A0A077ZJC1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJC1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 137 aa.

						>A0A077ZJC1_TRITR|A0A077ZJC1
MSSKDDIVRTALESHTESESAEQETLSSIDSLLPGLPIQEDLYNEESLRTLFAVTGREILETKRRLKRIVLELIEYERKVKRMRAALHEGTSLEEGEHPSARPTDAADNSVSTSVRKHRGDEPLPGNSAADDPETDN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49	Very low	74.5	Confident	243 Å²	243	108.9 Å²	108.9	100%	1.197	58%	0.584	S	S	*	*				0	133.1	0	-71.1	-177	152	0	0	107.1
2	S	64.4	Low	74.1	Confident	70 Å²	70	109.2 Å²	109.2	49%	0.49	58%	0.584	S	S	.	*			trans	-83	125.3	-162.9	-175.4	0	0	0	0	110.8	K4 D5	S2-K4 PolarHBondContact O-N 2.54Å; S2-D5 PolarHBondContact O-N 2.74Å
3	S	78.1	Confident	74.1	Confident	84 Å²	84	109.4 Å²	109.4	59%	0.587	58%	0.579	S	S	*	*	H	α-helix	trans	-51.5	-17.4	-179.6	164.5	0	0	0	0	115.2	I7	S3-I7 WeakPolarHBondContact O-CG1 2.96Å; S3-I7 PolarHBondContact O-N 3Å
4	K	73.2	Confident	73.7	Confident	160 Å²	160	106.1 Å²	106.1	70%	0.696	57%	0.569	S	S	*	*	H	α-helix	trans	-69.6	-32.9	175.9	-69.8	-177.6	177.3	177.2	0	113.2	S2 D6 I7 V8	S2-K4 PolarHBondContact O-N 2.54Å; K4-D6 VanDerWaalsContact C-N 3.32Å; K4-I7 PolarHBondContact O-N 3.06Å; K4-V8 WeakPolarHBondContact O-CG2 3.25Å; K4-V8 PolarHBondContact O-N 3.25Å
5	D	79.4	Confident	72.5	Confident	100 Å²	100	107.3 Å²	107.3	54%	0.535	57%	0.57	S	S	.	*	H	α-helix	trans	-70.3	-33.2	-178.6	-61.9	-39.6	0	0	0	111.3	S2 R9	S2-D5 PolarHBondContact O-N 2.74Å; D5-R9 WeakPolarHBondContact O-CB 3.4Å; D5-R9 PolarHBondContact O-N 3.32Å
6	D	82.8	Confident	71.5	Confident	79 Å²	79	106.4 Å²	106.4	42%	0.422	57%	0.57	S	S	.	*	H	α-helix	trans	-72	-38.7	177.4	-66	-34.7	0	0	0	111.8	K4 V8 R9 T10	K4-D6 VanDerWaalsContact C-N 3.32Å; D6-V8 VanDerWaalsContact C-N 3.34Å; D6-V8 PolarHBondContact O-N 3.27Å; D6-R9 PolarHBondContact O-N 2.81Å; D6-R9 IonicContact OD1-CZ 3.27Å; D6-R9 IonicContact OD1-NH1 3.4Å; D6-R9 PolarHBondContact OD1-NH1 2.91Å; D6-T10 WeakPolarHBondContact O-CB 3.43Å; D6-T10 PolarHBondContact O-N 2.79Å; D6-T10 PolarHBondContact O-OG1 3.01Å
7	I	79.1	Confident	70.7	Confident	112 Å²	112	109.8 Å²	109.8	57%	0.574	58%	0.581	S	S	*	*	H	α-helix	trans	-61.9	-43	176.4	-64	168.1	0	0	0	111	S3 K4 A11	S3-I7 WeakPolarHBondContact O-CG1 2.96Å; S3-I7 PolarHBondContact O-N 3Å; K4-I7 PolarHBondContact O-N 3.06Å; I7-A11 WeakPolarHBondContact O-CB 3.41Å; I7-A11 PolarHBondContact O-N 2.73Å
8	V	78.9	Confident	69.9	Low	88 Å²	88	106.7 Å²	106.7	53%	0.533	57%	0.57	S	S	.	*	H	α-helix	trans	-66.6	-41.7	177.9	176.1	0	0	0	0	110.7	K4 D6 A11 L12	K4-V8 WeakPolarHBondContact O-CG2 3.25Å; K4-V8 PolarHBondContact O-N 3.25Å; D6-V8 VanDerWaalsContact C-N 3.34Å; D6-V8 PolarHBondContact O-N 3.27Å; V8-A11 PolarHBondContact O-N 3.47Å; V8-L12 HydrophobicContact CG1-CD1 4.01Å; V8-L12 WeakPolarHBondContact O-CG 3.37Å; V8-L12 PolarHBondContact O-N 3.07Å
9	R	78.8	Confident	69.1	Low	131 Å²	131	108.2 Å²	108.2	49%	0.494	57%	0.574	S	S	.	*	H	α-helix	trans	-62.6	-48.4	177.1	-167.9	-174.6	-60.3	124	7.4	111.5	D5 D6 A11 L12 E13	D5-R9 WeakPolarHBondContact O-CB 3.4Å; D5-R9 PolarHBondContact O-N 3.32Å; D6-R9 PolarHBondContact O-N 2.81Å; D6-R9 IonicContact OD1-CZ 3.27Å; D6-R9 IonicContact OD1-NH1 3.4Å; D6-R9 PolarHBondContact OD1-NH1 2.91Å; R9-A11 VanDerWaalsContact C-N 3.33Å; R9-A11 PolarHBondContact O-N 2.79Å; R9-L12 PolarHBondContact O-N 2.96Å; R9-E13 WeakPolarHBondContact CD-OE1 3.25Å; R9-E13 HydrophobicContact CG-CG 4.46Å; R9-E13 WeakPolarHBondContact CG-OE1 3.48Å; R9-E13 WeakPolarHBondContact O-CB 3.14Å; R9-E13 WeakPolarHBondContact O-CG 3.41Å; R9-E13 PolarHBondContact O-N 2.82Å
10	T	78.7	Confident	68.5	Low	89 Å²	89	107.3 Å²	107.3	55%	0.546	58%	0.576	S	S	.	*	H	α-helix	trans	-62.9	-38.9	178.2	-53.6	0	0	0	0	112.1	D6 S14	D6-T10 WeakPolarHBondContact O-CB 3.43Å; D6-T10 PolarHBondContact O-N 2.79Å; D6-T10 PolarHBondContact O-OG1 3.01Å; T10-S14 WeakPolarHBondContact O-CB 3.33Å; T10-S14 PolarHBondContact O-N 3.18Å; T10-S14 PolarHBondContact O-OG 3.27Å
11	A	76.8	Confident	67.9	Low	42 Å²	42	104.7 Å²	104.7	35%	0.347	57%	0.57	S	S	.	*	H	α-helix	trans	-63.2	-44.3	174.9	0	0	0	0	0	111.7	I7 V8 R9 S14 H15	I7-A11 WeakPolarHBondContact O-CB 3.41Å; I7-A11 PolarHBondContact O-N 2.73Å; V8-A11 PolarHBondContact O-N 3.47Å; R9-A11 VanDerWaalsContact C-N 3.33Å; R9-A11 PolarHBondContact O-N 2.79Å; A11-S14 PolarHBondContact O-N 3.41Å; A11-S14 PolarHBondContact O-OG 3.1Å; A11-H15 PolarHBondContact O-CD2 3.12Å; A11-H15 PolarHBondContact O-N 3.17Å
12	L	69.9	Low	68.1	Low	112 Å²	112	99.2 Å²	99.2	59%	0.586	54%	0.541	S	S	*	.	H	α-helix	trans	-67.3	-42.4	178.1	-72.4	171.9	0	0	0	112.7	V8 R9 S14 H15 T16	V8-L12 HydrophobicContact CG1-CD1 4.01Å; V8-L12 WeakPolarHBondContact O-CG 3.37Å; V8-L12 PolarHBondContact O-N 3.07Å; R9-L12 PolarHBondContact O-N 2.96Å; L12-S14 VanDerWaalsContact C-N 3.29Å; L12-S14 PolarHBondContact O-N 2.92Å; L12-H15 PolarHBondContact O-N 2.88Å; L12-H15 VanDerWaalsContact O-N 3.13Å; L12-T16 PolarHBondContact O-N 2.95Å
13	E	74.2	Confident	67.7	Low	112 Å²	112	102.7 Å²	102.7	52%	0.523	55%	0.55	S	S	.	.	H	α-helix	trans	-60.1	-41.1	175.7	-74.9	170.3	-178	0	0	110.7	R9 H15 T16	R9-E13 WeakPolarHBondContact CD-OE1 3.25Å; R9-E13 HydrophobicContact CG-CG 4.46Å; R9-E13 WeakPolarHBondContact CG-OE1 3.48Å; R9-E13 WeakPolarHBondContact O-CB 3.14Å; R9-E13 WeakPolarHBondContact O-CG 3.41Å; R9-E13 PolarHBondContact O-N 2.82Å; E13-H15 VanDerWaalsContact C-N 3.27Å; E13-H15 PolarHBondContact O-N 3.41Å; E13-T16 PolarHBondContact O-N 3.22Å; E13-T16 PolarHBondContact O-OG1 3.39Å
14	S	69.1	Low	66.7	Low	63 Å²	63	105.5 Å²	105.5	44%	0.441	55%	0.554	S	S	.	*	H	α-helix	trans	-65.7	-25.3	176.4	73.7	0	0	0	0	114.5	T10 A11 L12	T10-S14 WeakPolarHBondContact O-CB 3.33Å; T10-S14 PolarHBondContact O-N 3.18Å; T10-S14 PolarHBondContact O-OG 3.27Å; A11-S14 PolarHBondContact O-N 3.41Å; A11-S14 PolarHBondContact O-OG 3.1Å; L12-S14 VanDerWaalsContact C-N 3.29Å; L12-S14 PolarHBondContact O-N 2.92Å
15	H	55.8	Low	65.9	Low	125 Å²	125	101.5 Å²	101.5	58%	0.579	54%	0.542	S	S	*	.	H	α-helix	trans	-79.9	-25.9	176.8	-78.7	-61.9	0	0	0	113	A11 L12 E13 E17 S18	A11-H15 PolarHBondContact O-CD2 3.12Å; A11-H15 PolarHBondContact O-N 3.17Å; L12-H15 PolarHBondContact O-N 2.88Å; L12-H15 VanDerWaalsContact O-N 3.13Å; E13-H15 VanDerWaalsContact C-N 3.27Å; E13-H15 PolarHBondContact O-N 3.41Å; H15-E17 VanDerWaalsContact C-N 3.26Å; H15-E17 PolarHBondContact O-N 2.73Å; H15-S18 WeakPolarHBondContact O-CB 3.4Å; H15-S18 PolarHBondContact O-N 3.05Å
