å; G92-A96 VanDerWaalsContact O-CB 3.25Å; G92-A96 WeakPolarHBondContact O-CB 3.43Å; G92-A96 PolarHBondContact O-N 3.16Å; R93-A96 PolarHBondContact O-N 3.3Å; E94-A96 VanDerWaalsContact C-N 3.31Å; E94-A96 PolarHBondContact O-N 3.39Å; A96-S99 WeakPolarHBondContact O-CB 3.41Å; A96-S99 PolarHBondContact O-N 2.83Å; A96-L100 WeakPolarHBondContact O-CG 3.21Å; A96-L100 PolarHBondContact O-N 2.88Å
97	I	95.3	Very high	93.5	Very high	25 Å²	25	50.9 Å²	50.9	13%	0.128	28%	0.281	C	S	.	.	H	α-helix	trans	-62	-48.2	178.6	-59.8	167.9	0	0	0	111.1	I23 V84 V86 R93 E94 S99 L100 Q101 I110	I23-I97 HydrophobicContact CD1-CG1 3.68Å; V84-I97 HydrophobicContact CG1-CG1 4.1Å; V86-I97 HydrophobicContact CG2-CD1 3.86Å; V86-I97 HydrophobicContact CG2-CG1 4.3Å; R93-I97 WeakPolarHBondContact O-CG1 3.37Å; R93-I97 PolarHBondContact O-N 3.24Å; E94-I97 PolarHBondContact O-N 3.02Å; I97-S99 PolarHBondContact O-N 2.85Å; I97-L100 WeakPolarHBondContact O-CB 3.25Å; I97-L100 PolarHBondContact O-N 3Å; I97-Q101 PolarHBondContact O-N 3.31Å; I97-I110 HydrophobicContact CD1-CG2 4.1Å; I97-I110 HydrophobicContact CG2-CD1 3.95Å
98	R	95	Very high	93.4	Very high	153 Å²	153	50.5 Å²	50.5	58%	0.577	29%	0.287	S	S	*	.	H	α-helix	trans	-59.2	-39.3	177.4	-71.5	-178.8	-170.8	131.1	13.2	111.3	E94 Q101 A102	E94-R98 WeakPolarHBondContact O-CB 2.94Å; E94-R98 WeakPolarHBondContact O-CG 2.98Å; E94-R98 PolarHBondContact O-N 3.49Å; E94-R98 IonicContact OE2-CZ 3.56Å; E94-R98 IonicContact OE2-NH1 3.66Å; E94-R98 IonicContact OE2-NH2 2.79Å; E94-R98 PolarHBondContact OE2-NH2 2.72Å; R98-Q101 PolarHBondContact O-N 3.08Å; R98-A102 VanDerWaalsContact O-CB 3.31Å; R98-A102 WeakPolarHBondContact O-CB 3.12Å; R98-A102 PolarHBondContact O-N 2.93Å
99	S	94.1	Very high	93.4	Very high	3 Å²	3	51.8 Å²	51.8	2%	0.021	30%	0.296	C	S	.	.	H	α-helix	trans	-62.9	-43.3	176.5	178.6	0	0	0	0	112.8	Q64 A67 E68 A95 A96 I97 Q101 A102 T103	Q64-S99 PolarHBondContact O-OG 3.24Å; A67-S99 WeakPolarHBondContact CB-OG 3.31Å; E68-S99 WeakPolarHBondContact CG-OG 3.15Å; E68-S99 PolarHBondContact N-OG 3.24Å; A95-S99 WeakPolarHBondContact O-CB 3.34Å; A95-S99 PolarHBondContact O-N 2.89Å; A96-S99 WeakPolarHBondContact O-CB 3.41Å; A96-S99 PolarHBondContact O-N 2.83Å; I97-S99 PolarHBondContact O-N 2.85Å; S99-Q101 VanDerWaalsContact C-N 3.34Å; S99-Q101 PolarHBondContact O-N 2.8Å; S99-A102 PolarHBondContact O-N 3.06Å; S99-T103 PolarHBondContact O-N 2.84Å; S99-T103 PolarHBondContact O-OG1 3.39Å
