A0A077ZJE9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJE9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 118 aa.

						>A0A077ZJE9_TRITR|A0A077ZJE9
MAKRVPYWQKYHSAERSFTIAAGLSVLNKSVANQRLKEVNRELVTELNVLKEEIAKSKAEIRQLENENVRTKNEIARLERQKRAKLSRHPVRTTVCGVVLPVSYVAFVIANRLSHRAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	76.7	Confident	241 Å²	241	148.6 Å²	148.6	100%	1.187	69%	0.689	S	S	*	*				0	113.2	0	-81.5	177.7	153.3	0	0	109.3	K3	M1-K3 PolarHBondContact O-N 2.84Å
2	A	64.3	Low	76.9	Confident	105 Å²	105	144.6 Å²	144.6	87%	0.868	67%	0.67	S	S	*	*			trans	-71.6	117.8	173.4	0	0	0	0	0	109.2	R4	A2-R4 PolarHBondContact O-N 3.44Å; A2-R4 VanDerWaalsContact O-N 3.08Å
3	K	74.3	Confident	77.4	Confident	201 Å²	201	138.8 Å²	138.8	87%	0.874	66%	0.656	S	S	*	*			trans	-63.3	111.2	174.4	-74.7	-177.5	178.4	179.1	0	108.2	M1 V5	M1-K3 PolarHBondContact O-N 2.84Å; K3-V5 PolarHBondContact O-N 2.98Å; K3-V5 VanDerWaalsContact O-N 3.14Å
4	R	79.2	Confident	77.8	Confident	249 Å²	249	133 Å²	133	94%	0.94	64%	0.643	S	S	*	*			trans	-66.2	112	176.1	-115.2	-171.6	-119	-148.9	0.5	108.3	A2	A2-R4 PolarHBondContact O-N 3.44Å; A2-R4 VanDerWaalsContact O-N 3.08Å
5	V	80.9	Confident	78.2	Confident	74 Å²	74	129.3 Å²	129.3	45%	0.448	62%	0.624	S	S	.	*			trans	-72.2	129.7	175.4	-155.1	0	0	0	0	108.5	K3 Q9	K3-V5 PolarHBondContact O-N 2.98Å; K3-V5 VanDerWaalsContact O-N 3.14Å; V5-Q9 HydrophobicContact CG1-CB 4.02Å; V5-Q9 HydrophobicContact CG1-CG 4.1Å
6	P	81.5	Confident	78.7	Confident	57 Å²	57	132.9 Å²	132.9	37%	0.37	63%	0.629	S	S	.	*			trans	-56	143	177.1	-24.3	33.2	0	0	0	112.1	W8 Q9 K10	P6-W8 VanDerWaalsContact C-N 3.26Å; P6-W8 HydrophobicContact CB-CD2 4.41Å; P6-W8 HydrophobicContact CB-CG 4.26Å; P6-W8 HydrophobicContact CB-CZ2 4.35Å; P6-W8 HydrophobicContact CG-CZ2 4.38Å; P6-W8 PolarHBondContact O-N 3.31Å; P6-Q9 WeakPolarHBondContact O-CB 2.93Å; P6-Q9 PolarHBondContact O-N 3.14Å; P6-K10 PolarHBondContact O-N 3.21Å
7	Y	83.4	Confident	79.2	Confident	190 Å²	190	129.1 Å²	129.1	75%	0.745	62%	0.62	S	S	*	*	H	α-helix	trans	-58	-37.2	-173.6	82.3	-89.2	0	0	0	113	Q9 K10 Y11	Y7-Q9 PolarHBondContact O-N 3.47Å; Y7-K10 WeakPolarHBondContact O-CB 3.47Å; Y7-K10 PolarHBondContact O-N 3.07Å; Y7-K10 VanDerWaalsContact O-N 3.14Å; Y7-Y11 PolarHBondContact O-N 2.94Å
8	W	83.5	Confident	79.6	Confident	140 Å²	140	130.7 Å²	130.7	53%	0.53	62%	0.624	S	S	.	*	H	α-helix	trans	-62.4	-31.9	179.8	60.1	-97.8	0	0	0	112.4	P6 Y11 H12	P6-W8 VanDerWaalsContact C-N 3.26Å; P6-W8 HydrophobicContact CB-CD2 4.41Å; P6-W8 HydrophobicContact CB-CG 4.26Å; P6-W8 HydrophobicContact CB-CZ2 4.35Å; P6-W8 HydrophobicContact CG-CZ2 4.38Å; P6-W8 PolarHBondContact O-N 3.31Å; W8-Y11 PolarHBondContact O-N 3.32Å; W8-H12 PolarHBondContact O-N 3.36Å
9	Q	86.5	Confident	80.2	Confident	98 Å²	98	128.9 Å²	128.9	46%	0.458	62%	0.623	S	S	.	*	H	α-helix	trans	-73.2	-35.9	177.6	-164.8	173.5	8	0	0	111.4	V5 P6 Y7 S13	V5-Q9 HydrophobicContact CG1-CB 4.02Å; V5-Q9 HydrophobicContact CG1-CG 4.1Å; P6-Q9 WeakPolarHBondContact O-CB 2.93Å; P6-Q9 PolarHBondContact O-N 3.14Å; Y7-Q9 PolarHBondContact O-N 3.47Å; Q9-S13 WeakPolarHBondContact O-CB 3.5Å; Q9-S13 PolarHBondContact O-N 3.08Å
10	K	82	Confident	80.7	Confident	138 Å²	138	127.9 Å²	127.9	60%	0.6	62%	0.619	S	S	*	*	H	α-helix	trans	-65.5	-43.5	171.3	-65.5	-175.9	-179.8	-176.6	0	111.3	P6 Y7 S13 A14	P6-K10 PolarHBondContact O-N 3.21Å; Y7-K10 WeakPolarHBondContact O-CB 3.47Å; Y7-K10 PolarHBondContact O-N 3.07Å; Y7-K10 VanDerWaalsContact O-N 3.14Å; K10-S13 WeakPolarHBondContact O-CB 3.44Å; K10-S13 PolarHBondContact O-N 3.18Å; K10-A14 PolarHBondContact O-N 3.26Å
11	Y	80.7	Confident	81.3	Confident	142 Å²	142	124.5 Å²	124.5	56%	0.557	61%	0.612	S	S	*	*	H	α-helix	trans	-61.5	-49.9	178.3	-176.9	-97.1	0	0	0	111.7	Y7 W8 S13 A14 E15	Y7-Y11 PolarHBondContact O-N 2.94Å; W8-Y11 PolarHBondContact O-N 3.32Å; Y11-S13 VanDerWaalsContact C-N 3.29Å; Y11-S13 PolarHBondContact O-N 2.94Å; Y11-A14 WeakPolarHBondContact O-CB 3.5Å; Y11-A14 PolarHBondContact O-N 3.38Å; Y11-A14 VanDerWaalsContact O-N 3.08Å; Y11-E15 HydrophobicContact CD1-CG 4.35Å; Y11-E15 HydrophobicContact CE1-CG 3.9Å; Y11-E15 WeakPolarHBondContact CE1-OE1 3.47Å; Y11-E15 PolarHBondContact O-N 3.08Å; Y11-E15 PolarHBondContact OH-OE1 3.14Å
12	H	79.3	Confident	83.5	Confident	100 Å²	100	115.1 Å²	115.1	46%	0.463	57%	0.573	S	S	.	*	H	α-helix	trans	-61.7	-34.5	174.2	-89.3	-38.1	0	0	0	113.5	W8 A14 E15 R16	W8-H12 PolarHBondContact O-N 3.36Å; H12-A14 VanDerWaalsContact C-N 3.34Å; H12-E15 IonicContact CE1-OE2 2.79Å; H12-E15 IonicContact ND1-OE2 3.36Å; H12-E15 PolarHBondContact ND1-OE2 3.47Å; H12-R16 WeakPolarHBondContact O-CB 3.38Å; H12-R16 VanDerWaalsContact O-CG 3.31Å; H12-R16 WeakPolarHBondContact O-CG 3.49Å; H12-R16 PolarHBondContact O-N 2.91Å
13	S	82.6	Confident	85	Confident	69 Å²	69	111.7 Å²	111.7	48%	0.483	55%	0.548	S	S	.	.	H	α-helix	trans	-65.5	-38.8	174.3	-171.9	0	0	0	0	111.8	Q9 K10 Y11 S17	Q9-S13 WeakPolarHBondContact O-CB 3.5Å; Q9-S13 PolarHBondContact O-N 3.08Å; K10-S13 WeakPolarHBondContact O-CB 3.44Å; K10-S13 PolarHBondContact O-N 3.18Å; Y11-S13 VanDerWaalsContact C-N 3.29Å; Y11-S13 PolarHBondContact O-N 2.94Å; S13-S17 WeakPolarHBondContact O-CB 3.23Å; S13-S17 PolarHBondContact O-N 2.95Å; S13-S17 PolarHBondContact O-OG 2.96Å
14	A	83.1	Confident	86	Confident	58 Å²	58	106.8 Å²	106.8	48%	0.479	53%	0.531	S	S	.	.	H	α-helix	trans	-67.6	-45.4	176.2	0	0	0	0	0	111.5	K10 Y11 H12 R16 S17 F18	K10-A14 PolarHBondContact O-N 3.26Å; Y11-A14 WeakPolarHBondContact O-CB 3.5Å; Y11-A14 PolarHBondContact O-N 3.38Å; Y11-A14 VanDerWaalsContact O-N 3.08Å; H12-A14 VanDerWaalsContact C-N 3.34Å; A14-R16 PolarHBondContact O-N 3.23Å; A14-S17 WeakPolarHBondContact O-CB 3.48Å; A14-S17 PolarHBondContact O-N 3.06Å; A14-F18 PolarHBondContact O-N 3.2Å
15	E	83.5	Confident	86.8	Confident	77 Å²	77	97.4 Å²	97.4	36%	0.36	50%	0.503	S	S	.	.	H	α-helix	trans	-59.1	-47.4	174.8	-74.1	-176.5	149.7	0	0	111.9	Y11 H12 S17 F18 T19	Y11-E15 HydrophobicContact CD1-CG 4.35Å; Y11-E15 HydrophobicContact CE1-CG 3.9Å; Y11-E15 WeakPolarHBondContact CE1-OE1 3.47Å; Y11-E15 PolarHBondContact O-N 3.08Å; Y11-E15 PolarHBondContact OH-OE1 3.14Å; H12-E15 IonicContact CE1-OE2 2.79Å; H12-E15 IonicContact ND1-OE2 3.36Å; H12-E15 PolarHBondContact ND1-OE2 3.47Å; E15-S17 VanDerWaalsContact C-N 3.29Å; E15-S17 PolarHBondContact O-N 2.94Å; E15-F18 PolarHBondContact O-N 3Å; E15-T19 PolarHBondContact O-N 3.02Å; E15-T19 PolarHBondContact O-OG1 3.25Å; E15-T19 VanDerWaalsContact O-OG1 3.06Å