16	T	56.4	Low	64.9	Low	93 Å²	93	101.5 Å²	101.5	57%	0.571	54%	0.542	S	S	*	.	H	α-helix	trans	-67.7	-26.4	176.5	58.9	0	0	0	0	113	L12 E13 S18	L12-T16 PolarHBondContact O-N 2.95Å; E13-T16 PolarHBondContact O-N 3.22Å; E13-T16 PolarHBondContact O-OG1 3.39Å; T16-S18 PolarHBondContact O-N 2.97Å
17	E	57.3	Low	63.8	Low	163 Å²	163	101 Å²	101	76%	0.762	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.2	-15.7	172.7	-63.6	-174.8	171.6	0	0	112.8	H15	H15-E17 VanDerWaalsContact C-N 3.26Å; H15-E17 PolarHBondContact O-N 2.73Å
18	S	57.1	Low	63.1	Low	55 Å²	55	98.7 Å²	98.7	39%	0.385	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.8	-10.9	178.6	-68.3	0	0	0	0	114.4	H15 T16 S20 A21 E22	H15-S18 WeakPolarHBondContact O-CB 3.4Å; H15-S18 PolarHBondContact O-N 3.05Å; T16-S18 PolarHBondContact O-N 2.97Å; S18-S20 PolarHBondContact O-N 2.98Å; S18-A21 WeakPolarHBondContact O-CB 3.28Å; S18-A21 PolarHBondContact O-N 2.89Å; S18-E22 PolarHBondContact O-N 3.32Å; S18-E22 VanDerWaalsContact O-N 3.12Å
19	E	54.3	Low	62	Low	135 Å²	135	98.2 Å²	98.2	63%	0.631	53%	0.532	S	S	*	.	H	α-helix	trans	-60.3	-29.4	174.3	-81.9	-173.5	157.8	0	0	112	E22 Q23	E19-E22 PolarHBondContact O-N 3.41Å; E19-Q23 PolarHBondContact O-N 3.49Å
20	S	56.6	Low	61	Low	89 Å²	89	97.9 Å²	97.9	62%	0.622	54%	0.54	S	S	*	.	H	α-helix	trans	-70.1	-32	173.7	-64.3	0	0	0	0	112.7	S18	S18-S20 PolarHBondContact O-N 2.98Å
21	A	56.7	Low	60.4	Low	54 Å²	54	98.5 Å²	98.5	45%	0.446	55%	0.548	S	S	.	.	H	α-helix	trans	-73.5	-34.2	177.2	0	0	0	0	0	111.6	S18 Q23 E24 T25	S18-A21 WeakPolarHBondContact O-CB 3.28Å; S18-A21 PolarHBondContact O-N 2.89Å; A21-Q23 VanDerWaalsContact C-N 3.3Å; A21-Q23 PolarHBondContact O-N 3.01Å; A21-E24 PolarHBondContact O-N 3.34Å; A21-T25 PolarHBondContact O-N 3.4Å; A21-T25 PolarHBondContact O-OG1 2.83Å
22	E	52.4	Low	59.6	Low	127 Å²	127	103 Å²	103	59%	0.593	57%	0.566	S	S	*	*	H	α-helix	trans	-62.3	-38	176.8	-67.9	-165.5	173.6	0	0	111.8	S18 E19 T25 L26	S18-E22 PolarHBondContact O-N 3.32Å; S18-E22 VanDerWaalsContact O-N 3.12Å; E19-E22 PolarHBondContact O-N 3.41Å; E22-T25 VanDerWaalsContact CA-OG1 3.25Å; E22-T25 WeakPolarHBondContact CA-OG1 3.44Å; E22-T25 PolarHBondContact O-N 3.32Å; E22-T25 PolarHBondContact O-OG1 3.26Å; E22-L26 WeakPolarHBondContact O-CG 3.4Å; E22-L26 PolarHBondContact O-N 2.95Å
23	Q	56.7	Low	59.1	Low	143 Å²	143	102.5 Å²	102.5	67%	0.668	56%	0.563	S	S	*	*	H	α-helix	trans	-65.5	-38.8	177.2	-122	115.5	63.1	0	0	113.4	E19 A21 S27	E19-Q23 PolarHBondContact O-N 3.49Å; A21-Q23 VanDerWaalsContact C-N 3.3Å; A21-Q23 PolarHBondContact O-N 3.01Å; Q23-S27 PolarHBondContact O-N 2.99Å; Q23-S27 PolarHBondContact O-OG 3.12Å
24	E	56.2	Low	58.2	Low	144 Å²	144	102 Å²	102	67%	0.673	57%	0.57	S	S	*	*	H	α-helix	trans	-70.6	-36.8	174.4	-75.9	-170.6	167.5	0	0	112.2	A21 S27 S28	A21-E24 PolarHBondContact O-N 3.34Å; E24-S27 PolarHBondContact O-OG 2.92Å; E24-S28 WeakPolarHBondContact O-CB 3.33Å; E24-S28 PolarHBondContact O-N 3.49Å; E24-S28 VanDerWaalsContact O-N 3.1Å; E24-S28 PolarHBondContact O-OG 3.22Å
25	T	57.2	Low	57.6	Low	75 Å²	75	102.8 Å²	102.8	46%	0.46	59%	0.588	S	S	.	*	H	α-helix	trans	-67.7	-39.4	175.4	37.4	0	0	0	0	112.8	A21 E22 S28 I29	A21-T25 PolarHBondContact O-N 3.4Å; A21-T25 PolarHBondContact O-OG1 2.83Å; E22-T25 VanDerWaalsContact CA-OG1 3.25Å; E22-T25 WeakPolarHBondContact CA-OG1 3.44Å; E22-T25 PolarHBondContact O-N 3.32Å; E22-T25 PolarHBondContact O-OG1 3.26Å; T25-S28 PolarHBondContact O-N 2.97Å; T25-I29 WeakPolarHBondContact O-CB 3.43Å; T25-I29 WeakPolarHBondContact O-CD1 3.49Å; T25-I29 WeakPolarHBondContact O-CG1 3.42Å; T25-I29 PolarHBondContact O-N 2.85Å
26	L	57.4	Low	57.4	Low	101 Å²	101	103 Å²	103	53%	0.529	59%	0.592	S	S	.	*	H	α-helix	trans	-63.1	-45.7	179.6	-72.6	172.7	0	0	0	111.8	E22 S28 I29 D30	E22-L26 WeakPolarHBondContact O-CG 3.4Å; E22-L26 PolarHBondContact O-N 2.95Å; L26-S28 VanDerWaalsContact C-N 3.3Å; L26-S28 PolarHBondContact O-N 3.22Å; L26-I29 PolarHBondContact O-N 2.72Å; L26-D30 PolarHBondContact O-N 3.47Å
27	S	61.1	Low	57.2	Low	68 Å²	68	103.7 Å²	103.7	48%	0.476	60%	0.598	S	S	.	*	H	α-helix	trans	-65.7	-32.9	176.8	40.5	0	0	0	0	112.7	Q23 E24 S31	Q23-S27 PolarHBondContact O-N 2.99Å; Q23-S27 PolarHBondContact O-OG 3.12Å; E24-S27 PolarHBondContact O-OG 2.92Å; S27-S31 PolarHBondContact O-N 3.25Å; S27-S31 PolarHBondContact O-OG 3.44Å
28	S	64.5	Low	57.1	Low	64 Å²	64	101.7 Å²	101.7	45%	0.448	59%	0.592	S	S	.	*	H	α-helix	trans	-69.8	-38.8	171.5	-63	0	0	0	0	112.7	E24 T25 L26 S31 L32	E24-S28 WeakPolarHBondContact O-CB 3.33Å; E24-S28 PolarHBondContact O-N 3.49Å; E24-S28 VanDerWaalsContact O-N 3.1Å; E24-S28 PolarHBondContact O-OG 3.22Å; T25-S28 PolarHBondContact O-N 2.97Å; L26-S28 VanDerWaalsContact C-N 3.3Å; L26-S28 PolarHBondContact O-N 3.22Å; S28-S31 WeakPolarHBondContact O-CB 3.18Å; S28-S31 PolarHBondContact O-N 2.99Å; S28-L32 VanDerWaalsContact O-CG 3.25Å; S28-L32 WeakPolarHBondContact O-CG 3.41Å; S28-L32 PolarHBondContact O-N 2.9Å
29	I	56	Low	57.1	Low	78 Å²	78	105 Å²	105	40%	0.4	60%	0.601	S	S	.	*	H	α-helix	trans	-66.1	-43.8	178.1	-70.4	160.7	0	0	0	110.5	T25 L26 S31 L32 L33	T25-I29 WeakPolarHBondContact O-CB 3.43Å; T25-I29 WeakPolarHBondContact O-CD1 3.49Å; T25-I29 WeakPolarHBondContact O-CG1 3.42Å; T25-I29 PolarHBondContact O-N 2.85Å; L26-I29 PolarHBondContact O-N 2.72Å; I29-S31 PolarHBondContact O-N 3.21Å; I29-L32 CarbonylContact O-C 3.6Å; I29-L32 PolarHBondContact O-N 3.48Å; I29-L33 HydrophobicContact CG2-CD1 3.71Å; I29-L33 HydrophobicContact CG2-CG 4.22Å; I29-L33 WeakPolarHBondContact O-CG 3.3Å; I29-L33 PolarHBondContact O-N 2.88Å
30	D	56.4	Low	57.4	Low	124 Å²	124	106 Å²	106	66%	0.663	61%	0.606	S	S	*	*	H	α-helix	trans	-60.9	-30.3	175.9	-75.2	-19.8	0	0	0	112.2	L26	L26-D30 PolarHBondContact O-N 3.47Å
31	S	66.6	Low	58	Low	102 Å²	102	107.9 Å²	107.9	71%	0.713	61%	0.609	S	S	*	*	H	α-helix	trans	-75.2	-31.2	174.3	-52.6	0	0	0	0	112.9	S27 S28 I29	S27-S31 PolarHBondContact O-N 3.25Å; S27-S31 PolarHBondContact O-OG 3.44Å; S28-S31 WeakPolarHBondContact O-CB 3.18Å; S28-S31 PolarHBondContact O-N 2.99Å; I29-S31 PolarHBondContact O-N 3.21Å
32	L	60.6	Low	58.4	Low	136 Å²	136	110.6 Å²	110.6	71%	0.712	62%	0.615	S	S	*	*	H	α-helix	trans	-87.8	-19.1	-176.7	-73.4	168.3	0	0	0	113.4	S28 I29 P34	S28-L32 VanDerWaalsContact O-CG 3.25Å; S28-L32 WeakPolarHBondContact O-CG 3.41Å; S28-L32 PolarHBondContact O-N 2.9Å; I29-L32 CarbonylContact O-C 3.6Å; I29-L32 PolarHBondContact O-N 3.48Å; L32-P34 VanDerWaalsContact C-CD 3.49Å; L32-P34 WeakPolarHBondContact O-CD 3.3Å