100	L	92.8	Very high	93.4	Very high	2 Å²	2	52.8 Å²	52.8	1%	0.01	30%	0.297	C	S	.	.	H	α-helix	trans	-57.2	-47.1	175.2	-64.7	178.6	0	0	0	111.5	A21 I23 A67 T71 V84 A96 I97 T103	A21-L100 HydrophobicContact CB-CD1 3.61Å; I23-L100 HydrophobicContact CD1-CD1 4.02Å; A67-L100 HydrophobicContact CB-CD2 4.3Å; T71-L100 WeakPolarHBondContact OG1-CD2 3.49Å; V84-L100 HydrophobicContact CG1-CD1 4.27Å; V84-L100 HydrophobicContact CG2-CD1 3.74Å; A96-L100 WeakPolarHBondContact O-CG 3.21Å; A96-L100 PolarHBondContact O-N 2.88Å; I97-L100 WeakPolarHBondContact O-CB 3.25Å; I97-L100 PolarHBondContact O-N 3Å; L100-T103 PolarHBondContact O-N 3.06Å
101	Q	92.8	Very high	93.5	Very high	99 Å²	99	59.5 Å²	59.5	46%	0.463	32%	0.322	S	S	.	.	H	α-helix	trans	-64.5	-45.1	177.2	-68.5	178.9	-21.7	0	0	111.9	I97 R98 S99 T103 G104 V107	I97-Q101 PolarHBondContact O-N 3.31Å; R98-Q101 PolarHBondContact O-N 3.08Å; S99-Q101 VanDerWaalsContact C-N 3.34Å; S99-Q101 PolarHBondContact O-N 2.8Å; Q101-T103 PolarHBondContact O-N 2.78Å; Q101-G104 PolarHBondContact O-N 3.48Å; Q101-G104 VanDerWaalsContact O-N 3.07Å; Q101-V107 HydrophobicContact CG-CB 4.11Å; Q101-V107 HydrophobicContact CG-CG2 3.5Å; Q101-V107 VanDerWaalsContact CG-CG2 3.5Å
102	A	93.8	Very high	93.7	Very high	86 Å²	86	60.7 Å²	60.7	71%	0.711	32%	0.323	S	S	*	.	H	α-helix	trans	-64.2	-24.9	-179.4	0	0	0	0	0	113.6	R98 S99 G104	R98-A102 VanDerWaalsContact O-CB 3.31Å; R98-A102 WeakPolarHBondContact O-CB 3.12Å; R98-A102 PolarHBondContact O-N 2.93Å; S99-A102 PolarHBondContact O-N 3.06Å; A102-G104 VanDerWaalsContact C-N 3.27Å; A102-G104 PolarHBondContact O-N 2.61Å
103	T	90.1	Very high	93.8	Very high	27 Å²	27	64.2 Å²	64.2	17%	0.166	34%	0.344	C	S	.	.	T	Hydrogen-bonded Turn	trans	-79.2	-11.3	177.7	-37	0	0	0	0	112.4	T71 K72 M75 S99 L100 Q101	T71-T103 HydrophobicContact CG2-CG2 3.59Å; K72-T103 HydrophobicContact CG-CG2 4Å; M75-T103 HydrophobicContact SD-CG2 4.13Å; S99-T103 PolarHBondContact O-N 2.84Å; S99-T103 PolarHBondContact O-OG1 3.39Å; L100-T103 PolarHBondContact O-N 3.06Å; Q101-T103 PolarHBondContact O-N 2.78Å
104	G	88.6	Confident	93.9	Very high	56 Å²	56	63.1 Å²	63.1	58%	0.577	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	102.3	11.3	176.6	0	0	0	0	0	115.5	Q101 A102	Q101-G104 PolarHBondContact O-N 3.48Å; Q101-G104 VanDerWaalsContact O-N 3.07Å; A102-G104 VanDerWaalsContact C-N 3.27Å; A102-G104 PolarHBondContact O-N 2.61Å