16	R	86.3	Confident	87.5	Confident	188 Å²	188	98.3 Å²	98.3	71%	0.709	51%	0.509	S	S	*	.	H	α-helix	trans	-58.7	-43.3	175.5	-76.7	-178.2	-176.6	-154.1	1.4	111.5	H12 A14 T19 I20	H12-R16 WeakPolarHBondContact O-CB 3.38Å; H12-R16 VanDerWaalsContact O-CG 3.31Å; H12-R16 WeakPolarHBondContact O-CG 3.49Å; H12-R16 PolarHBondContact O-N 2.91Å; A14-R16 PolarHBondContact O-N 3.23Å; R16-T19 PolarHBondContact O-N 2.73Å; R16-I20 WeakPolarHBondContact O-CB 3.49Å; R16-I20 WeakPolarHBondContact O-CD1 3.31Å; R16-I20 VanDerWaalsContact O-CG1 3.23Å; R16-I20 WeakPolarHBondContact O-CG1 3.38Å; R16-I20 PolarHBondContact O-N 2.88Å
17	S	87.3	Confident	88.2	Confident	68 Å²	68	100.8 Å²	100.8	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-62.9	-42.7	178.6	-57.6	0	0	0	0	111.5	S13 A14 E15 I20 A21	S13-S17 WeakPolarHBondContact O-CB 3.23Å; S13-S17 PolarHBondContact O-N 2.95Å; S13-S17 PolarHBondContact O-OG 2.96Å; A14-S17 WeakPolarHBondContact O-CB 3.48Å; A14-S17 PolarHBondContact O-N 3.06Å; E15-S17 VanDerWaalsContact C-N 3.29Å; E15-S17 PolarHBondContact O-N 2.94Å; S17-I20 PolarHBondContact O-N 3.38Å; S17-A21 WeakPolarHBondContact O-CB 3.44Å; S17-A21 PolarHBondContact O-N 3.46Å
18	F	86.5	Confident	88.8	Confident	158 Å²	158	97.2 Å²	97.2	69%	0.693	51%	0.512	S	S	*	.	H	α-helix	trans	-62	-46.1	176.3	-176.5	-97.2	0	0	0	111.8	A14 E15 I20 A21 A22	A14-F18 PolarHBondContact O-N 3.2Å; E15-F18 PolarHBondContact O-N 3Å; F18-I20 PolarHBondContact O-N 3.49Å; F18-A21 PolarHBondContact O-N 2.94Å; F18-A22 WeakPolarHBondContact O-CB 3.44Å; F18-A22 PolarHBondContact O-N 2.7Å
19	T	90.5	Very high	89.4	Confident	96 Å²	96	97.2 Å²	97.2	59%	0.589	52%	0.516	S	S	*	.	H	α-helix	trans	-63.7	-40.5	178.2	-55.6	0	0	0	0	112.1	E15 R16 A22 G23	E15-T19 PolarHBondContact O-N 3.02Å; E15-T19 PolarHBondContact O-OG1 3.25Å; E15-T19 VanDerWaalsContact O-OG1 3.06Å; R16-T19 PolarHBondContact O-N 2.73Å; T19-A22 PolarHBondContact O-N 3.42Å; T19-G23 PolarHBondContact O-N 3.42Å
20	I	91.1	Very high	89.9	Confident	108 Å²	108	95.4 Å²	95.4	55%	0.554	51%	0.514	S	S	*	.	H	α-helix	trans	-62.1	-46.6	174.5	-69.5	164.8	0	0	0	110.3	R16 S17 F18 A22 G23 L24	R16-I20 WeakPolarHBondContact O-CB 3.49Å; R16-I20 WeakPolarHBondContact O-CD1 3.31Å; R16-I20 VanDerWaalsContact O-CG1 3.23Å; R16-I20 WeakPolarHBondContact O-CG1 3.38Å; R16-I20 PolarHBondContact O-N 2.88Å; S17-I20 PolarHBondContact O-N 3.38Å; F18-I20 PolarHBondContact O-N 3.49Å; I20-A22 PolarHBondContact O-N 2.96Å; I20-G23 PolarHBondContact O-N 3.47Å; I20-L24 HydrophobicContact CG2-CD1 3.96Å; I20-L24 HydrophobicContact CG2-CG 4.33Å; I20-L24 WeakPolarHBondContact O-CB 3.34Å; I20-L24 WeakPolarHBondContact O-CG 3.37Å; I20-L24 PolarHBondContact O-N 3.12Å
21	A	93.4	Very high	90.6	Very high	58 Å²	58	91.8 Å²	91.8	48%	0.479	50%	0.504	S	S	.	.	H	α-helix	trans	-61.7	-42.9	179	0	0	0	0	0	112.2	S17 F18 L24 S25	S17-A21 WeakPolarHBondContact O-CB 3.44Å; S17-A21 PolarHBondContact O-N 3.46Å; F18-A21 PolarHBondContact O-N 2.94Å; A21-L24 PolarHBondContact O-N 3.44Å; A21-S25 PolarHBondContact O-N 2.98Å
22	A	93.7	Very high	91.4	Very high	44 Å²	44	87.3 Å²	87.3	36%	0.364	50%	0.496	S	S	.	.	H	α-helix	trans	-61.1	-46.8	175.2	0	0	0	0	0	111.4	F18 T19 I20 S25 V26	F18-A22 WeakPolarHBondContact O-CB 3.44Å; F18-A22 PolarHBondContact O-N 2.7Å; T19-A22 PolarHBondContact O-N 3.42Å; I20-A22 PolarHBondContact O-N 2.96Å; A22-S25 WeakPolarHBondContact O-CB 3.33Å; A22-S25 PolarHBondContact O-N 2.88Å; A22-S25 VanDerWaalsContact O-N 3.17Å; A22-S25 PolarHBondContact O-OG 3.27Å; A22-V26 PolarHBondContact O-N 2.95Å; A22-V26 VanDerWaalsContact O-N 3.12Å
23	G	94.7	Very high	92.2	Very high	33 Å²	33	87 Å²	87	34%	0.34	50%	0.497	S	S	.	.	H	α-helix	trans	-59.4	-45.9	176.4	0	0	0	0	0	112.9	T19 I20 S25 V26 L27	T19-G23 PolarHBondContact O-N 3.42Å; I20-G23 PolarHBondContact O-N 3.47Å; G23-S25 VanDerWaalsContact C-N 3.29Å; G23-S25 PolarHBondContact O-N 2.98Å; G23-V26 PolarHBondContact O-N 3.38Å; G23-L27 WeakPolarHBondContact O-CG 3.43Å; G23-L27 PolarHBondContact O-N 3.2Å
24	L	95.6	Very high	92.9	Very high	97 Å²	97	89 Å²	89	51%	0.508	50%	0.499	S	S	.	.	H	α-helix	trans	-60.6	-38.1	174.8	-72.1	174.4	0	0	0	112.1	I20 A21 V26 L27 N28	I20-L24 HydrophobicContact CG2-CD1 3.96Å; I20-L24 HydrophobicContact CG2-CG 4.33Å; I20-L24 WeakPolarHBondContact O-CB 3.34Å; I20-L24 WeakPolarHBondContact O-CG 3.37Å; I20-L24 PolarHBondContact O-N 3.12Å; A21-L24 PolarHBondContact O-N 3.44Å; L24-V26 VanDerWaalsContact C-N 3.34Å; L24-V26 PolarHBondContact O-N 3.17Å; L24-L27 PolarHBondContact O-N 3.36Å; L24-N28 WeakPolarHBondContact O-CB 3.41Å; L24-N28 PolarHBondContact O-N 2.91Å
25	S	95.8	Very high	93.6	Very high	52 Å²	52	94.1 Å²	94.1	36%	0.364	51%	0.506	S	S	.	.	H	α-helix	trans	-63.6	-39.7	176.7	87.8	0	0	0	0	112.4	A21 A22 G23 K29	A21-S25 PolarHBondContact O-N 2.98Å; A22-S25 WeakPolarHBondContact O-CB 3.33Å; A22-S25 PolarHBondContact O-N 2.88Å; A22-S25 VanDerWaalsContact O-N 3.17Å; A22-S25 PolarHBondContact O-OG 3.27Å; G23-S25 VanDerWaalsContact C-N 3.29Å; G23-S25 PolarHBondContact O-N 2.98Å; S25-K29 WeakPolarHBondContact O-CG 3.36Å; S25-K29 PolarHBondContact O-N 3.41Å
26	V	96	Very high	94.2	Very high	94 Å²	94	95.9 Å²	95.9	57%	0.57	52%	0.518	S	S	*	.	H	α-helix	trans	-68.5	-44.9	178.2	173.1	0	0	0	0	110.2	A22 G23 L24 N28 K29 S30	A22-V26 PolarHBondContact O-N 2.95Å; A22-V26 VanDerWaalsContact O-N 3.12Å; G23-V26 PolarHBondContact O-N 3.38Å; L24-V26 VanDerWaalsContact C-N 3.34Å; L24-V26 PolarHBondContact O-N 3.17Å; V26-N28 PolarHBondContact O-N 2.94Å; V26-K29 PolarHBondContact O-N 3.29Å; V26-S30 PolarHBondContact O-N 2.9Å
27	L	95.7	Very high	94.8	Very high	108 Å²	108	93.6 Å²	93.6	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-60.4	-45.7	176	-70.9	172.4	0	0	0	111.4	G23 L24 K29 S30 V31	G23-L27 WeakPolarHBondContact O-CG 3.43Å; G23-L27 PolarHBondContact O-N 3.2Å; L24-L27 PolarHBondContact O-N 3.36Å; L27-K29 VanDerWaalsContact C-N 3.35Å; L27-K29 PolarHBondContact O-N 3.05Å; L27-S30 WeakPolarHBondContact O-CB 3.39Å; L27-S30 PolarHBondContact O-N 3.42Å; L27-S30 VanDerWaalsContact O-N 3.15Å; L27-V31 WeakPolarHBondContact O-CG2 3.5Å; L27-V31 PolarHBondContact O-N 3.15Å