33	L	59.2	Low	59.4	Low	102 Å²	102	111.8 Å²	111.8	53%	0.534	62%	0.615	S	S	.	*	S	Bend	trans	-92.6	88.1	170.3	-65.7	174.2	0	0	0	107.5	I29 G35	I29-L33 HydrophobicContact CG2-CD1 3.71Å; I29-L33 HydrophobicContact CG2-CG 4.22Å; I29-L33 WeakPolarHBondContact O-CG 3.3Å; I29-L33 PolarHBondContact O-N 2.88Å; L33-G35 PolarHBondContact O-N 2.91Å
34	P	55.6	Low	60.8	Low	102 Å²	102	107.8 Å²	107.8	66%	0.662	60%	0.599	S	S	*	*			trans	-54.1	122.1	171.1	22.8	-31.6	0	0	0	106.3	L32 L36	L32-P34 VanDerWaalsContact C-CD 3.49Å; L32-P34 WeakPolarHBondContact O-CD 3.3Å; P34-L36 PolarHBondContact O-N 3.36Å
35	G	55	Low	62.1	Low	79 Å²	79	107.2 Å²	107.2	81%	0.814	60%	0.596	S	S	*	*			trans	-42.6	71.3	-166.2	0	0	0	0	0	115.2	L33	L33-G35 PolarHBondContact O-N 2.91Å
36	L	51.5	Low	63.5	Low	129 Å²	129	110.6 Å²	110.6	68%	0.675	61%	0.607	S	S	*	*			trans	-59.9	123.9	170.1	-80.8	162.4	0	0	0	102.1	P34 I38	P34-L36 PolarHBondContact O-N 3.36Å; L36-I38 VanDerWaalsContact C-N 3.31Å; L36-I38 PolarHBondContact O-N 3.36Å
37	P	53.1	Low	64.9	Low	107 Å²	107	107.9 Å²	107.9	70%	0.695	60%	0.596	S	S	*	*			trans	-52.3	111.5	173.6	22.4	-30.7	0	0	0	104.8	Q39	P37-Q39 PolarHBondContact O-N 2.85Å
38	I	55.6	Low	66.2	Low	122 Å²	122	107.3 Å²	107.3	63%	0.626	59%	0.587	S	S	*	*			trans	-56.6	106.9	167.1	-62.7	173.1	0	0	0	100.8	L36 E40 Y43	L36-I38 VanDerWaalsContact C-N 3.31Å; L36-I38 PolarHBondContact O-N 3.36Å; I38-E40 PolarHBondContact O-N 3.06Å; I38-Y43 HydrophobicContact CG2-CD2 3.64Å; I38-Y43 HydrophobicContact CG2-CE2 4.06Å
39	Q	56.1	Low	67.2	Low	125 Å²	125	112 Å²	112	58%	0.584	60%	0.595	S	S	*	*			trans	-65.9	91.8	170.4	-72.6	-167.4	-40.5	0	0	103.1	P37 D41 L42 Y43	P37-Q39 PolarHBondContact O-N 2.85Å; Q39-D41 PolarHBondContact O-N 2.9Å; Q39-D41 VanDerWaalsContact O-N 3.07Å; Q39-L42 HydrophobicContact CB-CB 4.19Å; Q39-L42 WeakPolarHBondContact O-CB 3.09Å; Q39-L42 PolarHBondContact O-N 2.93Å; Q39-Y43 PolarHBondContact O-N 2.65Å
40	E	61.2	Low	68.8	Low	155 Å²	155	112.2 Å²	112.2	72%	0.724	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.2	-30.1	-179.2	-69.7	-179.3	171	0	0	109.5	I38 L42 Y43 N44	I38-E40 PolarHBondContact O-N 3.06Å; E40-L42 VanDerWaalsContact C-N 3.33Å; E40-L42 PolarHBondContact O-N 3.39Å; E40-Y43 CarbonylContact O-C 3.42Å; E40-Y43 PolarHBondContact O-N 2.75Å; E40-N44 PolarHBondContact O-N 3.3Å
41	D	68.1	Low	70.3	Confident	128 Å²	128	111 Å²	111	68%	0.684	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.6	-33.6	172.4	-64.3	-14.4	0	0	0	113.8	Q39 N44 S47	Q39-D41 PolarHBondContact O-N 2.9Å; Q39-D41 VanDerWaalsContact O-N 3.07Å; D41-N44 PolarHBondContact O-ND2 3.23Å; D41-S47 PolarHBondContact O-OG 3.38Å; D41-S47 VanDerWaalsContact O-OG 3.12Å
42	L	65.5	Low	71.3	Confident	112 Å²	112	113.3 Å²	113.3	59%	0.586	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	-32	177.2	-124	78.1	0	0	0	112	Q39 E40 S47	Q39-L42 HydrophobicContact CB-CB 4.19Å; Q39-L42 WeakPolarHBondContact O-CB 3.09Å; Q39-L42 PolarHBondContact O-N 2.93Å; E40-L42 VanDerWaalsContact C-N 3.33Å; E40-L42 PolarHBondContact O-N 3.39Å; L42-S47 VanDerWaalsContact O-CB 3.28Å; L42-S47 WeakPolarHBondContact O-CB 3.45Å
43	Y	74.5	Confident	72.7	Confident	151 Å²	151	109.9 Å²	109.9	59%	0.592	58%	0.582	S	S	*	*	S	Bend	trans	-96.9	11	179	-66.5	-78.7	0	0	0	113.3	I38 Q39 E40 L48	I38-Y43 HydrophobicContact CG2-CD2 3.64Å; I38-Y43 HydrophobicContact CG2-CE2 4.06Å; Q39-Y43 PolarHBondContact O-N 2.65Å; E40-Y43 CarbonylContact O-C 3.42Å; E40-Y43 PolarHBondContact O-N 2.75Å; Y43-L48 HydrophobicContact CD1-CD2 4.26Å; Y43-L48 WeakPolarHBondContact O-CD1 3.36Å
44	N	84.8	Confident	74.1	Confident	60 Å²	60	108.8 Å²	108.8	32%	0.321	58%	0.579	S	S	.	*	S	Bend	trans	-63.4	154.7	174.4	84.9	50.1	0	0	0	110.1	E40 D41 E46 S47 L48	E40-N44 PolarHBondContact O-N 3.3Å; D41-N44 PolarHBondContact O-ND2 3.23Å; N44-E46 VanDerWaalsContact C-N 3.26Å; N44-E46 PolarHBondContact O-N 3.1Å; N44-E46 WeakPolarHBondContact OD1-CA 3.49Å; N44-E46 WeakPolarHBondContact OD1-CB 3.47Å; N44-E46 PolarHBondContact OD1-N 3.43Å; N44-S47 PolarHBondContact ND2-OG 3.12Å; N44-S47 PolarHBondContact O-N 3.33Å; N44-S47 PolarHBondContact OD1-N 2.91Å; N44-S47 PolarHBondContact OD1-OG 3.29Å; N44-L48 PolarHBondContact O-N 3.25Å
45	E	83.2	Confident	75.8	Confident	132 Å²	132	106.3 Å²	106.3	62%	0.617	56%	0.563	S	S	*	*	H	α-helix	trans	-59	-35.9	-173	-166.4	-174	159.5	0	0	112.9	R49	E45-R49 VanDerWaalsContact O-CB 3.3Å; E45-R49 WeakPolarHBondContact O-CB 3.23Å; E45-R49 WeakPolarHBondContact O-CD 3.15Å; E45-R49 WeakPolarHBondContact O-CG 3.21Å; E45-R49 PolarHBondContact O-N 3.13Å; E45-R49 IonicContact OE1-CZ 3.24Å; E45-R49 IonicContact OE1-NE 2.93Å; E45-R49 PolarHBondContact OE1-NE 3.41Å; E45-R49 IonicContact OE1-NH2 3.63Å; E45-R49 PolarHBondContact OE1-NH2 3.31Å
46	E	87.6	Confident	77.6	Confident	146 Å²	146	104.2 Å²	104.2	68%	0.682	54%	0.541	S	S	*	.	H	α-helix	trans	-71.7	-43.7	179.5	-176.1	174.6	-169.4	0	0	112.3	N44 L48 R49 T50	N44-E46 VanDerWaalsContact C-N 3.26Å; N44-E46 PolarHBondContact O-N 3.1Å; N44-E46 WeakPolarHBondContact OD1-CA 3.49Å; N44-E46 WeakPolarHBondContact OD1-CB 3.47Å; N44-E46 PolarHBondContact OD1-N 3.43Å; E46-L48 VanDerWaalsContact C-N 3.35Å; E46-R49 PolarHBondContact O-N 3.26Å; E46-T50 WeakPolarHBondContact O-CB 3.46Å; E46-T50 PolarHBondContact O-N 3.03Å; E46-T50 PolarHBondContact O-OG1 2.9Å
47	S	86.8	Confident	79.6	Confident	44 Å²	44	107 Å²	107	31%	0.308	54%	0.542	S	S	.	.	H	α-helix	trans	-58.8	-46.7	173.6	-66	0	0	0	0	110.6	D41 L42 N44 T50 L51	D41-S47 PolarHBondContact O-OG 3.38Å; D41-S47 VanDerWaalsContact O-OG 3.12Å; L42-S47 VanDerWaalsContact O-CB 3.28Å; L42-S47 WeakPolarHBondContact O-CB 3.45Å; N44-S47 PolarHBondContact ND2-OG 3.12Å; N44-S47 PolarHBondContact O-N 3.33Å; N44-S47 PolarHBondContact OD1-N 2.91Å; N44-S47 PolarHBondContact OD1-OG 3.29Å; S47-T50 PolarHBondContact O-N 2.8Å; S47-L51 WeakPolarHBondContact O-CB 3.42Å; S47-L51 PolarHBondContact O-N 3.07Å