105	L	90.2	Very high	93.9	Very high	7 Å²	7	61.8 Å²	61.8	4%	0.037	35%	0.346	C	S	.	.			trans	-79.2	136.6	168.4	-70.3	177.5	0	0	0	110.5	T71 M75 L79 V82 V107	T71-L105 HydrophobicContact CG2-CD1 3.33Å; T71-L105 HydrophobicContact CG2-CD2 4.49Å; T71-L105 HydrophobicContact CG2-CG 3.57Å; M75-L105 HydrophobicContact CG-CD2 4.11Å; L79-L105 HydrophobicContact CB-CD2 4.18Å; L79-L105 WeakPolarHBondContact O-CD2 3.25Å; V82-L105 HydrophobicContact CG2-CD1 3.83Å; V82-L105 HydrophobicContact CG2-CD2 4.29Å; V82-L105 HydrophobicContact CG2-CG 4.49Å; L105-V107 PolarHBondContact O-N 2.87Å
106	E	93.6	Very high	93.8	Very high	133 Å²	133	66.6 Å²	66.6	62%	0.621	37%	0.374	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.8	116.5	172.3	-171.8	-177.6	178.5	0	0	109.9	K80 S81 V82	K80-E106 PolarHBondContact O-N 2.78Å; S81-E106 CarbonylContact C-O 3.08Å; S81-E106 VanDerWaalsContact CA-O 3.32Å; S81-E106 WeakPolarHBondContact CA-O 3.32Å; V82-E106 PolarHBondContact N-O 2.56Å
107	V	94.2	Very high	93.8	Very high	31 Å²	31	71.4 Å²	71.4	19%	0.188	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	111.5	178.1	174.8	0	0	0	0	109.7	V82 V84 Q101 L105 I110	V82-V107 WeakPolarHBondContact O-CA 3.42Å; V84-V107 HydrophobicContact CG2-CG1 3.73Å; V84-V107 HydrophobicContact CG2-CG2 4.04Å; Q101-V107 HydrophobicContact CG-CB 4.11Å; Q101-V107 HydrophobicContact CG-CG2 3.5Å; Q101-V107 VanDerWaalsContact CG-CG2 3.5Å; L105-V107 PolarHBondContact O-N 2.87Å; V107-I110 HydrophobicContact CG1-CD1 4.36Å; V107-I110 HydrophobicContact CG1-CG1 3.83Å
108	T	94.8	Very high	93.8	Very high	88 Å²	88	78.7 Å²	78.7	54%	0.54	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	-37	-175.2	55.4	0	0	0	0	113.2	V82	V82-T108 PolarHBondContact O-N 2.88Å; V82-T108 PolarHBondContact O-OG1 3.07Å
109	A	94.6	Very high	93.5	Very high	34 Å²	34	79.6 Å²	79.6	28%	0.281	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.9	154	178.1	0	0	0	0	0	111	E83 V84	E83-A109 HydrophobicContact CG-CB 4.14Å; V84-A109 PolarHBondContact N-O 2.83Å
110	I	95.3	Very high	93.4	Very high	94 Å²	94	82 Å²	82	48%	0.482	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	120	175.6	-57.5	169.2	0	0	0	107.5	V84 I97 V107	V84-I110 HydrophobicContact CB-CG1 4.45Å; V84-I110 CarbonylContact O-C 3.53Å; V84-I110 WeakPolarHBondContact O-CA 3.2Å; I97-I110 HydrophobicContact CD1-CG2 4.1Å; I97-I110 HydrophobicContact CG2-CD1 3.95Å; V107-I110 HydrophobicContact CG1-CD1 4.36Å; V107-I110 HydrophobicContact CG1-CG1 3.83Å