28	N	97	Very high	95.3	Very high	116 Å²	116	95.6 Å²	95.6	62%	0.62	51%	0.514	S	S	*	.	H	α-helix	trans	-59.6	-43.4	176.3	-85.2	-4.2	0	0	0	112.4	L24 V26 V31 A32	L24-N28 WeakPolarHBondContact O-CB 3.41Å; L24-N28 PolarHBondContact O-N 2.91Å; V26-N28 PolarHBondContact O-N 2.94Å; N28-V31 PolarHBondContact O-N 3.43Å; N28-A32 WeakPolarHBondContact O-CB 3.41Å; N28-A32 PolarHBondContact O-N 3.37Å
29	K	96.8	Very high	95.8	Very high	140 Å²	140	91.5 Å²	91.5	61%	0.609	50%	0.502	S	S	*	.	H	α-helix	trans	-62.3	-42.2	174.9	-74	173.4	-177.2	176.8	0	111.8	S25 V26 L27 A32 N33	S25-K29 WeakPolarHBondContact O-CG 3.36Å; S25-K29 PolarHBondContact O-N 3.41Å; V26-K29 PolarHBondContact O-N 3.29Å; L27-K29 VanDerWaalsContact C-N 3.35Å; L27-K29 PolarHBondContact O-N 3.05Å; K29-A32 PolarHBondContact O-N 3.49Å; K29-N33 WeakPolarHBondContact O-CB 3.5Å; K29-N33 VanDerWaalsContact O-CG 3.28Å; K29-N33 PolarHBondContact O-N 2.89Å; K29-N33 PolarHBondContact O-ND2 3.45Å
30	S	96.6	Very high	96.2	Very high	59 Å²	59	91.8 Å²	91.8	41%	0.413	50%	0.5	S	S	.	.	H	α-helix	trans	-62.3	-46.6	177.8	-174.5	0	0	0	0	111.8	V26 L27 N33 Q34	V26-S30 PolarHBondContact O-N 2.9Å; L27-S30 WeakPolarHBondContact O-CB 3.39Å; L27-S30 PolarHBondContact O-N 3.42Å; L27-S30 VanDerWaalsContact O-N 3.15Å; S30-N33 PolarHBondContact O-N 3.05Å; S30-Q34 PolarHBondContact O-N 3.09Å
31	V	96.8	Very high	96.5	Very high	63 Å²	63	95.3 Å²	95.3	38%	0.382	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-43.4	177.6	172.9	0	0	0	0	110.9	L27 N28 N33 Q34 R35	L27-V31 WeakPolarHBondContact O-CG2 3.5Å; L27-V31 PolarHBondContact O-N 3.15Å; N28-V31 PolarHBondContact O-N 3.43Å; V31-N33 VanDerWaalsContact C-N 3.34Å; V31-N33 PolarHBondContact O-N 3.27Å; V31-Q34 PolarHBondContact O-N 3.45Å; V31-R35 WeakPolarHBondContact O-CG 3.46Å; V31-R35 PolarHBondContact O-N 3.27Å
32	A	96.6	Very high	96.7	Very high	47 Å²	47	97.9 Å²	97.9	39%	0.388	51%	0.509	S	S	.	.	H	α-helix	trans	-60.5	-42.8	175.4	0	0	0	0	0	112	N28 K29 Q34 R35 L36	N28-A32 WeakPolarHBondContact O-CB 3.41Å; N28-A32 PolarHBondContact O-N 3.37Å; K29-A32 PolarHBondContact O-N 3.49Å; A32-Q34 PolarHBondContact O-N 3.48Å; A32-R35 PolarHBondContact O-N 2.93Å; A32-L36 WeakPolarHBondContact O-CB 3.37Å; A32-L36 WeakPolarHBondContact O-CG 3.48Å; A32-L36 PolarHBondContact O-N 2.94Å
33	N	97.2	Very high	96.9	Very high	94 Å²	94	100.3 Å²	100.3	50%	0.503	52%	0.515	S	S	.	.	H	α-helix	trans	-65.6	-35.7	177	-76.5	-22.8	0	0	0	113	K29 S30 V31 K37	K29-N33 WeakPolarHBondContact O-CB 3.5Å; K29-N33 VanDerWaalsContact O-CG 3.28Å; K29-N33 PolarHBondContact O-N 2.89Å; K29-N33 PolarHBondContact O-ND2 3.45Å; S30-N33 PolarHBondContact O-N 3.05Å; V31-N33 VanDerWaalsContact C-N 3.34Å; V31-N33 PolarHBondContact O-N 3.27Å; N33-K37 WeakPolarHBondContact O-CG 3.23Å; N33-K37 PolarHBondContact O-N 3.05Å; N33-K37 VanDerWaalsContact O-N 3.09Å
34	Q	97.2	Very high	97	Very high	111 Å²	111	102.2 Å²	102.2	52%	0.519	52%	0.52	S	S	.	.	H	α-helix	trans	-64.7	-48.5	173.9	-78	176.9	-29.4	0	0	111.2	S30 V31 A32 L36 K37 E38	S30-Q34 PolarHBondContact O-N 3.09Å; V31-Q34 PolarHBondContact O-N 3.45Å; A32-Q34 PolarHBondContact O-N 3.48Å; Q34-L36 VanDerWaalsContact C-N 3.32Å; Q34-L36 PolarHBondContact O-N 3.4Å; Q34-K37 WeakPolarHBondContact O-CB 3.32Å; Q34-K37 PolarHBondContact O-N 2.97Å; Q34-E38 PolarHBondContact O-N 3.05Å
35	R	96.9	Very high	97.2	Very high	165 Å²	165	101.7 Å²	101.7	62%	0.623	52%	0.521	S	S	*	.	H	α-helix	trans	-58.9	-42.7	176.4	-70.8	178.8	176.7	-175.6	-1.5	112.3	V31 A32 K37 E38 V39	V31-R35 WeakPolarHBondContact O-CG 3.46Å; V31-R35 PolarHBondContact O-N 3.27Å; A32-R35 PolarHBondContact O-N 2.93Å; R35-K37 VanDerWaalsContact C-N 3.29Å; R35-K37 PolarHBondContact O-N 3.37Å; R35-E38 PolarHBondContact O-N 3.39Å; R35-V39 WeakPolarHBondContact O-CG2 3.19Å; R35-V39 PolarHBondContact O-N 3.01Å
36	L	97.5	Very high	97.3	Very high	115 Å²	115	104.7 Å²	104.7	60%	0.602	53%	0.529	S	S	*	.	H	α-helix	trans	-61.1	-38.2	175.4	-78.6	169.5	0	0	0	112.3	A32 Q34 N40	A32-L36 WeakPolarHBondContact O-CB 3.37Å; A32-L36 WeakPolarHBondContact O-CG 3.48Å; A32-L36 PolarHBondContact O-N 2.94Å; Q34-L36 VanDerWaalsContact C-N 3.32Å; Q34-L36 PolarHBondContact O-N 3.4Å; L36-N40 WeakPolarHBondContact O-CB 3.28Å; L36-N40 PolarHBondContact O-N 3.29Å
37	K	97.7	Very high	97.4	Very high	140 Å²	140	104.4 Å²	104.4	61%	0.609	52%	0.524	S	S	*	.	H	α-helix	trans	-67.4	-38.2	175.8	-74.7	174.3	-178.7	-177.9	0	112.2	N33 Q34 R35 R41	N33-K37 WeakPolarHBondContact O-CG 3.23Å; N33-K37 PolarHBondContact O-N 3.05Å; N33-K37 VanDerWaalsContact O-N 3.09Å; Q34-K37 WeakPolarHBondContact O-CB 3.32Å; Q34-K37 PolarHBondContact O-N 2.97Å; R35-K37 VanDerWaalsContact C-N 3.29Å; R35-K37 PolarHBondContact O-N 3.37Å; K37-R41 VanDerWaalsContact O-CG 3.28Å; K37-R41 WeakPolarHBondContact O-CG 3.41Å; K37-R41 PolarHBondContact O-N 3.01Å
38	E	97.5	Very high	97.5	Very high	109 Å²	109	102.9 Å²	102.9	51%	0.509	52%	0.516	S	S	.	.	H	α-helix	trans	-64.3	-53.5	176.5	-71.4	166	178.4	0	0	110.7	Q34 R35 N40 R41 E42	Q34-E38 PolarHBondContact O-N 3.05Å; R35-E38 PolarHBondContact O-N 3.39Å; E38-N40 VanDerWaalsContact C-N 3.29Å; E38-N40 PolarHBondContact O-N 2.93Å; E38-R41 WeakPolarHBondContact O-CB 3.42Å; E38-R41 PolarHBondContact O-N 3.22Å; E38-E42 PolarHBondContact O-N 3.01Å
39	V	97.9	Very high	97.5	Very high	72 Å²	72	100.9 Å²	100.9	44%	0.436	51%	0.508	S	S	.	.	H	α-helix	trans	-58.1	-41.9	176.8	173.9	0	0	0	0	111.2	R35 R41 E42 L43	R35-V39 WeakPolarHBondContact O-CG2 3.19Å; R35-V39 PolarHBondContact O-N 3.01Å; V39-R41 VanDerWaalsContact C-N 3.3Å; V39-R41 PolarHBondContact O-N 3Å; V39-E42 PolarHBondContact O-N 3.34Å; V39-L43 HydrophobicContact CG1-CD1 3.92Å; V39-L43 HydrophobicContact CG1-CG 4.26Å; V39-L43 WeakPolarHBondContact O-CB 3.32Å; V39-L43 VanDerWaalsContact O-CG 3.32Å; V39-L43 WeakPolarHBondContact O-CG 3.41Å; V39-L43 PolarHBondContact O-N 2.91Å
40	N	97.7	Very high	97.6	Very high	103 Å²	103	98.9 Å²	98.9	55%	0.551	50%	0.503	S	S	*	.	H	α-helix	trans	-65.2	-33.8	178.1	-166.6	36.5	0	0	0	112.4	L36 E38 V44	L36-N40 WeakPolarHBondContact O-CB 3.28Å; L36-N40 PolarHBondContact O-N 3.29Å; E38-N40 VanDerWaalsContact C-N 3.29Å; E38-N40 PolarHBondContact O-N 2.93Å; N40-V44 WeakPolarHBondContact O-CB 3.31Å; N40-V44 VanDerWaalsContact O-CG2 3.23Å; N40-V44 WeakPolarHBondContact O-CG2 3.15Å; N40-V44 PolarHBondContact O-N 2.95Å