48	L	87.8	Confident	81.6	Confident	55 Å²	55	107.4 Å²	107.4	29%	0.288	54%	0.535	S	S	.	.	H	α-helix	trans	-65.9	-45	177.2	-70.5	176.8	0	0	0	112	Y43 N44 E46 T50 L51 F52	Y43-L48 HydrophobicContact CD1-CD2 4.26Å; Y43-L48 WeakPolarHBondContact O-CD1 3.36Å; N44-L48 PolarHBondContact O-N 3.25Å; E46-L48 VanDerWaalsContact C-N 3.35Å; L48-T50 VanDerWaalsContact C-N 3.28Å; L48-T50 PolarHBondContact O-N 3.41Å; L48-L51 PolarHBondContact O-N 3.36Å; L48-F52 HydrophobicContact CB-CD2 4.39Å; L48-F52 HydrophobicContact CB-CE2 4.39Å; L48-F52 WeakPolarHBondContact O-CB 3.5Å; L48-F52 WeakPolarHBondContact O-CD2 3.38Å; L48-F52 PolarHBondContact O-N 3.37Å
49	R	86.8	Confident	83.4	Confident	163 Å²	163	106.8 Å²	106.8	62%	0.615	53%	0.532	S	S	*	.	H	α-helix	trans	-57.2	-43.2	175.8	-79.3	170	-179.1	-94.3	3.7	111.5	E45 E46 F52 A53	E45-R49 VanDerWaalsContact O-CB 3.3Å; E45-R49 WeakPolarHBondContact O-CB 3.23Å; E45-R49 WeakPolarHBondContact O-CD 3.15Å; E45-R49 WeakPolarHBondContact O-CG 3.21Å; E45-R49 PolarHBondContact O-N 3.13Å; E45-R49 IonicContact OE1-CZ 3.24Å; E45-R49 IonicContact OE1-NE 2.93Å; E45-R49 PolarHBondContact OE1-NE 3.41Å; E45-R49 IonicContact OE1-NH2 3.63Å; E45-R49 PolarHBondContact OE1-NH2 3.31Å; E46-R49 PolarHBondContact O-N 3.26Å; R49-F52 PolarHBondContact O-N 2.74Å; R49-A53 VanDerWaalsContact O-CB 3.3Å; R49-A53 WeakPolarHBondContact O-CB 3.43Å; R49-A53 PolarHBondContact O-N 3.42Å
50	T	89.2	Confident	85.3	Confident	82 Å²	82	104.6 Å²	104.6	50%	0.503	52%	0.524	S	S	.	.	H	α-helix	trans	-65.1	-46.9	177.5	-58.3	0	0	0	0	111.3	E46 S47 L48 F52 A53 V54	E46-T50 WeakPolarHBondContact O-CB 3.46Å; E46-T50 PolarHBondContact O-N 3.03Å; E46-T50 PolarHBondContact O-OG1 2.9Å; S47-T50 PolarHBondContact O-N 2.8Å; L48-T50 VanDerWaalsContact C-N 3.28Å; L48-T50 PolarHBondContact O-N 3.41Å; T50-F52 PolarHBondContact O-N 2.87Å; T50-A53 PolarHBondContact O-N 3.4Å; T50-V54 WeakPolarHBondContact O-CG2 3.27Å; T50-V54 PolarHBondContact O-N 2.88Å
51	L	87.4	Confident	87	Confident	99 Å²	99	102.9 Å²	102.9	52%	0.518	52%	0.515	S	S	.	.	H	α-helix	trans	-58	-46.8	175.9	178.9	64.1	0	0	0	111.5	S47 L48 V54 T55	S47-L51 WeakPolarHBondContact O-CB 3.42Å; S47-L51 PolarHBondContact O-N 3.07Å; L48-L51 PolarHBondContact O-N 3.36Å; L51-V54 PolarHBondContact O-N 3.13Å; L51-T55 WeakPolarHBondContact CD1-OG1 3.49Å; L51-T55 WeakPolarHBondContact O-CB 3.49Å; L51-T55 PolarHBondContact O-N 3.4Å; L51-T55 PolarHBondContact O-OG1 2.85Å
52	F	88.3	Confident	88.4	Confident	150 Å²	150	101.1 Å²	101.1	66%	0.658	51%	0.51	S	S	*	.	H	α-helix	trans	-66.9	-34.7	177.5	-78.8	-63.4	0	0	0	112.8	L48 R49 T50 G56	L48-F52 HydrophobicContact CB-CD2 4.39Å; L48-F52 HydrophobicContact CB-CE2 4.39Å; L48-F52 WeakPolarHBondContact O-CB 3.5Å; L48-F52 WeakPolarHBondContact O-CD2 3.38Å; L48-F52 PolarHBondContact O-N 3.37Å; R49-F52 PolarHBondContact O-N 2.74Å; T50-F52 PolarHBondContact O-N 2.87Å; F52-G56 WeakPolarHBondContact O-CA 3.33Å; F52-G56 PolarHBondContact O-N 3.46Å
53	A	89.5	Confident	89.9	Confident	65 Å²	65	103 Å²	103	54%	0.537	51%	0.513	S	S	.	.	H	α-helix	trans	-67.2	-42.5	176.9	0	0	0	0	0	112.1	R49 T50 R57	R49-A53 VanDerWaalsContact O-CB 3.3Å; R49-A53 WeakPolarHBondContact O-CB 3.43Å; R49-A53 PolarHBondContact O-N 3.42Å; T50-A53 PolarHBondContact O-N 3.4Å; A53-R57 WeakPolarHBondContact O-CB 3.45Å; A53-R57 PolarHBondContact O-N 3.26Å
54	V	88.9	Confident	91	Very high	78 Å²	78	102.8 Å²	102.8	47%	0.473	51%	0.511	S	S	.	.	H	α-helix	trans	-71	-57.9	177.2	176.1	0	0	0	0	110.2	T50 L51 G56 R57 E58	T50-V54 WeakPolarHBondContact O-CG2 3.27Å; T50-V54 PolarHBondContact O-N 2.88Å; L51-V54 PolarHBondContact O-N 3.13Å; V54-G56 VanDerWaalsContact C-N 3.31Å; V54-G56 PolarHBondContact O-N 2.92Å; V54-R57 WeakPolarHBondContact O-CB 3.37Å; V54-R57 PolarHBondContact O-N 2.87Å; V54-R57 VanDerWaalsContact O-N 3.1Å; V54-E58 PolarHBondContact O-N 3.44Å; V54-E58 VanDerWaalsContact O-N 3.12Å
55	T	92.1	Very high	91.7	Very high	51 Å²	51	107.8 Å²	107.8	31%	0.313	53%	0.526	S	S	.	.	H	α-helix	trans	-62.1	-39.8	-177.5	-46.7	0	0	0	0	111.2	L51 R57 E58 I59	L51-T55 WeakPolarHBondContact CD1-OG1 3.49Å; L51-T55 WeakPolarHBondContact O-CB 3.49Å; L51-T55 PolarHBondContact O-N 3.4Å; L51-T55 PolarHBondContact O-OG1 2.85Å; T55-R57 VanDerWaalsContact C-N 3.33Å; T55-R57 PolarHBondContact O-N 3.46Å; T55-E58 PolarHBondContact O-N 2.99Å; T55-I59 HydrophobicContact CG2-CD1 3.86Å; T55-I59 HydrophobicContact CG2-CG1 4.38Å; T55-I59 WeakPolarHBondContact O-CB 3.47Å; T55-I59 VanDerWaalsContact O-CG1 3.23Å; T55-I59 WeakPolarHBondContact O-CG1 3.41Å; T55-I59 PolarHBondContact O-N 2.99Å
56	G	92.2	Very high	92.4	Very high	34 Å²	34	106.6 Å²	106.6	35%	0.351	52%	0.523	S	S	.	.	H	α-helix	trans	-63.7	-36.8	177.2	0	0	0	0	0	112.8	F52 V54 L60	F52-G56 WeakPolarHBondContact O-CA 3.33Å; F52-G56 PolarHBondContact O-N 3.46Å; V54-G56 VanDerWaalsContact C-N 3.31Å; V54-G56 PolarHBondContact O-N 2.92Å; G56-L60 VanDerWaalsContact O-CB 3.27Å; G56-L60 WeakPolarHBondContact O-CB 3.44Å; G56-L60 PolarHBondContact O-N 3.43Å
57	R	92.6	Very high	92.9	Very high	188 Å²	188	106.6 Å²	106.6	71%	0.709	52%	0.521	S	S	*	.	H	α-helix	trans	-65	-46.5	174.4	-175.7	-176.3	-64.9	-154	0.7	111.2	A53 V54 T55 L60 E61	A53-R57 WeakPolarHBondContact O-CB 3.45Å; A53-R57 PolarHBondContact O-N 3.26Å; V54-R57 WeakPolarHBondContact O-CB 3.37Å; V54-R57 PolarHBondContact O-N 2.87Å; V54-R57 VanDerWaalsContact O-N 3.1Å; T55-R57 VanDerWaalsContact C-N 3.33Å; T55-R57 PolarHBondContact O-N 3.46Å; R57-L60 PolarHBondContact O-N 2.87Å; R57-E61 PolarHBondContact O-N 3.42Å
58	E	94.6	Very high	93.5	Very high	116 Å²	116	111.8 Å²	111.8	54%	0.542	53%	0.533	S	S	.	.	H	α-helix	trans	-63.4	-43.3	178.7	-68.3	178.1	174.1	0	0	112.3	V54 T55 L60 E61 T62	V54-E58 PolarHBondContact O-N 3.44Å; V54-E58 VanDerWaalsContact O-N 3.12Å; T55-E58 PolarHBondContact O-N 2.99Å; E58-L60 VanDerWaalsContact C-N 3.33Å; E58-L60 PolarHBondContact O-N 3.22Å; E58-E61 PolarHBondContact O-N 2.96Å; E58-T62 WeakPolarHBondContact O-CB 3.36Å; E58-T62 PolarHBondContact O-N 3.27Å; E58-T62 PolarHBondContact O-OG1 3.37Å
59	I	94.9	Very high	94	Very high	109 Å²	109	112.6 Å²	112.6	56%	0.559	54%	0.537	S	S	*	.	H	α-helix	trans	-60.2	-45.2	174.4	-70.9	168.1	0	0	0	110.1	T55 T62 K63	T55-I59 HydrophobicContact CG2-CD1 3.86Å; T55-I59 HydrophobicContact CG2-CG1 4.38Å; T55-I59 WeakPolarHBondContact O-CB 3.47Å; T55-I59 VanDerWaalsContact O-CG1 3.23Å; T55-I59 WeakPolarHBondContact O-CG1 3.41Å; T55-I59 PolarHBondContact O-N 2.99Å; I59-T62 PolarHBondContact O-N 3.26Å; I59-K63 WeakPolarHBondContact O-CB 3.49Å; I59-K63 PolarHBondContact O-N 3.41Å