111	R	95.7	Very high	93.4	Very high	143 Å²	143	88.1 Å²	88.1	54%	0.54	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	130.9	179.4	-60.6	-172.6	-179.9	154.1	-5	110.4	E83 V84 T85 V86	E83-R111 WeakPolarHBondContact OE1-CD 3.36Å; E83-R111 IonicContact OE1-CZ 3.78Å; E83-R111 IonicContact OE1-NE 3.75Å; E83-R111 PolarHBondContact OE1-NE 3.37Å; E83-R111 VanDerWaalsContact OE1-NE 3.14Å; E83-R111 IonicContact OE1-NH1 3.98Å; E83-R111 PolarHBondContact OE1-NH1 2.76Å; E83-R111 IonicContact OE1-NH2 3.48Å; E83-R111 IonicContact OE2-CZ 2.65Å; E83-R111 IonicContact OE2-NH1 3.14Å; V84-R111 PolarHBondContact O-N 3.41Å; T85-R111 CarbonylContact C-O 3.59Å; T85-R111 WeakPolarHBondContact CA-O 3.38Å; V86-R111 PolarHBondContact N-O 3.12Å
112	D	95.6	Very high	93.6	Very high	97 Å²	97	94.6 Å²	94.6	52%	0.519	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	119.7	167.2	-166.7	-17.3	0	0	0	108.9	V86 R93 T114	V86-D112 VanDerWaalsContact O-OD1 3.08Å; R93-D112 IonicContact CZ-OD2 3.88Å; R93-D112 IonicContact NH1-OD2 3.91Å; R93-D112 IonicContact NH2-OD1 3Å; R93-D112 IonicContact NH2-OD2 3.52Å; R93-D112 PolarHBondContact NH2-OD2 3.22Å; D112-T114 WeakPolarHBondContact OD1-CB 3.3Å; D112-T114 PolarHBondContact OD1-N 3.14Å; D112-T114 PolarHBondContact OD1-OG1 3.48Å
113	V	95.8	Very high	93.6	Very high	74 Å²	74	95.4 Å²	95.4	45%	0.448	54%	0.539	S	S	.	.			trans	-114.8	27.9	178.6	-62.3	0	0	0	0	110.8	V86 K87 P115	V86-V113 VanDerWaalsContact O-CG2 3.32Å; V86-V113 WeakPolarHBondContact O-CG2 3.49Å; V86-V113 PolarHBondContact O-N 2.88Å; K87-V113 HydrophobicContact CB-CG2 4.1Å; V113-P115 WeakPolarHBondContact O-CD 3.44Å
114	T	95.5	Very high	93.8	Very high	41 Å²	41	100 Å²	100	25%	0.252	57%	0.57	S	S	.	*			trans	-63.9	120.3	174.3	-61.1	0	0	0	0	109.8	G88 R93 D112 V116	G88-T114 PolarHBondContact N-OG1 2.81Å; R93-T114 PolarHBondContact NH2-OG1 3.03Å; D112-T114 WeakPolarHBondContact OD1-CB 3.3Å; D112-T114 PolarHBondContact OD1-N 3.14Å; D112-T114 PolarHBondContact OD1-OG1 3.48Å; T114-V116 PolarHBondContact O-N 3.31Å
115	P	94.9	Very high	94.2	Very high	91 Å²	91	104.9 Å²	104.9	59%	0.591	58%	0.575	S	S	*	*			trans	-69.6	124.6	-176.5	27.6	-34.1	0	0	0	110.8	V113	V113-P115 WeakPolarHBondContact O-CD 3.44Å
116	V	93.1	Very high	94.5	Very high	115 Å²	115	115.6 Å²	115.6	70%	0.697	62%	0.615	S	S	*	*			trans	-106.4	111.8	171.9	-179.6	0	0	0	0	108.3	T114	T114-V116 PolarHBondContact O-N 3.31Å
117	P	94.2	Very high	94.5	Very high	101 Å²	101	118.7 Å²	118.7	66%	0.656	62%	0.621	S	S	*	*			trans	-77.6	131.8	-179	29.8	-33.1	0	0	0	111.6	N119	P117-N119 PolarHBondContact O-N 3.3Å
118	H	94.3	Very high	94.5	Very high	178 Å²	178	127.6 Å²	127.6	82%	0.824	65%	0.651	S	S	*	*	S	Bend	trans	-84.4	81.7	172.4	-61.2	172	0	0	0	110.3	G120	H118-G120 VanDerWaalsContact C-N 3.32Å; H118-G120 PolarHBondContact O-N 3.18Å