41	R	97.8	Very high	97.7	Very high	182 Å²	182	102 Å²	102	69%	0.687	51%	0.51	S	S	*	.	H	α-helix	trans	-66.4	-45.5	173.8	-75.4	169.8	177.8	-178.9	-1.2	111.2	K37 E38 V39 V44 T45	K37-R41 VanDerWaalsContact O-CG 3.28Å; K37-R41 WeakPolarHBondContact O-CG 3.41Å; K37-R41 PolarHBondContact O-N 3.01Å; E38-R41 WeakPolarHBondContact O-CB 3.42Å; E38-R41 PolarHBondContact O-N 3.22Å; V39-R41 VanDerWaalsContact C-N 3.3Å; V39-R41 PolarHBondContact O-N 3Å; R41-V44 PolarHBondContact O-N 3.26Å; R41-T45 PolarHBondContact O-N 3.5Å; R41-T45 PolarHBondContact O-OG1 2.9Å
42	E	97.4	Very high	97.7	Very high	112 Å²	112	104.8 Å²	104.8	52%	0.523	52%	0.518	S	S	.	.	H	α-helix	trans	-59.3	-48.3	177.3	-70	171.6	-177.6	0	0	111.1	E38 V39 V44 T45 E46	E38-E42 PolarHBondContact O-N 3.01Å; V39-E42 PolarHBondContact O-N 3.34Å; E42-V44 VanDerWaalsContact C-N 3.33Å; E42-V44 PolarHBondContact O-N 3.27Å; E42-T45 VanDerWaalsContact C-OG1 3.31Å; E42-T45 VanDerWaalsContact CA-OG1 3.31Å; E42-T45 WeakPolarHBondContact CA-OG1 3.38Å; E42-T45 PolarHBondContact O-N 3.17Å; E42-T45 VanDerWaalsContact O-N 3.09Å; E42-T45 PolarHBondContact O-OG1 3.09Å; E42-E46 WeakPolarHBondContact O-CG 3.47Å; E42-E46 PolarHBondContact O-N 3.08Å
43	L	98.2	Very high	97.8	Very high	94 Å²	94	107.4 Å²	107.4	49%	0.492	52%	0.523	S	S	.	.	H	α-helix	trans	-61.4	-39.6	176.7	-71	174.4	0	0	0	112.6	V39 T45 E46 L47	V39-L43 HydrophobicContact CG1-CD1 3.92Å; V39-L43 HydrophobicContact CG1-CG 4.26Å; V39-L43 WeakPolarHBondContact O-CB 3.32Å; V39-L43 VanDerWaalsContact O-CG 3.32Å; V39-L43 WeakPolarHBondContact O-CG 3.41Å; V39-L43 PolarHBondContact O-N 2.91Å; L43-T45 VanDerWaalsContact C-N 3.33Å; L43-E46 PolarHBondContact O-N 3.42Å; L43-L47 WeakPolarHBondContact O-CB 3.49Å; L43-L47 PolarHBondContact O-N 2.88Å
44	V	98.2	Very high	97.8	Very high	73 Å²	73	107.3 Å²	107.3	44%	0.442	52%	0.521	S	S	.	.	H	α-helix	trans	-64.3	-40	175.1	166.4	0	0	0	0	111	N40 R41 E42 N48	N40-V44 WeakPolarHBondContact O-CB 3.31Å; N40-V44 VanDerWaalsContact O-CG2 3.23Å; N40-V44 WeakPolarHBondContact O-CG2 3.15Å; N40-V44 PolarHBondContact O-N 2.95Å; R41-V44 PolarHBondContact O-N 3.26Å; E42-V44 VanDerWaalsContact C-N 3.33Å; E42-V44 PolarHBondContact O-N 3.27Å; V44-N48 VanDerWaalsContact O-CG 3.28Å; V44-N48 PolarHBondContact O-N 2.96Å; V44-N48 VanDerWaalsContact O-N 3.09Å; V44-N48 PolarHBondContact O-ND2 3.37Å
45	T	97.9	Very high	97.8	Very high	86 Å²	86	104.8 Å²	104.8	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-65.7	-46.8	176.2	44.9	0	0	0	0	112.3	R41 E42 L43 L47 N48 V49	R41-T45 PolarHBondContact O-N 3.5Å; R41-T45 PolarHBondContact O-OG1 2.9Å; E42-T45 VanDerWaalsContact C-OG1 3.31Å; E42-T45 VanDerWaalsContact CA-OG1 3.31Å; E42-T45 WeakPolarHBondContact CA-OG1 3.38Å; E42-T45 PolarHBondContact O-N 3.17Å; E42-T45 VanDerWaalsContact O-N 3.09Å; E42-T45 PolarHBondContact O-OG1 3.09Å; L43-T45 VanDerWaalsContact C-N 3.33Å; T45-L47 VanDerWaalsContact C-N 3.32Å; T45-L47 PolarHBondContact O-N 3.09Å; T45-N48 PolarHBondContact O-N 3.17Å; T45-N48 VanDerWaalsContact O-N 3.17Å; T45-V49 WeakPolarHBondContact O-CG2 3.31Å; T45-V49 PolarHBondContact O-N 3.31Å
46	E	98	Very high	97.9	Very high	116 Å²	116	103.7 Å²	103.7	54%	0.542	52%	0.519	S	S	.	.	H	α-helix	trans	-60.2	-42.9	176.4	-72.4	179.2	-171.5	0	0	111.7	E42 L43 N48 V49 L50	E42-E46 WeakPolarHBondContact O-CG 3.47Å; E42-E46 PolarHBondContact O-N 3.08Å; L43-E46 PolarHBondContact O-N 3.42Å; E46-N48 VanDerWaalsContact C-N 3.27Å; E46-N48 PolarHBondContact O-N 3.03Å; E46-V49 PolarHBondContact O-N 2.64Å; E46-L50 WeakPolarHBondContact O-CG 3.23Å; E46-L50 PolarHBondContact O-N 2.92Å
47	L	98.1	Very high	97.9	Very high	88 Å²	88	101 Å²	101	46%	0.461	51%	0.511	S	S	.	.	H	α-helix	trans	-62.4	-35.4	178	-174.7	149.7	0	0	0	112	L43 T45 K51	L43-L47 WeakPolarHBondContact O-CB 3.49Å; L43-L47 PolarHBondContact O-N 2.88Å; T45-L47 VanDerWaalsContact C-N 3.32Å; T45-L47 PolarHBondContact O-N 3.09Å; L47-K51 HydrophobicContact CD2-CD 3.84Å; L47-K51 HydrophobicContact CD2-CG 4.45Å; L47-K51 VanDerWaalsContact CD2-NZ 3.28Å; L47-K51 VanDerWaalsContact O-CG 3.31Å; L47-K51 WeakPolarHBondContact O-CG 3.47Å; L47-K51 PolarHBondContact O-N 3.27Å; L47-K51 VanDerWaalsContact O-N 3.08Å
48	N	98.1	Very high	97.9	Very high	75 Å²	75	100.3 Å²	100.3	40%	0.401	51%	0.507	S	S	.	.	H	α-helix	trans	-70.6	-41.9	175	-71.9	-25.2	0	0	0	112	V44 T45 E46 L50 K51 E52	V44-N48 VanDerWaalsContact O-CG 3.28Å; V44-N48 PolarHBondContact O-N 2.96Å; V44-N48 VanDerWaalsContact O-N 3.09Å; V44-N48 PolarHBondContact O-ND2 3.37Å; T45-N48 PolarHBondContact O-N 3.17Å; T45-N48 VanDerWaalsContact O-N 3.17Å; E46-N48 VanDerWaalsContact C-N 3.27Å; E46-N48 PolarHBondContact O-N 3.03Å; N48-L50 PolarHBondContact O-N 3.43Å; N48-K51 WeakPolarHBondContact O-CB 3.42Å; N48-K51 PolarHBondContact O-N 3.48Å; N48-E52 PolarHBondContact O-N 3.2Å
49	V	98	Very high	97.9	Very high	75 Å²	75	98 Å²	98	46%	0.455	51%	0.507	S	S	.	.	H	α-helix	trans	-58.6	-48.7	174.5	172.7	0	0	0	0	110.6	T45 E46 K51 E52 E53	T45-V49 WeakPolarHBondContact O-CG2 3.31Å; T45-V49 PolarHBondContact O-N 3.31Å; E46-V49 PolarHBondContact O-N 2.64Å; V49-K51 VanDerWaalsContact C-N 3.3Å; V49-K51 PolarHBondContact O-N 2.91Å; V49-E52 WeakPolarHBondContact O-CB 3.41Å; V49-E52 PolarHBondContact O-N 3.1Å; V49-E52 VanDerWaalsContact O-N 3.1Å; V49-E53 HydrophobicContact CG1-CG 4.48Å; V49-E53 WeakPolarHBondContact O-CG 3.46Å; V49-E53 PolarHBondContact O-N 3.2Å
50	L	98.2	Very high	97.9	Very high	97 Å²	97	100.2 Å²	100.2	51%	0.508	51%	0.512	S	S	.	.	H	α-helix	trans	-61.6	-37.2	178.4	-71.5	172.6	0	0	0	112.5	E46 N48 E52 E53 I54	E46-L50 WeakPolarHBondContact O-CG 3.23Å; E46-L50 PolarHBondContact O-N 2.92Å; N48-L50 PolarHBondContact O-N 3.43Å; L50-E52 VanDerWaalsContact C-N 3.34Å; L50-E53 PolarHBondContact O-N 3.33Å; L50-I54 WeakPolarHBondContact O-CB 3.47Å; L50-I54 VanDerWaalsContact O-CG1 3.23Å; L50-I54 WeakPolarHBondContact O-CG1 3.46Å; L50-I54 PolarHBondContact O-N 3.24Å
51	K	98.1	Very high	98	Very high	126 Å²	126	99.8 Å²	99.8	55%	0.548	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-41.8	174.1	-80.9	174.4	175.1	170	0	112.1	L47 N48 V49 A55	L47-K51 HydrophobicContact CD2-CD 3.84Å; L47-K51 HydrophobicContact CD2-CG 4.45Å; L47-K51 VanDerWaalsContact CD2-NZ 3.28Å; L47-K51 VanDerWaalsContact O-CG 3.31Å; L47-K51 WeakPolarHBondContact O-CG 3.47Å; L47-K51 PolarHBondContact O-N 3.27Å; L47-K51 VanDerWaalsContact O-N 3.08Å; N48-K51 WeakPolarHBondContact O-CB 3.42Å; N48-K51 PolarHBondContact O-N 3.48Å; V49-K51 VanDerWaalsContact C-N 3.3Å; V49-K51 PolarHBondContact O-N 2.91Å; K51-A55 WeakPolarHBondContact O-CB 3.48Å; K51-A55 PolarHBondContact O-N 3.03Å