60	L	95.2	Very high	94.5	Very high	79 Å²	79	108.1 Å²	108.1	41%	0.414	53%	0.528	S	S	.	.	H	α-helix	trans	-65.7	-40.2	-179.5	-177	59.4	0	0	0	112	G56 R57 E58 K63 R64	G56-L60 VanDerWaalsContact O-CB 3.27Å; G56-L60 WeakPolarHBondContact O-CB 3.44Å; G56-L60 PolarHBondContact O-N 3.43Å; R57-L60 PolarHBondContact O-N 2.87Å; E58-L60 VanDerWaalsContact C-N 3.33Å; E58-L60 PolarHBondContact O-N 3.22Å; L60-K63 PolarHBondContact O-N 3.42Å; L60-R64 VanDerWaalsContact CD2-NH2 3.29Å; L60-R64 WeakPolarHBondContact O-CG 3.49Å; L60-R64 PolarHBondContact O-N 2.99Å
61	E	97.6	Very high	94.9	Very high	118 Å²	118	108.6 Å²	108.6	55%	0.551	53%	0.527	S	S	*	.	H	α-helix	trans	-63.4	-46.1	174.1	-177.9	169.5	-174.7	0	0	111.7	R57 E58 K63 R64 R65	R57-E61 PolarHBondContact O-N 3.42Å; E58-E61 PolarHBondContact O-N 2.96Å; E61-K63 VanDerWaalsContact C-N 3.31Å; E61-K63 PolarHBondContact O-N 2.86Å; E61-R64 WeakPolarHBondContact O-CB 3.39Å; E61-R64 PolarHBondContact O-N 3.26Å; E61-R64 VanDerWaalsContact O-N 3.13Å; E61-R65 WeakPolarHBondContact O-CB 3.49Å; E61-R65 PolarHBondContact O-N 3.05Å
62	T	97.2	Very high	95.4	Very high	92 Å²	92	109 Å²	109	56%	0.564	53%	0.526	S	S	*	.	H	α-helix	trans	-59.1	-43.9	176.1	-60.2	0	0	0	0	111	E58 I59 R64 R65 L66	E58-T62 WeakPolarHBondContact O-CB 3.36Å; E58-T62 PolarHBondContact O-N 3.27Å; E58-T62 PolarHBondContact O-OG1 3.37Å; I59-T62 PolarHBondContact O-N 3.26Å; T62-R64 PolarHBondContact O-N 3.13Å; T62-R65 PolarHBondContact O-N 3.16Å; T62-L66 WeakPolarHBondContact O-CB 3.34Å; T62-L66 PolarHBondContact O-N 2.96Å
63	K	97.3	Very high	95.9	Very high	151 Å²	151	107.1 Å²	107.1	66%	0.657	52%	0.522	S	S	*	.	H	α-helix	trans	-60.5	-43.1	174.7	-176.2	178.2	179.6	176.5	0	112.2	I59 L60 E61 L66 K67	I59-K63 WeakPolarHBondContact O-CB 3.49Å; I59-K63 PolarHBondContact O-N 3.41Å; L60-K63 PolarHBondContact O-N 3.42Å; E61-K63 VanDerWaalsContact C-N 3.31Å; E61-K63 PolarHBondContact O-N 2.86Å; K63-L66 PolarHBondContact O-N 2.99Å; K63-K67 WeakPolarHBondContact O-CB 3.36Å; K63-K67 PolarHBondContact O-N 3.43Å
64	R	98.2	Very high	96.3	Very high	147 Å²	147	107 Å²	107	56%	0.555	51%	0.512	S	S	*	.	H	α-helix	trans	-65.3	-40.9	176.1	-72.2	174.3	-171.9	143.7	-3.3	111.9	L60 E61 T62 K67 R68	L60-R64 VanDerWaalsContact CD2-NH2 3.29Å; L60-R64 WeakPolarHBondContact O-CG 3.49Å; L60-R64 PolarHBondContact O-N 2.99Å; E61-R64 WeakPolarHBondContact O-CB 3.39Å; E61-R64 PolarHBondContact O-N 3.26Å; E61-R64 VanDerWaalsContact O-N 3.13Å; T62-R64 PolarHBondContact O-N 3.13Å; R64-K67 PolarHBondContact O-N 3.29Å; R64-R68 PolarHBondContact O-N 3.48Å; R64-R68 VanDerWaalsContact O-N 3.17Å
65	R	98.4	Very high	96.7	Very high	165 Å²	165	109.3 Å²	109.3	62%	0.623	52%	0.518	S	S	*	.	H	α-helix	trans	-61.6	-48.2	175.4	-176.6	178.6	178.5	-179.1	-0.5	111	E61 T62 K67 R68 I69	E61-R65 WeakPolarHBondContact O-CB 3.49Å; E61-R65 PolarHBondContact O-N 3.05Å; T62-R65 PolarHBondContact O-N 3.16Å; R65-K67 VanDerWaalsContact C-N 3.32Å; R65-K67 PolarHBondContact O-N 2.96Å; R65-R68 WeakPolarHBondContact O-CB 3.46Å; R65-R68 PolarHBondContact O-N 3.17Å; R65-R68 VanDerWaalsContact O-N 3.16Å; R65-I69 HydrophobicContact CG-CD1 4.2Å; R65-I69 WeakPolarHBondContact O-CG1 3.5Å; R65-I69 PolarHBondContact O-N 2.96Å; R65-I69 VanDerWaalsContact O-N 3.13Å
66	L	98.5	Very high	97	Very high	106 Å²	106	114.1 Å²	114.1	56%	0.555	53%	0.531	S	S	*	.	H	α-helix	trans	-60.3	-42.3	177.7	-175.1	62.1	0	0	0	111.7	T62 K63 R68 I69 V70	T62-L66 WeakPolarHBondContact O-CB 3.34Å; T62-L66 PolarHBondContact O-N 2.96Å; K63-L66 PolarHBondContact O-N 2.99Å; L66-R68 VanDerWaalsContact C-N 3.31Å; L66-R68 PolarHBondContact O-N 3.48Å; L66-I69 PolarHBondContact O-N 3.41Å; L66-V70 HydrophobicContact CD1-CG2 4.49Å; L66-V70 WeakPolarHBondContact O-CG2 3.47Å; L66-V70 PolarHBondContact O-N 3.47Å
67	K	98	Very high	97.2	Very high	147 Å²	147	117.3 Å²	117.3	64%	0.639	54%	0.537	S	S	*	.	H	α-helix	trans	-57.3	-42.5	175.4	-175.2	179.8	178.1	-177.7	0	112.4	K63 R64 R65 V70 L71	K63-K67 WeakPolarHBondContact O-CB 3.36Å; K63-K67 PolarHBondContact O-N 3.43Å; R64-K67 PolarHBondContact O-N 3.29Å; R65-K67 VanDerWaalsContact C-N 3.32Å; R65-K67 PolarHBondContact O-N 2.96Å; K67-V70 PolarHBondContact O-N 3.39Å; K67-L71 HydrophobicContact CG-CD1 4.44Å; K67-L71 WeakPolarHBondContact O-CG 3.4Å; K67-L71 PolarHBondContact O-N 2.88Å; K67-L71 VanDerWaalsContact O-N 3.14Å
68	R	98.4	Very high	97.5	Very high	152 Å²	152	116 Å²	116	57%	0.574	53%	0.532	S	S	*	.	H	α-helix	trans	-62.3	-48.5	176.7	-73.9	-174.6	-75.5	175.1	-2.9	111.6	R64 R65 L66 V70 L71 E72	R64-R68 PolarHBondContact O-N 3.48Å; R64-R68 VanDerWaalsContact O-N 3.17Å; R65-R68 WeakPolarHBondContact O-CB 3.46Å; R65-R68 PolarHBondContact O-N 3.17Å; R65-R68 VanDerWaalsContact O-N 3.16Å; L66-R68 VanDerWaalsContact C-N 3.31Å; L66-R68 PolarHBondContact O-N 3.48Å; R68-V70 VanDerWaalsContact C-N 3.32Å; R68-V70 PolarHBondContact O-N 2.94Å; R68-L71 PolarHBondContact O-N 3.24Å; R68-L71 VanDerWaalsContact O-N 3.13Å; R68-E72 WeakPolarHBondContact O-CG 3.49Å; R68-E72 PolarHBondContact O-N 2.99Å
69	I	98.1	Very high	97.6	Very high	72 Å²	72	115.7 Å²	115.7	37%	0.369	53%	0.529	S	S	.	.	H	α-helix	trans	-57.8	-45.2	178.3	-65.5	167.6	0	0	0	111	R65 L66 L71 E72 L73	R65-I69 HydrophobicContact CG-CD1 4.2Å; R65-I69 WeakPolarHBondContact O-CG1 3.5Å; R65-I69 PolarHBondContact O-N 2.96Å; R65-I69 VanDerWaalsContact O-N 3.13Å; L66-I69 PolarHBondContact O-N 3.41Å; I69-L71 VanDerWaalsContact C-N 3.33Å; I69-L71 PolarHBondContact O-N 3.47Å; I69-E72 PolarHBondContact O-N 3.42Å; I69-L73 HydrophobicContact CG2-CD1 4.05Å; I69-L73 HydrophobicContact CG2-CG 4.42Å; I69-L73 VanDerWaalsContact O-CG 3.31Å; I69-L73 WeakPolarHBondContact O-CG 3.44Å; I69-L73 PolarHBondContact O-N 3.48Å
70	V	98.2	Very high	97.7	Very high	70 Å²	70	114.1 Å²	114.1	42%	0.424	52%	0.524	S	S	.	.	H	α-helix	trans	-61.9	-40.6	178.7	171.2	0	0	0	0	111.7	L66 K67 R68 L73 I74	L66-V70 HydrophobicContact CD1-CG2 4.49Å; L66-V70 WeakPolarHBondContact O-CG2 3.47Å; L66-V70 PolarHBondContact O-N 3.47Å; K67-V70 PolarHBondContact O-N 3.39Å; R68-V70 VanDerWaalsContact C-N 3.32Å; R68-V70 PolarHBondContact O-N 2.94Å; V70-L73 PolarHBondContact O-N 3.07Å; V70-I74 HydrophobicContact CG1-CD1 4.07Å; V70-I74 VanDerWaalsContact O-CG1 3.32Å; V70-I74 WeakPolarHBondContact O-CG1 3.5Å; V70-I74 PolarHBondContact O-N 3Å; V70-I74 VanDerWaalsContact O-N 3.07Å