119	N	89.8	Confident	94.3	Very high	172 Å²	172	131.6 Å²	131.6	92%	0.92	68%	0.675	S	S	*	*	S	Bend	trans	55.2	38	-179	-62.7	-38.5	0	0	0	114.9	P117	P117-N119 PolarHBondContact O-N 3.3Å
120	G	90.9	Very high	94.3	Very high	54 Å²	54	136.5 Å²	136.5	56%	0.557	70%	0.695	S	S	*	*			trans	-74	-135.3	-178.5	0	0	0	0	0	114.7	H118 R122	H118-G120 VanDerWaalsContact C-N 3.32Å; H118-G120 PolarHBondContact O-N 3.18Å; G120-R122 PolarHBondContact O-N 3.26Å
121	C	94.6	Very high	94.3	Very high	130 Å²	130	138.7 Å²	138.7	88%	0.878	71%	0.706	S	S	*	*	S	Bend	trans	-59.3	138.1	-179.2	-57.8	0	0	0	0	112	P123	C121-P123 WeakPolarHBondContact O-CD 3.38Å
122	R	95.4	Very high	94.2	Very high	235 Å²	235	138.4 Å²	138.4	89%	0.887	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-56.8	123.6	174.5	-176.1	179.8	-177.6	173.6	4.2	110.2	G120	G120-R122 PolarHBondContact O-N 3.26Å
123	P	94.3	Very high	94.1	Very high	102 Å²	102	140.9 Å²	140.9	66%	0.662	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-59.4	150	174.4	-25.1	34.5	0	0	0	112	C121	C121-P123 WeakPolarHBondContact O-CD 3.38Å
124	P	95.6	Very high	94	Very high	124 Å²	124	145.1 Å²	145.1	81%	0.805	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-53.6	153.5	173.5	-24.7	32.9	0	0	0	112.4	R126	P124-R126 PolarHBondContact O-N 3.36Å
125	K	96.8	Very high	93.9	Very high	159 Å²	159	152 Å²	152	69%	0.691	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-53.2	134.7	176.3	-176.3	179	178	178.2	0	110.4	R127	K125-R127 PolarHBondContact O-N 3.45Å
126	R	94.7	Very high	93.8	Very high	231 Å²	231	156.4 Å²	156.4	87%	0.872	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-53.6	128.2	173.2	-173.3	176.2	178.2	178.8	-0.2	109.6	P124	P124-R126 PolarHBondContact O-N 3.36Å
127	R	94.9	Very high	93.9	Very high	199 Å²	199	159.5 Å²	159.5	75%	0.751	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-61.9	140.7	178	-64.4	179	69.9	-166.7	0.8	109.7	K125 V129	K125-R127 PolarHBondContact O-N 3.45Å; R127-V129 HydrophobicContact CB-CG1 4.42Å; R127-V129 HydrophobicContact CB-CG2 4.33Å
128	R	94.8	Very high	93.9	Very high	218 Å²	218	164.4 Å²	164.4	82%	0.823	81%	0.809	S	S	*	*			trans	-101.4	68.7	171.8	-60.1	-179	-174.8	-171	0.2	107.9
129	V	90.6	Very high	93.8	Very high	171 Å²	171	163.2 Å²	163.2	100%	1.036	81%	0.807	S	S	*	*			trans	-104.6	0	173	-69.5	0	0	0	0	109.2	R127	R127-V129 HydrophobicContact CB-CG1 4.42Å; R127-V129 HydrophobicContact CB-CG2 4.33Å

Retrieved 129 of 129 residues in 292 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).