52	E	97.9	Very high	98	Very high	120 Å²	120	99.2 Å²	99.2	56%	0.561	51%	0.507	S	S	*	.	H	α-helix	trans	-66.5	-42.5	176.8	-71.3	-179.3	-172.8	0	0	111.9	N48 V49 L50 A55 K56	N48-E52 PolarHBondContact O-N 3.2Å; V49-E52 WeakPolarHBondContact O-CB 3.41Å; V49-E52 PolarHBondContact O-N 3.1Å; V49-E52 VanDerWaalsContact O-N 3.1Å; L50-E52 VanDerWaalsContact C-N 3.34Å; E52-A55 WeakPolarHBondContact O-CB 3.37Å; E52-A55 PolarHBondContact O-N 3.24Å; E52-K56 WeakPolarHBondContact O-CG 3.29Å; E52-K56 PolarHBondContact O-N 3.35Å
53	E	98.1	Very high	98	Very high	102 Å²	102	99.3 Å²	99.3	48%	0.477	51%	0.507	S	S	.	.	H	α-helix	trans	-61.2	-46.5	175.4	-72.2	-178.7	172.8	0	0	111.5	V49 L50 A55 K56 S57	V49-E53 HydrophobicContact CG1-CG 4.48Å; V49-E53 WeakPolarHBondContact O-CG 3.46Å; V49-E53 PolarHBondContact O-N 3.2Å; L50-E53 PolarHBondContact O-N 3.33Å; E53-A55 VanDerWaalsContact C-N 3.26Å; E53-A55 PolarHBondContact O-N 2.98Å; E53-K56 PolarHBondContact O-N 3.06Å; E53-K56 VanDerWaalsContact O-N 3.14Å; E53-S57 PolarHBondContact O-N 2.88Å; E53-S57 PolarHBondContact O-OG 2.93Å
54	I	97.8	Very high	98	Very high	92 Å²	92	99.3 Å²	99.3	47%	0.472	51%	0.507	S	S	.	.	H	α-helix	trans	-58.8	-39.6	174.9	-71.8	167.9	0	0	0	111.1	L50 K58	L50-I54 WeakPolarHBondContact O-CB 3.47Å; L50-I54 VanDerWaalsContact O-CG1 3.23Å; L50-I54 WeakPolarHBondContact O-CG1 3.46Å; L50-I54 PolarHBondContact O-N 3.24Å; I54-K58 HydrophobicContact CG2-CD 4.14Å; I54-K58 WeakPolarHBondContact O-CB 3.41Å; I54-K58 VanDerWaalsContact O-CG 3.29Å; I54-K58 WeakPolarHBondContact O-CG 3.5Å; I54-K58 PolarHBondContact O-N 3.05Å
55	A	97.8	Very high	98	Very high	59 Å²	59	101.4 Å²	101.4	49%	0.488	51%	0.512	S	S	.	.	H	α-helix	trans	-65.3	-42.4	177.4	0	0	0	0	0	111.9	K51 E52 E53 K58 A59	K51-A55 WeakPolarHBondContact O-CB 3.48Å; K51-A55 PolarHBondContact O-N 3.03Å; E52-A55 WeakPolarHBondContact O-CB 3.37Å; E52-A55 PolarHBondContact O-N 3.24Å; E53-A55 VanDerWaalsContact C-N 3.26Å; E53-A55 PolarHBondContact O-N 2.98Å; A55-K58 PolarHBondContact O-N 3.09Å; A55-A59 PolarHBondContact O-N 3.15Å; A55-A59 VanDerWaalsContact O-N 3.09Å
56	K	97.7	Very high	98	Very high	141 Å²	141	102.1 Å²	102.1	61%	0.613	51%	0.513	S	S	*	.	H	α-helix	trans	-62.3	-49.1	175.1	-71	172.5	-174.5	170.1	0	111.4	E52 E53 K58 A59 E60	E52-K56 WeakPolarHBondContact O-CG 3.29Å; E52-K56 PolarHBondContact O-N 3.35Å; E53-K56 PolarHBondContact O-N 3.06Å; E53-K56 VanDerWaalsContact O-N 3.14Å; K56-K58 VanDerWaalsContact C-N 3.31Å; K56-K58 PolarHBondContact O-N 2.98Å; K56-A59 WeakPolarHBondContact O-CB 3.4Å; K56-A59 PolarHBondContact O-N 3.14Å; K56-E60 PolarHBondContact O-N 3.42Å
57	S	98	Very high	97.9	Very high	60 Å²	60	100.5 Å²	100.5	42%	0.42	51%	0.505	S	S	.	.	H	α-helix	trans	-61.4	-38.4	178.1	-59.4	0	0	0	0	112.3	E53 A59 E60 I61	E53-S57 PolarHBondContact O-N 2.88Å; E53-S57 PolarHBondContact O-OG 2.93Å; S57-A59 VanDerWaalsContact C-N 3.31Å; S57-A59 PolarHBondContact O-N 3.22Å; S57-E60 PolarHBondContact O-N 3.14Å; S57-I61 VanDerWaalsContact O-CG1 3.28Å; S57-I61 WeakPolarHBondContact O-CG1 3.28Å; S57-I61 PolarHBondContact O-N 3.23Å
58	K	98.1	Very high	97.9	Very high	125 Å²	125	100.1 Å²	100.1	54%	0.543	50%	0.504	S	S	.	.	H	α-helix	trans	-63.1	-37	173.8	-78.2	176.5	178.5	178.2	0	112.6	I54 A55 K56 R62	I54-K58 HydrophobicContact CG2-CD 4.14Å; I54-K58 WeakPolarHBondContact O-CB 3.41Å; I54-K58 VanDerWaalsContact O-CG 3.29Å; I54-K58 WeakPolarHBondContact O-CG 3.5Å; I54-K58 PolarHBondContact O-N 3.05Å; A55-K58 PolarHBondContact O-N 3.09Å; K56-K58 VanDerWaalsContact C-N 3.31Å; K56-K58 PolarHBondContact O-N 2.98Å; K58-R62 WeakPolarHBondContact O-CG 3.47Å; K58-R62 PolarHBondContact O-N 2.94Å
59	A	97.8	Very high	97.9	Very high	60 Å²	60	100.4 Å²	100.4	50%	0.496	51%	0.508	S	S	.	.	H	α-helix	trans	-67.5	-42.9	176.1	0	0	0	0	0	111.5	A55 K56 S57 R62 Q63	A55-A59 PolarHBondContact O-N 3.15Å; A55-A59 VanDerWaalsContact O-N 3.09Å; K56-A59 WeakPolarHBondContact O-CB 3.4Å; K56-A59 PolarHBondContact O-N 3.14Å; S57-A59 VanDerWaalsContact C-N 3.31Å; S57-A59 PolarHBondContact O-N 3.22Å; A59-R62 PolarHBondContact O-N 2.93Å; A59-Q63 PolarHBondContact O-N 3.34Å
60	E	98	Very high	97.9	Very high	119 Å²	119	105.9 Å²	105.9	56%	0.556	52%	0.52	S	S	*	.	H	α-helix	trans	-63	-44.1	177	-172.9	174.7	-170	0	0	112.1	K56 S57 R62 Q63 L64	K56-E60 PolarHBondContact O-N 3.42Å; S57-E60 PolarHBondContact O-N 3.14Å; E60-R62 VanDerWaalsContact C-N 3.32Å; E60-R62 PolarHBondContact O-N 3.1Å; E60-Q63 WeakPolarHBondContact O-CB 3.41Å; E60-Q63 PolarHBondContact O-N 3.37Å; E60-Q63 VanDerWaalsContact O-N 3.1Å; E60-L64 HydrophobicContact CG-CD1 4.3Å; E60-L64 WeakPolarHBondContact O-CG 3.32Å; E60-L64 PolarHBondContact O-N 3.3Å
61	I	97.9	Very high	97.9	Very high	93 Å²	93	105 Å²	105	48%	0.477	52%	0.52	S	S	.	.	H	α-helix	trans	-56.6	-46.9	174.8	-71.5	166.4	0	0	0	110.7	S57 Q63 L64 E65	S57-I61 VanDerWaalsContact O-CG1 3.28Å; S57-I61 WeakPolarHBondContact O-CG1 3.28Å; S57-I61 PolarHBondContact O-N 3.23Å; I61-Q63 VanDerWaalsContact C-N 3.29Å; I61-Q63 PolarHBondContact O-N 3.36Å; I61-L64 PolarHBondContact O-N 2.86Å; I61-E65 HydrophobicContact CG2-CG 4.34Å; I61-E65 VanDerWaalsContact O-CG 3.32Å; I61-E65 WeakPolarHBondContact O-CG 3.44Å; I61-E65 PolarHBondContact O-N 2.93Å
62	R	97.8	Very high	97.9	Very high	171 Å²	171	105.3 Å²	105.3	65%	0.645	52%	0.521	S	S	*	.	H	α-helix	trans	-62.3	-36.6	178	-72.9	174.5	-179.6	-179	0.3	112.4	K58 A59 E60 N66	K58-R62 WeakPolarHBondContact O-CG 3.47Å; K58-R62 PolarHBondContact O-N 2.94Å; A59-R62 PolarHBondContact O-N 2.93Å; E60-R62 VanDerWaalsContact C-N 3.32Å; E60-R62 PolarHBondContact O-N 3.1Å; R62-N66 VanDerWaalsContact O-CG 3.32Å; R62-N66 PolarHBondContact O-N 3.05Å; R62-N66 VanDerWaalsContact O-N 3.14Å; R62-N66 PolarHBondContact O-ND2 3.37Å; R62-N66 VanDerWaalsContact O-ND2 3.08Å
63	Q	97.9	Very high	97.9	Very high	113 Å²	113	104.5 Å²	104.5	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-64.8	-48.5	175.5	-175.7	-177.6	-24.5	0	0	110.7	A59 E60 I61 E65 N66 E67	A59-Q63 PolarHBondContact O-N 3.34Å; E60-Q63 WeakPolarHBondContact O-CB 3.41Å; E60-Q63 PolarHBondContact O-N 3.37Å; E60-Q63 VanDerWaalsContact O-N 3.1Å; I61-Q63 VanDerWaalsContact C-N 3.29Å; I61-Q63 PolarHBondContact O-N 3.36Å; Q63-E65 VanDerWaalsContact C-N 3.32Å; Q63-E65 PolarHBondContact O-N 3.08Å; Q63-N66 WeakPolarHBondContact O-CB 3.45Å; Q63-N66 PolarHBondContact O-N 3.43Å; Q63-N66 VanDerWaalsContact O-N 3.15Å; Q63-E67 WeakPolarHBondContact CG-OE1 3.4Å; Q63-E67 PolarHBondContact NE2-OE1 2.96Å; Q63-E67 WeakPolarHBondContact O-CG 3.06Å; Q63-E67 PolarHBondContact O-N 3.37Å