71	L	98	Very high	97.7	Very high	91 Å²	91	116.4 Å²	116.4	48%	0.476	53%	0.531	S	S	.	.	H	α-helix	trans	-65.6	-44.1	177	-70.2	172.7	0	0	0	112	K67 R68 I69 L73 I74 E75	K67-L71 HydrophobicContact CG-CD1 4.44Å; K67-L71 WeakPolarHBondContact O-CG 3.4Å; K67-L71 PolarHBondContact O-N 2.88Å; K67-L71 VanDerWaalsContact O-N 3.14Å; R68-L71 PolarHBondContact O-N 3.24Å; R68-L71 VanDerWaalsContact O-N 3.13Å; I69-L71 VanDerWaalsContact C-N 3.33Å; I69-L71 PolarHBondContact O-N 3.47Å; L71-L73 VanDerWaalsContact C-N 3.3Å; L71-L73 PolarHBondContact O-N 2.87Å; L71-I74 PolarHBondContact O-N 3.32Å; L71-E75 PolarHBondContact O-N 3.1Å
72	E	98.2	Very high	97.6	Very high	109 Å²	109	119.3 Å²	119.3	51%	0.509	54%	0.537	S	S	.	.	H	α-helix	trans	-59	-42.3	175	-71.8	171.9	-160.7	0	0	111.3	R68 I69 I74 E75 Y76	R68-E72 WeakPolarHBondContact O-CG 3.49Å; R68-E72 PolarHBondContact O-N 2.99Å; I69-E72 PolarHBondContact O-N 3.42Å; E72-I74 PolarHBondContact O-N 3.13Å; E72-E75 PolarHBondContact O-N 3.14Å; E72-Y76 WeakPolarHBondContact O-CB 3.31Å; E72-Y76 WeakPolarHBondContact O-CD2 3.47Å; E72-Y76 PolarHBondContact O-N 3.36Å
73	L	98.5	Very high	97.5	Very high	109 Å²	109	120.1 Å²	120.1	57%	0.571	54%	0.535	S	S	*	.	H	α-helix	trans	-62.5	-41	176.7	-72.3	173	0	0	0	112.4	I69 V70 L71 E75 Y76 E77	I69-L73 HydrophobicContact CG2-CD1 4.05Å; I69-L73 HydrophobicContact CG2-CG 4.42Å; I69-L73 VanDerWaalsContact O-CG 3.31Å; I69-L73 WeakPolarHBondContact O-CG 3.44Å; I69-L73 PolarHBondContact O-N 3.48Å; V70-L73 PolarHBondContact O-N 3.07Å; L71-L73 VanDerWaalsContact C-N 3.3Å; L71-L73 PolarHBondContact O-N 2.87Å; L73-E75 VanDerWaalsContact C-N 3.34Å; L73-E75 PolarHBondContact O-N 3.04Å; L73-Y76 PolarHBondContact O-N 2.88Å; L73-E77 WeakPolarHBondContact O-CB 3.37Å; L73-E77 PolarHBondContact O-N 2.88Å
74	I	97.4	Very high	97.4	Very high	64 Å²	64	120.7 Å²	120.7	33%	0.328	53%	0.533	S	S	.	.	H	α-helix	trans	-63.2	-41.1	175.5	-68.5	164.8	0	0	0	110.8	V70 L71 E72 E77 R78	V70-I74 HydrophobicContact CG1-CD1 4.07Å; V70-I74 VanDerWaalsContact O-CG1 3.32Å; V70-I74 WeakPolarHBondContact O-CG1 3.5Å; V70-I74 PolarHBondContact O-N 3Å; V70-I74 VanDerWaalsContact O-N 3.07Å; L71-I74 PolarHBondContact O-N 3.32Å; E72-I74 PolarHBondContact O-N 3.13Å; I74-E77 PolarHBondContact O-N 3.32Å; I74-R78 WeakPolarHBondContact O-CG 3.32Å; I74-R78 PolarHBondContact O-N 3.2Å
75	E	97.5	Very high	97.1	Very high	126 Å²	126	116 Å²	116	59%	0.589	53%	0.526	S	S	*	.	H	α-helix	trans	-65.4	-43.2	176.5	-71.9	-180	-174.8	0	0	112	L71 E72 L73 R78 K79	L71-E75 PolarHBondContact O-N 3.1Å; E72-E75 PolarHBondContact O-N 3.14Å; L73-E75 VanDerWaalsContact C-N 3.34Å; L73-E75 PolarHBondContact O-N 3.04Å; E75-R78 PolarHBondContact O-N 3.09Å; E75-K79 WeakPolarHBondContact O-CB 3.45Å; E75-K79 PolarHBondContact O-N 3.15Å
76	Y	98.2	Very high	96.8	Very high	151 Å²	151	111 Å²	111	59%	0.592	52%	0.52	S	S	*	.	H	α-helix	trans	-59.6	-44.8	173.3	-98.2	-79.2	0	0	0	111.7	E72 L73 R78 K79 V80	E72-Y76 WeakPolarHBondContact O-CB 3.31Å; E72-Y76 WeakPolarHBondContact O-CD2 3.47Å; E72-Y76 PolarHBondContact O-N 3.36Å; L73-Y76 PolarHBondContact O-N 2.88Å; Y76-R78 PolarHBondContact O-N 3.44Å; Y76-K79 WeakPolarHBondContact O-CB 3.38Å; Y76-K79 PolarHBondContact O-N 3.36Å; Y76-K79 VanDerWaalsContact O-N 3.15Å; Y76-V80 WeakPolarHBondContact O-CG2 3.49Å; Y76-V80 PolarHBondContact O-N 2.92Å
77	E	97.1	Very high	96.4	Very high	101 Å²	101	111.7 Å²	111.7	47%	0.472	52%	0.524	S	S	.	.	H	α-helix	trans	-59.8	-45.5	177.3	-167.2	-163.4	156.9	0	0	111.4	L73 I74 K79 V80 K81	L73-E77 WeakPolarHBondContact O-CB 3.37Å; L73-E77 PolarHBondContact O-N 2.88Å; I74-E77 PolarHBondContact O-N 3.32Å; E77-K79 VanDerWaalsContact C-N 3.32Å; E77-K79 PolarHBondContact O-N 3.5Å; E77-V80 PolarHBondContact O-N 2.93Å; E77-K81 WeakPolarHBondContact O-CG 3.35Å; E77-K81 PolarHBondContact O-N 3.02Å; E77-K81 VanDerWaalsContact OE1-CE 3.29Å; E77-K81 WeakPolarHBondContact OE1-CE 3.41Å; E77-K81 IonicContact OE1-NZ 3.2Å; E77-K81 PolarHBondContact OE1-NZ 3.41Å
78	R	97.5	Very high	95.8	Very high	161 Å²	161	110.5 Å²	110.5	61%	0.608	52%	0.52	S	S	*	.	H	α-helix	trans	-61.8	-39.2	175.4	-71.4	175.6	-172.8	174.5	2.8	111.9	I74 E75 Y76 R82	I74-R78 WeakPolarHBondContact O-CG 3.32Å; I74-R78 PolarHBondContact O-N 3.2Å; E75-R78 PolarHBondContact O-N 3.09Å; Y76-R78 PolarHBondContact O-N 3.44Å; R78-R82 WeakPolarHBondContact O-CG 3.29Å; R78-R82 PolarHBondContact O-N 2.65Å; R78-R82 VanDerWaalsContact O-N 3.1Å
79	K	97.6	Very high	94.7	Very high	109 Å²	109	110.6 Å²	110.6	47%	0.474	53%	0.527	S	S	.	.	H	α-helix	trans	-64.2	-46.2	176.3	-173.9	179.4	178	-178.6	0	111.2	E75 Y76 E77 K81 R82 M83	E75-K79 WeakPolarHBondContact O-CB 3.45Å; E75-K79 PolarHBondContact O-N 3.15Å; Y76-K79 WeakPolarHBondContact O-CB 3.38Å; Y76-K79 PolarHBondContact O-N 3.36Å; Y76-K79 VanDerWaalsContact O-N 3.15Å; E77-K79 VanDerWaalsContact C-N 3.32Å; E77-K79 PolarHBondContact O-N 3.5Å; K79-K81 PolarHBondContact O-N 3.31Å; K79-R82 PolarHBondContact O-N 3.03Å; K79-M83 HydrophobicContact CG-SD 4.28Å; K79-M83 WeakPolarHBondContact O-CG 3.37Å; K79-M83 PolarHBondContact O-N 3.43Å
80	V	96.8	Very high	93	Very high	76 Å²	76	109.7 Å²	109.7	46%	0.461	54%	0.535	S	S	.	.	H	α-helix	trans	-61.6	-43	177.1	171.2	0	0	0	0	111.3	Y76 E77 R82 M83 R84	Y76-V80 WeakPolarHBondContact O-CG2 3.49Å; Y76-V80 PolarHBondContact O-N 2.92Å; E77-V80 PolarHBondContact O-N 2.93Å; V80-R82 PolarHBondContact O-N 2.88Å; V80-M83 PolarHBondContact O-N 2.93Å; V80-R84 WeakPolarHBondContact O-CB 3.36Å; V80-R84 PolarHBondContact O-N 3.06Å
81	K	96	Very high	90.9	Very high	128 Å²	128	111.5 Å²	111.5	56%	0.557	55%	0.547	S	S	*	.	H	α-helix	trans	-59.3	-43.9	175.5	-78.5	172.9	169.6	167.6	0	112.2	E77 K79 R84 A85	E77-K81 WeakPolarHBondContact O-CG 3.35Å; E77-K81 PolarHBondContact O-N 3.02Å; E77-K81 VanDerWaalsContact OE1-CE 3.29Å; E77-K81 WeakPolarHBondContact OE1-CE 3.41Å; E77-K81 IonicContact OE1-NZ 3.2Å; E77-K81 PolarHBondContact OE1-NZ 3.41Å; K79-K81 PolarHBondContact O-N 3.31Å; K81-R84 PolarHBondContact O-N 3.31Å; K81-A85 PolarHBondContact O-N 3.3Å
82	R	94.5	Very high	88.8	Confident	178 Å²	178	112.1 Å²	112.1	67%	0.672	56%	0.558	S	S	*	*	H	α-helix	trans	-64.6	-44.7	175.5	-73.9	-172.7	-68.8	155.8	-4.7	112.6	R78 K79 V80 R84 A85 A86	R78-R82 WeakPolarHBondContact O-CG 3.29Å; R78-R82 PolarHBondContact O-N 2.65Å; R78-R82 VanDerWaalsContact O-N 3.1Å; K79-R82 PolarHBondContact O-N 3.03Å; V80-R82 PolarHBondContact O-N 2.88Å; R82-R84 VanDerWaalsContact C-N 3.32Å; R82-R84 PolarHBondContact O-N 2.76Å; R82-A85 PolarHBondContact O-N 3.41Å; R82-A86 PolarHBondContact O-N 3.46Å
83	M	95.6	Very high	86.5	Confident	110 Å²	110	113.2 Å²	113.2	54%	0.542	57%	0.567	S	S	.	*	H	α-helix	trans	-61.9	-41.1	176.3	-71.9	178.2	65.2	0	0	111.6	K79 V80 A86 L87	K79-M83 HydrophobicContact CG-SD 4.28Å; K79-M83 WeakPolarHBondContact O-CG 3.37Å; K79-M83 PolarHBondContact O-N 3.43Å; V80-M83 PolarHBondContact O-N 2.93Å; M83-A86 PolarHBondContact O-N 3.26Å; M83-L87 WeakPolarHBondContact O-CG 3.46Å; M83-L87 PolarHBondContact O-N 3.47Å
84	R	93.9	Very high	84	Confident	163 Å²	163	115.5 Å²	115.5	62%	0.615	58%	0.575	S	S	*	*	H	α-helix	trans	-60.9	-47.4	175.4	-175.7	-179.7	-66.6	-171.9	-1.7	111.2	V80 K81 R82 L87 H88	V80-R84 WeakPolarHBondContact O-CB 3.36Å; V80-R84 PolarHBondContact O-N 3.06Å; K81-R84 PolarHBondContact O-N 3.31Å; R82-R84 VanDerWaalsContact C-N 3.32Å; R82-R84 PolarHBondContact O-N 2.76Å; R84-L87 PolarHBondContact O-N 3.02Å; R84-H88 PolarHBondContact O-N 3.42Å; R84-H88 PolarHBondContact O-ND1 2.99Å
85	A	92.9	Very high	81.6	Confident	47 Å²	47	122 Å²	122	39%	0.388	60%	0.604	S	S	.	*	H	α-helix	trans	-59.5	-47.4	177.5	0	0	0	0	0	111.7	K81 R82 L87 H88 E89	K81-A85 PolarHBondContact O-N 3.3Å; R82-A85 PolarHBondContact O-N 3.41Å; A85-L87 VanDerWaalsContact C-N 3.3Å; A85-L87 PolarHBondContact O-N 3.32Å; A85-H88 PolarHBondContact O-N 3.1Å; A85-E89 PolarHBondContact O-N 2.85Å
86	A	92	Very high	78.9	Confident	60 Å²	60	118.9 Å²	118.9	50%	0.496	61%	0.605	S	S	.	*	H	α-helix	trans	-60.7	-36.9	178.2	0	0	0	0	0	113.1	R82 M83 G90	R82-A86 PolarHBondContact O-N 3.46Å; M83-A86 PolarHBondContact O-N 3.26Å; A86-G90 PolarHBondContact O-N 3.45Å; A86-G90 VanDerWaalsContact O-N 3.16Å
87	L	90.3	Very high	76.1	Confident	122 Å²	122	120.8 Å²	120.8	64%	0.639	62%	0.619	S	S	*	*	H	α-helix	trans	-67.7	-38	174	-72.2	171.9	0	0	0	112.3	M83 R84 A85 G90 T91	M83-L87 WeakPolarHBondContact O-CG 3.46Å; M83-L87 PolarHBondContact O-N 3.47Å; R84-L87 PolarHBondContact O-N 3.02Å; A85-L87 VanDerWaalsContact C-N 3.3Å; A85-L87 PolarHBondContact O-N 3.32Å; L87-G90 PolarHBondContact O-N 3.31Å; L87-T91 WeakPolarHBondContact O-CG2 3.49Å; L87-T91 PolarHBondContact O-N 3.41Å; L87-T91 PolarHBondContact O-OG1 3.46Å
88	H	85.7	Confident	73.2	Confident	122 Å²	122	124.5 Å²	124.5	57%	0.565	64%	0.637	S	S	*	*	H	α-helix	trans	-72.6	-35.6	179.5	-72.9	62	0	0	0	112.1	R84 A85 G90 T91	R84-H88 PolarHBondContact O-N 3.42Å; R84-H88 PolarHBondContact O-ND1 2.99Å; A85-H88 PolarHBondContact O-N 3.1Å; H88-G90 VanDerWaalsContact C-N 3.33Å; H88-T91 WeakPolarHBondContact CA-OG1 3.33Å; H88-T91 PolarHBondContact O-N 3.16Å; H88-T91 PolarHBondContact O-OG1 3.32Å
89	E	74.3	Confident	70.8	Confident	154 Å²	154	122.9 Å²	122.9	72%	0.72	65%	0.647	S	S	*	*	H	α-helix	trans	-64.4	-37.4	172.4	-74.7	173.6	-171.1	0	0	111.5	A85 T91 S92	A85-E89 PolarHBondContact O-N 2.85Å; E89-T91 VanDerWaalsContact C-N 3.32Å; E89-T91 PolarHBondContact O-N 3.19Å; E89-S92 PolarHBondContact O-N 3.21Å
90	G	63.2	Low	68.4	Low	52 Å²	52	122.9 Å²	122.9	54%	0.536	66%	0.661	S	S	.	*	H	α-helix	trans	-72.6	-17.9	175.7	0	0	0	0	0	115.2	A86 L87 H88	A86-G90 PolarHBondContact O-N 3.45Å; A86-G90 VanDerWaalsContact O-N 3.16Å; L87-G90 PolarHBondContact O-N 3.31Å; H88-G90 VanDerWaalsContact C-N 3.33Å
91	T	53.9	Low	65.8	Low	109 Å²	109	123.6 Å²	123.6	67%	0.669	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.3	3.8	177.1	46.6	0	0	0	0	114.2	L87 H88 E89 L93	L87-T91 WeakPolarHBondContact O-CG2 3.49Å; L87-T91 PolarHBondContact O-N 3.41Å; L87-T91 PolarHBondContact O-OG1 3.46Å; H88-T91 WeakPolarHBondContact CA-OG1 3.33Å; H88-T91 PolarHBondContact O-N 3.16Å; H88-T91 PolarHBondContact O-OG1 3.32Å; E89-T91 VanDerWaalsContact C-N 3.32Å; E89-T91 PolarHBondContact O-N 3.19Å; T91-L93 VanDerWaalsContact C-N 3.25Å; T91-L93 PolarHBondContact O-N 3.06Å
92	S	53.1	Low	63.3	Low	104 Å²	104	128.7 Å²	128.7	73%	0.727	69%	0.69	S	S	*	*			trans	-91.5	35.6	175	-172.4	0	0	0	0	112.8	E89	E89-S92 PolarHBondContact O-N 3.21Å
93	L	50.2	Low	61	Low	131 Å²	131	125.7 Å²	125.7	69%	0.686	69%	0.694	S	S	*	*			trans	-115.5	121.5	171.7	-89.5	155.4	0	0	0	107.8	T91	T91-L93 VanDerWaalsContact C-N 3.25Å; T91-L93 PolarHBondContact O-N 3.06Å
94	E	45.9	Very low	58.8	Low	158 Å²	158	127.2 Å²	127.2	74%	0.738	71%	0.71	S	S	*	*			trans	88.7	67.1	169.5	-43.2	-52.7	139.1	0	0	118.1
95	E	47.5	Very low	56.4	Low	201 Å²	201	126.9 Å²	126.9	94%	0.939	72%	0.72	S	S	*	*	S	Bend		-115.7	114.6	129.3	-80.6	-172.8	170.6	0	0	107.4
96	G	40.4	Very low	54.1	Low	60 Å²	60	129 Å²	129	62%	0.619	74%	0.737	S	S	*	*			trans	-71.2	140.8	-156.3	0	0	0	0	0	116
97	E	39.6	Very low	51.8	Low	190 Å²	190	130.3 Å²	130.3	89%	0.888	75%	0.748	S	S	*	*			trans	-117.9	106.1	147	-103	-178.5	158.2	0	0	107.8	P99	E97-P99 WeakPolarHBondContact O-CD 3.16Å
98	H	36.8	Very low	49.6	Very low	180 Å²	180	131.5 Å²	131.5	83%	0.833	76%	0.755	S	S	*	*			trans	-63.9	119.5	175.9	-63.9	-91.5	0	0	0	111.3	S100	H98-S100 PolarHBondContact O-N 2.92Å
99	P	47.5	Very low	47.5	Very low	127 Å²	127	133.5 Å²	133.5	83%	0.825	77%	0.77	S	S	*	*			trans	-81.1	99.8	150	30.1	-28.2	0	0	0	107.8	E97 A101	E97-P99 WeakPolarHBondContact O-CD 3.16Å; P99-A101 PolarHBondContact O-N 2.97Å
100	S	45.8	Very low	46.2	Very low	109 Å²	109	131.1 Å²	131.1	76%	0.762	77%	0.771	S	S	*	*			trans	-48.1	129	166.5	-177	0	0	0	0	111.5	H98	H98-S100 PolarHBondContact O-N 2.92Å
101	A	42.5	Very low	45.6	Very low	90 Å²	90	134.2 Å²	134.2	74%	0.744	78%	0.779	S	S	*	*			trans	57.8	109.3	150.6	0	0	0	0	0	119.1	P99	P99-A101 PolarHBondContact O-N 2.97Å
102	R	43.6	Very low	45.3	Very low	235 Å²	235	134.6 Å²	134.6	89%	0.887	79%	0.786	S	S	*	*				-177.1	130.7	99.9	-167.3	170.5	-175.8	176.2	-0.1	110.3
103	P	45.7	Very low	44.7	Very low	116 Å²	116	136 Å²	136	75%	0.753	79%	0.79	S	S	*	*			trans	-80.6	132.3	-179.3	32.5	-30.4	0	0	0	109.6
104	T	49.7	Very low	44.1	Very low	142 Å²	142	134.6 Å²	134.6	87%	0.871	79%	0.791	S	S	*	*			trans	-110.6	115.1	161.1	-25.2	0	0	0	0	106.9
105	D	44.1	Very low	43.9	Very low	155 Å²	155	133.5 Å²	133.5	83%	0.829	80%	0.795	S	S	*	*			trans	-63.2	149.3	177.3	-93	-47	0	0	0	112.7
106	A	43.4	Very low	43.4	Very low	91 Å²	91	134.4 Å²	134.4	75%	0.752	79%	0.79	S	S	*	*			trans	84.1	123.3	145.1	0	0	0	0	0	120.7
107	A	44.3	Very low	43.6	Very low	89 Å²	89	139.3 Å²	139.3	74%	0.736	79%	0.794	S	S	*	*			trans	71.3	130.4	145.4	0	0	0	0	0	116.6