64	L	98.1	Very high	97.8	Very high	95 Å²	95	103.1 Å²	103.1	50%	0.497	51%	0.514	S	S	.	.	H	α-helix	trans	-62.2	-37.7	178.2	-70.6	171.5	0	0	0	112.3	E60 I61 E67 N68	E60-L64 HydrophobicContact CG-CD1 4.3Å; E60-L64 WeakPolarHBondContact O-CG 3.32Å; E60-L64 PolarHBondContact O-N 3.3Å; I61-L64 PolarHBondContact O-N 2.86Å; L64-E67 PolarHBondContact O-N 3.44Å; L64-N68 VanDerWaalsContact O-CB 3.27Å; L64-N68 WeakPolarHBondContact O-CB 3.41Å; L64-N68 PolarHBondContact O-N 3.38Å
65	E	98.2	Very high	97.8	Very high	116 Å²	116	102.8 Å²	102.8	54%	0.542	51%	0.512	S	S	.	.	H	α-helix	trans	-60.6	-44.8	173.5	-75.7	175.1	155.4	0	0	111.5	I61 Q63 N68 V69	I61-E65 HydrophobicContact CG2-CG 4.34Å; I61-E65 VanDerWaalsContact O-CG 3.32Å; I61-E65 WeakPolarHBondContact O-CG 3.44Å; I61-E65 PolarHBondContact O-N 2.93Å; Q63-E65 VanDerWaalsContact C-N 3.32Å; Q63-E65 PolarHBondContact O-N 3.08Å; E65-N68 WeakPolarHBondContact O-CB 3.46Å; E65-N68 PolarHBondContact O-N 2.98Å; E65-V69 WeakPolarHBondContact O-CG2 3.27Å; E65-V69 PolarHBondContact O-N 2.85Å
66	N	97.7	Very high	97.8	Very high	101 Å²	101	101.4 Å²	101.4	54%	0.54	50%	0.5	S	S	.	.	H	α-helix	trans	-64.6	-42.1	176.8	-73.7	-37	0	0	0	112.2	R62 Q63 N68 V69 R70	R62-N66 VanDerWaalsContact O-CG 3.32Å; R62-N66 PolarHBondContact O-N 3.05Å; R62-N66 VanDerWaalsContact O-N 3.14Å; R62-N66 PolarHBondContact O-ND2 3.37Å; R62-N66 VanDerWaalsContact O-ND2 3.08Å; Q63-N66 WeakPolarHBondContact O-CB 3.45Å; Q63-N66 PolarHBondContact O-N 3.43Å; Q63-N66 VanDerWaalsContact O-N 3.15Å; N66-N68 VanDerWaalsContact C-N 3.32Å; N66-V69 PolarHBondContact O-N 3.4Å; N66-R70 WeakPolarHBondContact O-CG 3.38Å; N66-R70 PolarHBondContact O-N 2.92Å
67	E	97.7	Very high	97.8	Very high	82 Å²	82	100.4 Å²	100.4	38%	0.383	49%	0.493	S	S	.	.	H	α-helix	trans	-63.3	-39.2	175.2	-72.7	175.7	-167.1	0	0	111.7	Q63 L64 R70 T71	Q63-E67 WeakPolarHBondContact CG-OE1 3.4Å; Q63-E67 PolarHBondContact NE2-OE1 2.96Å; Q63-E67 WeakPolarHBondContact O-CG 3.06Å; Q63-E67 PolarHBondContact O-N 3.37Å; L64-E67 PolarHBondContact O-N 3.44Å; E67-R70 PolarHBondContact O-N 3.44Å; E67-T71 WeakPolarHBondContact O-CB 3.46Å; E67-T71 PolarHBondContact O-N 2.93Å; E67-T71 PolarHBondContact O-OG1 2.9Å
68	N	97.7	Very high	97.8	Very high	81 Å²	81	101.6 Å²	101.6	43%	0.433	49%	0.494	S	S	.	.	H	α-helix	trans	-63.8	-44.4	176	-167	-38.4	0	0	0	111.3	L64 E65 N66 R70 T71 K72	L64-N68 VanDerWaalsContact O-CB 3.27Å; L64-N68 WeakPolarHBondContact O-CB 3.41Å; L64-N68 PolarHBondContact O-N 3.38Å; E65-N68 WeakPolarHBondContact O-CB 3.46Å; E65-N68 PolarHBondContact O-N 2.98Å; N66-N68 VanDerWaalsContact C-N 3.32Å; N68-R70 PolarHBondContact O-N 3.31Å; N68-T71 PolarHBondContact O-N 3.21Å; N68-K72 WeakPolarHBondContact O-CB 3.4Å; N68-K72 WeakPolarHBondContact O-CG 3.4Å; N68-K72 PolarHBondContact O-N 3.3Å; N68-K72 WeakPolarHBondContact OD1-CD 3.42Å; N68-K72 WeakPolarHBondContact OD1-CE 3.46Å; N68-K72 PolarHBondContact OD1-NZ 3.43Å
69	V	98.1	Very high	97.7	Very high	80 Å²	80	100.1 Å²	100.1	49%	0.485	49%	0.489	S	S	.	.	H	α-helix	trans	-60.4	-46.3	174.5	171.5	0	0	0	0	111.2	E65 N66 T71 K72 N73	E65-V69 WeakPolarHBondContact O-CG2 3.27Å; E65-V69 PolarHBondContact O-N 2.85Å; N66-V69 PolarHBondContact O-N 3.4Å; V69-T71 VanDerWaalsContact C-N 3.32Å; V69-T71 PolarHBondContact O-N 3.37Å; V69-K72 PolarHBondContact O-N 2.99Å; V69-N73 WeakPolarHBondContact O-CB 3.5Å; V69-N73 VanDerWaalsContact O-CG 3.29Å; V69-N73 PolarHBondContact O-N 2.93Å; V69-N73 PolarHBondContact O-ND2 3.49Å
70	R	97.4	Very high	97.6	Very high	190 Å²	190	105.6 Å²	105.6	72%	0.717	50%	0.497	S	S	*	.	H	α-helix	trans	-58.9	-44.9	176.1	-73.2	176.4	-180	-174.9	1.9	111.6	N66 E67 N68 N73 E74	N66-R70 WeakPolarHBondContact O-CG 3.38Å; N66-R70 PolarHBondContact O-N 2.92Å; E67-R70 PolarHBondContact O-N 3.44Å; N68-R70 PolarHBondContact O-N 3.31Å; R70-N73 PolarHBondContact O-N 2.86Å; R70-E74 PolarHBondContact O-N 2.77Å
71	T	97.7	Very high	97.4	Very high	80 Å²	80	103.6 Å²	103.6	49%	0.491	49%	0.488	S	S	.	.	H	α-helix	trans	-64.4	-44.6	179.7	-56.4	0	0	0	0	111.4	E67 N68 V69 N73 E74 I75	E67-T71 WeakPolarHBondContact O-CB 3.46Å; E67-T71 PolarHBondContact O-N 2.93Å; E67-T71 PolarHBondContact O-OG1 2.9Å; N68-T71 PolarHBondContact O-N 3.21Å; V69-T71 VanDerWaalsContact C-N 3.32Å; V69-T71 PolarHBondContact O-N 3.37Å; T71-N73 VanDerWaalsContact C-N 3.33Å; T71-N73 PolarHBondContact O-N 2.86Å; T71-E74 PolarHBondContact O-N 3.34Å; T71-I75 HydrophobicContact CG2-CD1 4.02Å; T71-I75 VanDerWaalsContact O-CG1 3.31Å; T71-I75 WeakPolarHBondContact O-CG1 3.5Å; T71-I75 PolarHBondContact O-N 3.41Å
72	K	97.9	Very high	97.1	Very high	131 Å²	131	105.9 Å²	105.9	57%	0.57	49%	0.494	S	S	*	.	H	α-helix	trans	-60.2	-42.4	174.9	-77.4	174.4	174	168.8	0	112.1	N68 V69 E74 I75 A76	N68-K72 WeakPolarHBondContact O-CB 3.4Å; N68-K72 WeakPolarHBondContact O-CG 3.4Å; N68-K72 PolarHBondContact O-N 3.3Å; N68-K72 WeakPolarHBondContact OD1-CD 3.42Å; N68-K72 WeakPolarHBondContact OD1-CE 3.46Å; N68-K72 PolarHBondContact OD1-NZ 3.43Å; V69-K72 PolarHBondContact O-N 2.99Å; K72-E74 VanDerWaalsContact C-N 3.34Å; K72-I75 PolarHBondContact O-N 3.43Å; K72-A76 WeakPolarHBondContact O-CB 3.29Å; K72-A76 PolarHBondContact O-N 2.91Å
73	N	97.9	Very high	96.8	Very high	104 Å²	104	106 Å²	106	56%	0.556	50%	0.495	S	S	*	.	H	α-helix	trans	-64.2	-40.3	176.7	-73.9	-22.4	0	0	0	111.8	V69 R70 T71 A76 R77	V69-N73 WeakPolarHBondContact O-CB 3.5Å; V69-N73 VanDerWaalsContact O-CG 3.29Å; V69-N73 PolarHBondContact O-N 2.93Å; V69-N73 PolarHBondContact O-ND2 3.49Å; R70-N73 PolarHBondContact O-N 2.86Å; T71-N73 VanDerWaalsContact C-N 3.33Å; T71-N73 PolarHBondContact O-N 2.86Å; N73-A76 PolarHBondContact O-N 3.28Å; N73-R77 WeakPolarHBondContact O-CB 3.31Å; N73-R77 PolarHBondContact O-N 2.86Å