108	D	44.6	Very low	44	Very low	147 Å²	147	139.5 Å²	139.5	79%	0.786	80%	0.795	S	S	*	*			cis	-149.5	127.5	22.3	-98.1	-45.6	0	0	0	109.2	S110	D108-S110 PolarHBondContact O-N 3.35Å; D108-S110 VanDerWaalsContact O-N 3.13Å
109	N	42	Very low	44.2	Very low	164 Å²	164	140.2 Å²	140.2	88%	0.877	79%	0.79	S	S	*	*			trans	-78.8	91.1	168.4	-112.8	-3.4	0	0	0	108.5
110	S	46.4	Very low	44.1	Very low	104 Å²	104	137.7 Å²	137.7	73%	0.727	79%	0.787	S	S	*	*			trans	-114.5	81.9	165.5	-74.3	0	0	0	0	109.9	D108 S112	D108-S110 PolarHBondContact O-N 3.35Å; D108-S110 VanDerWaalsContact O-N 3.13Å; S110-S112 PolarHBondContact O-N 2.9Å; S110-S112 VanDerWaalsContact O-N 3.15Å
111	V	49.8	Very low	43.9	Very low	117 Å²	117	137.4 Å²	137.4	71%	0.709	78%	0.777	S	S	*	*			trans	-81.1	86.9	169.2	174.8	0	0	0	0	108.2	T113	V111-T113 HydrophobicContact CG1-CG2 3.96Å; V111-T113 PolarHBondContact O-N 3.27Å
112	S	48.6	Very low	44.1	Very low	117 Å²	117	142 Å²	142	82%	0.818	78%	0.783	S	S	*	*			trans	-76.9	94.2	163	-96.1	0	0	0	0	109	S110 S114	S110-S112 PolarHBondContact O-N 2.9Å; S110-S112 VanDerWaalsContact O-N 3.15Å; S112-S114 PolarHBondContact O-N 3.4Å
113	T	41	Very low	44.4	Very low	132 Å²	132	136 Å²	136	81%	0.81	78%	0.775	S	S	*	*			trans	-80.3	89.2	163.9	38.5	0	0	0	0	108.9	V111	V111-T113 HydrophobicContact CG1-CG2 3.96Å; V111-T113 PolarHBondContact O-N 3.27Å
114	S	38	Very low	44.5	Very low	102 Å²	102	138.4 Å²	138.4	71%	0.713	78%	0.78	S	S	*	*			trans	-160.8	111.1	160.3	-165.8	0	0	0	0	109.4	S112	S112-S114 PolarHBondContact O-N 3.4Å
115	V	40.4	Very low	44.7	Very low	135 Å²	135	137.3 Å²	137.3	82%	0.818	78%	0.776	S	S	*	*				-176	119.5	106.3	158.9	0	0	0	0	108.5
116	R	37	Very low	44.6	Very low	221 Å²	221	133 Å²	133	83%	0.834	77%	0.768	S	S	*	*			trans	-71.3	142.3	161.6	-172.4	-174	-174	175.5	2.9	108.9
117	K	43.9	Very low	44.8	Very low	162 Å²	162	136 Å²	136	70%	0.704	77%	0.771	S	S	*	*			trans	123.3	104.6	146.1	-67	-178.4	-178.7	-179.9	0	115.9
118	H	48.5	Very low	45	Very low	194 Å²	194	137.2 Å²	137.2	90%	0.898	78%	0.775	S	S	*	*				-146.3	114.5	126.6	-67.3	-74.8	0	0	0	103
119	R	41.1	Very low	45.1	Very low	196 Å²	196	135.1 Å²	135.1	74%	0.74	78%	0.777	S	S	*	*			cis	48.4	67	37	-151.5	178.1	-171.4	-165.7	-1.8	113.8	D121	R119-D121 HydrophobicContact CG-CB 4.4Å; R119-D121 IonicContact CZ-OD1 3.86Å; R119-D121 IonicContact CZ-OD2 2.65Å; R119-D121 VanDerWaalsContact CZ-OD2 3.24Å; R119-D121 VanDerWaalsContact NE-CG 3.27Å; R119-D121 IonicContact NE-OD1 2.97Å; R119-D121 PolarHBondContact NE-OD1 3.5Å; R119-D121 IonicContact NE-OD2 2.86Å; R119-D121 PolarHBondContact NE-OD2 3.22Å; R119-D121 IonicContact NH2-OD1 2.65Å; R119-D121 PolarHBondContact NH2-OD1 2.86Å; R119-D121 IonicContact NH2-OD2 2.96Å; R119-D121 PolarHBondContact NH2-OD2 2.97Å
120	G	45.3	Very low	45.5	Very low	74 Å²	74	131 Å²	131	76%	0.763	77%	0.766	S	S	*	*				-102.1	112.7	120	0	0	0	0	0	104.9
121	D	42.5	Very low	45.6	Very low	103 Å²	103	133.6 Å²	133.6	55%	0.551	77%	0.772	S	S	*	*				43.5	101	56	-73.4	-3.6	0	0	0	111.4	R119	R119-D121 HydrophobicContact CG-CB 4.4Å; R119-D121 IonicContact CZ-OD1 3.86Å; R119-D121 IonicContact CZ-OD2 2.65Å; R119-D121 VanDerWaalsContact CZ-OD2 3.24Å; R119-D121 VanDerWaalsContact NE-CG 3.27Å; R119-D121 IonicContact NE-OD1 2.97Å; R119-D121 PolarHBondContact NE-OD1 3.5Å; R119-D121 IonicContact NE-OD2 2.86Å; R119-D121 PolarHBondContact NE-OD2 3.22Å; R119-D121 IonicContact NH2-OD1 2.65Å; R119-D121 PolarHBondContact NH2-OD1 2.86Å; R119-D121 IonicContact NH2-OD2 2.96Å; R119-D121 PolarHBondContact NH2-OD2 2.97Å
122	E	47.2	Very low	45.8	Very low	185 Å²	185	133.5 Å²	133.5	86%	0.864	77%	0.767	S	S	*	*			trans	121.6	140.6	153.6	-71.2	-150	136.1	0	0	117.6
123	P	49.7	Very low	46.1	Very low	110 Å²	110	134 Å²	134	71%	0.714	77%	0.768	S	S	*	*				-124.3	161	-63	21.3	-0.7	0	0	0	111
124	L	47.4	Very low	46.6	Very low	166 Å²	166	135.2 Å²	135.2	87%	0.869	77%	0.765	S	S	*	*			trans	-66.1	131.9	171.5	-66.4	167.8	0	0	0	109.5	G126	L124-G126 VanDerWaalsContact C-N 3.28Å; L124-G126 PolarHBondContact O-N 3.23Å
125	P	54.1	Low	47	Very low	120 Å²	120	136.1 Å²	136.1	78%	0.779	77%	0.766	S	S	*	*			trans	-69.4	92.2	165.5	27.8	-30.9	0	0	0	108.5	N127	P125-N127 PolarHBondContact O-N 3.15Å; P125-N127 VanDerWaalsContact O-N 3.1Å
126	G	42.5	Very low	47.2	Very low	65 Å²	65	137.5 Å²	137.5	67%	0.67	77%	0.769	S	S	*	*			trans	-73.7	82.5	159.7	0	0	0	0	0	108.8	L124 S128	L124-G126 VanDerWaalsContact C-N 3.28Å; L124-G126 PolarHBondContact O-N 3.23Å; G126-S128 PolarHBondContact O-N 3.4Å; G126-S128 VanDerWaalsContact O-N 3.09Å
127	N	46.6	Very low	48	Very low	152 Å²	152	138.5 Å²	138.5	81%	0.813	79%	0.791	S	S	*	*			trans	-79.6	75	157	-87.4	30.2	0	0	0	107.7	P125 A129	P125-N127 PolarHBondContact O-N 3.15Å; P125-N127 VanDerWaalsContact O-N 3.1Å; N127-A129 PolarHBondContact O-N 3.26Å
128	S	47.9	Very low	48.2	Very low	116 Å²	116	137.4 Å²	137.4	81%	0.811	80%	0.795	S	S	*	*			trans	-71.9	83	153.5	-64.7	0	0	0	0	107	G126	G126-S128 PolarHBondContact O-N 3.4Å; G126-S128 VanDerWaalsContact O-N 3.09Å
129	A	47	Very low	48.2	Very low	102 Å²	102	134.4 Å²	134.4	84%	0.843	79%	0.79	S	S	*	*			trans	-102.3	74.2	157.3	0	0	0	0	0	106.4	N127	N127-A129 PolarHBondContact O-N 3.26Å
130	A	50.5	Low	48.5	Very low	77 Å²	77	130.9 Å²	130.9	64%	0.636	79%	0.792	S	S	*	*			trans	-130.5	145	162.7	0	0	0	0	0	105.5
131	D	48.4	Very low	48.7	Very low	159 Å²	159	134.3 Å²	134.3	85%	0.85	79%	0.794	S	S	*	*			trans	90.6	116.5	-168.6	-53.4	-17.9	0	0	0	113.1
132	D	53.7	Low	49.1	Very low	115 Å²	115	136.3 Å²	136.3	62%	0.615	81%	0.809	S	S	*	*			cis	-173.8	138.2	-2	-151.5	-15.9	0	0	0	107
133	P	56	Low	49.3	Very low	128 Å²	128	133 Å²	133	83%	0.831	81%	0.806	S	S	*	*			trans	-99.6	79.4	158.2	34.3	-27.1	0	0	0	110.3
134	E	51.7	Low	49.2	Very low	158 Å²	158	134.6 Å²	134.6	74%	0.738	81%	0.812	S	S	*	*			trans	-93.4	143.5	157.4	-89.4	-166.6	160.1	0	0	109
135	T	45.3	Very low	49.4	Very low	121 Å²	121	132.2 Å²	132.2	74%	0.742	81%	0.808	S	S	*	*			cis	-169.6	153.7	-21.2	13	0	0	0	0	103.6	N137	T135-N137 PolarHBondContact O-N 3.13Å
136	D	44.1	Very low	49	Very low	164 Å²	164	133.3 Å²	133.3	88%	0.877	81%	0.81	S	S	*	*			trans	-48	127.7	174.6	-82.3	-42.7	0	0	0	113.5
137	N	54	Low	49.6	Very low	242 Å²	242	139.5 Å²	139.5	100%	1.294	82%	0.823	S	S	*	*			trans	-154.2	0	140.9	-99.3	-21.3	0	0	0	109.6	T135	T135-N137 PolarHBondContact O-N 3.13Å

Retrieved 137 of 137 residues in 186.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).