74	E	97.8	Very high	96.4	Very high	73 Å²	73	102.6 Å²	102.6	34%	0.341	49%	0.486	S	S	.	.	H	α-helix	trans	-68	-42.4	176.9	-175.4	57.6	-166.7	0	0	112	R70 T71 K72 A76 R77 L78	R70-E74 PolarHBondContact O-N 2.77Å; T71-E74 PolarHBondContact O-N 3.34Å; K72-E74 VanDerWaalsContact C-N 3.34Å; E74-A76 VanDerWaalsContact C-N 3.35Å; E74-A76 PolarHBondContact O-N 3.29Å; E74-R77 WeakPolarHBondContact O-CB 3.37Å; E74-R77 PolarHBondContact O-N 3.05Å; E74-R77 IonicContact OE1-CZ 3.73Å; E74-R77 IonicContact OE1-NE 2.71Å; E74-R77 PolarHBondContact OE1-NE 3.34Å; E74-R77 IonicContact OE1-NH2 3.45Å; E74-R77 PolarHBondContact OE1-NH2 3.2Å; E74-R77 IonicContact OE2-CZ 3.18Å; E74-R77 IonicContact OE2-NE 3.4Å; E74-R77 PolarHBondContact OE2-NE 3.18Å; E74-R77 IonicContact OE2-NH2 3.42Å; E74-R77 PolarHBondContact OE2-NH2 2.85Å; E74-L78 HydrophobicContact CG-CD1 4.11Å; E74-L78 HydrophobicContact CG-CG 4.46Å; E74-L78 WeakPolarHBondContact O-CB 3.46Å; E74-L78 WeakPolarHBondContact O-CG 3.39Å; E74-L78 PolarHBondContact O-N 3.45Å
75	I	97.5	Very high	96	Very high	85 Å²	85	104.8 Å²	104.8	44%	0.436	49%	0.491	S	S	.	.	H	α-helix	trans	-57	-49.6	172.2	-69.9	167.3	0	0	0	110.1	T71 K72 R77 L78 E79	T71-I75 HydrophobicContact CG2-CD1 4.02Å; T71-I75 VanDerWaalsContact O-CG1 3.31Å; T71-I75 WeakPolarHBondContact O-CG1 3.5Å; T71-I75 PolarHBondContact O-N 3.41Å; K72-I75 PolarHBondContact O-N 3.43Å; I75-R77 VanDerWaalsContact C-N 3.29Å; I75-R77 PolarHBondContact O-N 2.81Å; I75-L78 PolarHBondContact O-N 3.4Å; I75-E79 HydrophobicContact CG2-CG 4.34Å; I75-E79 WeakPolarHBondContact O-CB 3.46Å; I75-E79 WeakPolarHBondContact O-CG 3.32Å; I75-E79 PolarHBondContact O-N 2.71Å
76	A	97.3	Very high	95.4	Very high	29 Å²	29	102.9 Å²	102.9	24%	0.24	48%	0.484	C	S	.	.	H	α-helix	trans	-60.8	-38.6	178.5	0	0	0	0	0	112.1	K72 N73 E74 R80	K72-A76 WeakPolarHBondContact O-CB 3.29Å; K72-A76 PolarHBondContact O-N 2.91Å; N73-A76 PolarHBondContact O-N 3.28Å; E74-A76 VanDerWaalsContact C-N 3.35Å; E74-A76 PolarHBondContact O-N 3.29Å; A76-R80 VanDerWaalsContact O-CG 3.29Å; A76-R80 WeakPolarHBondContact O-CG 3.43Å; A76-R80 PolarHBondContact O-N 3.36Å
77	R	97.6	Very high	94.6	Very high	120 Å²	120	102.5 Å²	102.5	45%	0.453	49%	0.49	S	S	.	.	H	α-helix	trans	-62.9	-48.9	174.8	-171.3	-178.3	78.8	121.9	3.7	111.2	N73 E74 I75 R80 Q81	N73-R77 WeakPolarHBondContact O-CB 3.31Å; N73-R77 PolarHBondContact O-N 2.86Å; E74-R77 WeakPolarHBondContact O-CB 3.37Å; E74-R77 PolarHBondContact O-N 3.05Å; E74-R77 IonicContact OE1-CZ 3.73Å; E74-R77 IonicContact OE1-NE 2.71Å; E74-R77 PolarHBondContact OE1-NE 3.34Å; E74-R77 IonicContact OE1-NH2 3.45Å; E74-R77 PolarHBondContact OE1-NH2 3.2Å; E74-R77 IonicContact OE2-CZ 3.18Å; E74-R77 IonicContact OE2-NE 3.4Å; E74-R77 PolarHBondContact OE2-NE 3.18Å; E74-R77 IonicContact OE2-NH2 3.42Å; E74-R77 PolarHBondContact OE2-NH2 2.85Å; I75-R77 VanDerWaalsContact C-N 3.29Å; I75-R77 PolarHBondContact O-N 2.81Å; R77-R80 PolarHBondContact O-N 2.92Å; R77-Q81 WeakPolarHBondContact O-CG 3.41Å; R77-Q81 PolarHBondContact O-N 2.97Å
78	L	97.2	Very high	93.7	Very high	86 Å²	86	108 Å²	108	45%	0.45	51%	0.507	S	S	.	.	H	α-helix	trans	-64.6	-38.7	179.2	-70.4	172.2	0	0	0	112	E74 I75 Q81 K82	E74-L78 HydrophobicContact CG-CD1 4.11Å; E74-L78 HydrophobicContact CG-CG 4.46Å; E74-L78 WeakPolarHBondContact O-CB 3.46Å; E74-L78 WeakPolarHBondContact O-CG 3.39Å; E74-L78 PolarHBondContact O-N 3.45Å; I75-L78 PolarHBondContact O-N 3.4Å; L78-Q81 PolarHBondContact O-N 3.34Å; L78-K82 VanDerWaalsContact O-CB 3.32Å; L78-K82 WeakPolarHBondContact O-CB 3.32Å; L78-K82 PolarHBondContact O-N 2.87Å
79	E	96.6	Very high	92.8	Very high	94 Å²	94	111.2 Å²	111.2	44%	0.439	52%	0.519	S	S	.	.	H	α-helix	trans	-62.4	-43.9	173.8	-77.2	-170.1	172.5	0	0	112	I75 Q81 K82 R83	I75-E79 HydrophobicContact CG2-CG 4.34Å; I75-E79 WeakPolarHBondContact O-CB 3.46Å; I75-E79 WeakPolarHBondContact O-CG 3.32Å; I75-E79 PolarHBondContact O-N 2.71Å; E79-Q81 VanDerWaalsContact C-N 3.35Å; E79-K82 PolarHBondContact O-N 2.79Å; E79-R83 VanDerWaalsContact O-CG 3.31Å; E79-R83 WeakPolarHBondContact O-CG 3.39Å; E79-R83 PolarHBondContact O-N 3.35Å; E79-R83 IonicContact OE2-NH2 3.85Å
80	R	95	Very high	91.6	Very high	174 Å²	174	109.7 Å²	109.7	66%	0.657	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-44	174.6	-71.5	175.2	-161.9	135.1	2.3	111.3	A76 R77 R83 A84	A76-R80 VanDerWaalsContact O-CG 3.29Å; A76-R80 WeakPolarHBondContact O-CG 3.43Å; A76-R80 PolarHBondContact O-N 3.36Å; R77-R80 PolarHBondContact O-N 2.92Å; R80-R83 PolarHBondContact O-N 3.31Å; R80-A84 WeakPolarHBondContact O-CB 3.5Å; R80-A84 PolarHBondContact O-N 2.8Å
81	Q	94.3	Very high	90.8	Very high	78 Å²	78	104.8 Å²	104.8	36%	0.364	50%	0.501	S	S	.	.	H	α-helix	trans	-62	-43.7	175.9	-72.3	-178.1	8.1	0	0	111.8	R77 L78 E79 A84 K85	R77-Q81 WeakPolarHBondContact O-CG 3.41Å; R77-Q81 PolarHBondContact O-N 2.97Å; L78-Q81 PolarHBondContact O-N 3.34Å; E79-Q81 VanDerWaalsContact C-N 3.35Å; Q81-A84 PolarHBondContact O-N 2.88Å; Q81-K85 WeakPolarHBondContact O-CB 3.31Å; Q81-K85 WeakPolarHBondContact O-CG 3.39Å; Q81-K85 PolarHBondContact O-N 3.5Å
82	K	92.8	Very high	90.1	Very high	141 Å²	141	108.8 Å²	108.8	61%	0.613	51%	0.508	S	S	*	.	H	α-helix	trans	-58.9	-48.7	175.4	175.9	176.6	175.2	-175.2	0	110.7	L78 E79 A84 K85 L86	L78-K82 VanDerWaalsContact O-CB 3.32Å; L78-K82 WeakPolarHBondContact O-CB 3.32Å; L78-K82 PolarHBondContact O-N 2.87Å; E79-K82 PolarHBondContact O-N 2.79Å; K82-A84 PolarHBondContact O-N 3.31Å; K82-K85 PolarHBondContact O-N 2.85Å; K82-L86 HydrophobicContact CG-CD1 3.75Å; K82-L86 WeakPolarHBondContact O-CB 3.49Å; K82-L86 WeakPolarHBondContact O-CD1 3.34Å; K82-L86 PolarHBondContact O-N 3.24Å
83	R	90.4	Very high	89.4	Confident	173 Å²	173	105.2 Å²	105.2	65%	0.653	50%	0.497	S	S	*	.	H	α-helix	trans	-60	-44	176.7	-70.6	177.7	-163.8	-168.9	7.1	112	E79 R80 K85 L86 S87	E79-R83 VanDerWaalsContact O-CG 3.31Å; E79-R83 WeakPolarHBondContact O-CG 3.39Å; E79-R83 PolarHBondContact O-N 3.35Å; E79-R83 IonicContact OE2-NH2 3.85Å; R80-R83 PolarHBondContact O-N 3.31Å; R83-K85 PolarHBondContact O-N 2.9Å; R83-L86 PolarHBondContact O-N 3.48Å; R83-S87 PolarHBondContact O-N 3.33Å
84	A	90.4	Very high	88.7	Confident	41 Å²	41	104.9 Å²	104.9	34%	0.339	50%	0.499	S	S	.	.	H	α-helix	trans	-65.9	-36.2	177.5	0	0	0	0	0	112.9	R80 Q81 K82 S87 R88	R80-A84 WeakPolarHBondContact O-CB 3.5Å; R80-A84 PolarHBondContact O-N 2.8Å; Q81-A84 PolarHBondContact O-N 2.88Å; K82-A84 PolarHBondContact O-N 3.31Å; A84-S87 PolarHBondContact O-OG 2.95Å; A84-R88 WeakPolarHBondContact O-CG 3.43Å; A84-R88 PolarHBondContact O-N 2.92Å
85	K	89.3	Confident	87.9	Confident	142 Å²	142	104.3 Å²	104.3	62%	0.617	50%	0.5	S	S	*	.	H	α-helix	trans	-67.9	-43.8	173.7	-75	-178.9	-179.3	-177.7	0	111.4	Q81 K82 R83 S87 R88 H89	Q81-K85 WeakPolarHBondContact O-CB 3.31Å; Q81-K85 WeakPolarHBondContact O-CG 3.39Å; Q81-K85 PolarHBondContact O-N 3.5Å; K82-K85 PolarHBondContact O-N 2.85Å; R83-K85 PolarHBondContact O-N 2.9Å; K85-S87 VanDerWaalsContact C-N 3.31Å; K85-S87 PolarHBondContact O-N 3.17Å; K85-R88 PolarHBondContact O-N 2.82Å; K85-H89 PolarHBondContact O-N 3.44Å
86	L	85	Confident	87	Confident	75 Å²	75	106.7 Å²	106.7	39%	0.393	52%	0.523	S	S	.	.	H	α-helix	trans	-62.3	-35.7	175.9	-88.9	149.7	0	0	0	112.8	K82 R83 H89 P90 V91	K82-L86 HydrophobicContact CG-CD1 3.75Å; K82-L86 WeakPolarHBondContact O-CB 3.49Å; K82-L86 WeakPolarHBondContact O-CD1 3.34Å; K82-L86 PolarHBondContact O-N 3.24Å; R83-L86 PolarHBondContact O-N 3.48Å; L86-H89 CarbonylContact O-C 3.26Å; L86-H89 VanDerWaalsContact O-C 3.26Å; L86-P90 WeakPolarHBondContact O-CA 3.25Å; L86-V91 HydrophobicContact CD2-CG2 3.55Å
87	S	80.7	Confident	86.4	Confident	93 Å²	93	108.8 Å²	108.8	65%	0.65	55%	0.547	S	S	*	.	H	α-helix	trans	-71.7	-34.6	176	73.3	0	0	0	0	112.3	R83 A84 K85	R83-S87 PolarHBondContact O-N 3.33Å; A84-S87 PolarHBondContact O-OG 2.95Å; K85-S87 VanDerWaalsContact C-N 3.31Å; K85-S87 PolarHBondContact O-N 3.17Å
88	R	79.5	Confident	85.7	Confident	198 Å²	198	107.1 Å²	107.1	75%	0.747	55%	0.55	S	S	*	*	H	α-helix	trans	-76	-36.9	176.1	-70.9	177.5	-175	-175.7	1.1	112.8	A84 K85	A84-R88 WeakPolarHBondContact O-CG 3.43Å; A84-R88 PolarHBondContact O-N 2.92Å; K85-R88 PolarHBondContact O-N 2.82Å
89	H	78.5	Confident	85.2	Confident	149 Å²	149	107 Å²	107	69%	0.69	55%	0.553	S	S	*	*	S	Bend	trans	-127	84.1	179.8	-60.6	-52.2	0	0	0	108.8	K85 L86 V91	K85-H89 PolarHBondContact O-N 3.44Å; L86-H89 CarbonylContact O-C 3.26Å; L86-H89 VanDerWaalsContact O-C 3.26Å; H89-V91 PolarHBondContact O-N 3.28Å
90	P	73.7	Confident	84.7	Confident	47 Å²	47	104.9 Å²	104.9	31%	0.305	54%	0.544	S	S	.	.			trans	-60.7	134.2	177.7	24.3	-32.6	0	0	0	109	L86 R92 P101	L86-P90 WeakPolarHBondContact O-CA 3.25Å; P90-R92 VanDerWaalsContact O-CG 3.31Å; P90-R92 WeakPolarHBondContact O-CG 3.47Å; P90-R92 PolarHBondContact O-N 3.27Å; P90-P101 HydrophobicContact CB-CB 4.18Å; P90-P101 HydrophobicContact CG-CB 4.5Å
91	V	80.5	Confident	84.1	Confident	87 Å²	87	98.5 Å²	98.5	53%	0.527	53%	0.525	S	S	.	.			trans	-56.8	124.9	173.5	-177.5	0	0	0	0	107.2	L86 H89 V102	L86-V91 HydrophobicContact CD2-CG2 3.55Å; H89-V91 PolarHBondContact O-N 3.28Å; V91-V102 HydrophobicContact CB-CG2 4.18Å; V91-V102 HydrophobicContact CG1-CG2 3.87Å; V91-V102 WeakPolarHBondContact O-CG2 3.06Å; V91-V102 PolarHBondContact O-N 3.24Å
92	R	81.4	Confident	83.7	Confident	165 Å²	165	97.7 Å²	97.7	62%	0.623	53%	0.526	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105	144.7	179.7	-57.1	-168.4	-179.8	-172.7	-5.3	109.6	P90 V99 L100	P90-R92 VanDerWaalsContact O-CG 3.31Å; P90-R92 WeakPolarHBondContact O-CG 3.47Å; P90-R92 PolarHBondContact O-N 3.27Å; R92-V99 HydrophobicContact CB-CG1 3.65Å; R92-V99 HydrophobicContact CG-CG1 4.26Å; R92-L100 CarbonylContact C-O 3.57Å; R92-L100 VanDerWaalsContact CA-O 3.3Å; R92-L100 WeakPolarHBondContact CA-O 3.38Å
93	T	84.8	Confident	83.4	Confident	55 Å²	55	95 Å²	95	34%	0.337	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	153.4	172.9	-174.3	0	0	0	0	108.7	V95 L100 V102 V105	T93-V95 HydrophobicContact CG2-CG2 4.2Å; T93-L100 PolarHBondContact N-O 2.97Å; T93-L100 PolarHBondContact O-N 3.15Å; T93-L100 VanDerWaalsContact O-O 3.1Å; T93-V102 HydrophobicContact CG2-CG2 3.76Å; T93-V105 HydrophobicContact CG2-CG2 3.85Å
94	T	81.5	Confident	83.2	Confident	97 Å²	97	92.8 Å²	92.8	60%	0.595	52%	0.517	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.8	120.9	176.9	30.7	0	0	0	0	109.5	V98 V99	T94-V98 WeakPolarHBondContact CA-O 3.32Å; T94-V99 HydrophobicContact CG2-CB 4.4Å; T94-V99 HydrophobicContact CG2-CG2 3.65Å
95	V	81.3	Confident	83.1	Confident	62 Å²	62	92.2 Å²	92.2	38%	0.376	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	120.3	173.8	-174.3	0	0	0	0	107.8	T93 G97 V98 V105	T93-V95 HydrophobicContact CG2-CG2 4.2Å; V95-G97 PolarHBondContact O-N 2.98Å; V95-V98 PolarHBondContact N-O 3.26Å; V95-V98 PolarHBondContact O-N 3.47Å; V95-V105 HydrophobicContact CG2-CG1 4.3Å; V95-V105 HydrophobicContact CG2-CG2 4Å
96	C	78.7	Confident	83.1	Confident	134 Å²	134	88 Å²	88	91%	0.905	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.4	41.9	-176.6	-65.6	0	0	0	0	113.7	V98	C96-V98 VanDerWaalsContact C-N 3.28Å; C96-V98 PolarHBondContact O-N 3.36Å
97	G	85.5	Confident	83.3	Confident	74 Å²	74	90.6 Å²	90.6	76%	0.763	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.3	-6	179.7	0	0	0	0	0	115.5	V95	V95-G97 PolarHBondContact O-N 2.98Å
98	V	83.3	Confident	83.7	Confident	84 Å²	84	89.3 Å²	89.3	51%	0.509	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	126.8	178.1	-170.7	0	0	0	0	110.2	T94 V95 C96 L100	T94-V98 WeakPolarHBondContact CA-O 3.32Å; V95-V98 PolarHBondContact N-O 3.26Å; V95-V98 PolarHBondContact O-N 3.47Å; C96-V98 VanDerWaalsContact C-N 3.28Å; C96-V98 PolarHBondContact O-N 3.36Å; V98-L100 HydrophobicContact CB-CG 4.4Å; V98-L100 HydrophobicContact CG1-CD1 4.41Å; V98-L100 HydrophobicContact CG1-CD2 3.86Å; V98-L100 HydrophobicContact CG1-CG 3.88Å; V98-L100 PolarHBondContact O-N 3.36Å
99	V	86.8	Confident	84.2	Confident	83 Å²	83	84.4 Å²	84.4	50%	0.503	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	105.7	176.6	-174.6	0	0	0	0	109.1	R92 T94	R92-V99 HydrophobicContact CB-CG1 3.65Å; R92-V99 HydrophobicContact CG-CG1 4.26Å; T94-V99 HydrophobicContact CG2-CB 4.4Å; T94-V99 HydrophobicContact CG2-CG2 3.65Å
100	L	84.5	Confident	84.7	Confident	51 Å²	51	79.7 Å²	79.7	27%	0.267	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	147.6	-178.3	-64.8	172.9	0	0	0	111.2	R92 T93 V98 V102 Y104 V105	R92-L100 CarbonylContact C-O 3.57Å; R92-L100 VanDerWaalsContact CA-O 3.3Å; R92-L100 WeakPolarHBondContact CA-O 3.38Å; T93-L100 PolarHBondContact N-O 2.97Å; T93-L100 PolarHBondContact O-N 3.15Å; T93-L100 VanDerWaalsContact O-O 3.1Å; V98-L100 HydrophobicContact CB-CG 4.4Å; V98-L100 HydrophobicContact CG1-CD1 4.41Å; V98-L100 HydrophobicContact CG1-CD2 3.86Å; V98-L100 HydrophobicContact CG1-CG 3.88Å; V98-L100 PolarHBondContact O-N 3.36Å; L100-V102 PolarHBondContact O-N 3.24Å; L100-Y104 HydrophobicContact CD1-CD1 4.18Å; L100-Y104 HydrophobicContact CD1-CE1 4.33Å; L100-Y104 HydrophobicContact CD2-CD1 4.43Å; L100-V105 HydrophobicContact CB-CG2 3.99Å; L100-V105 HydrophobicContact CD1-CG2 4.46Å
101	P	83.9	Confident	85.5	Confident	39 Å²	39	80.5 Å²	80.5	25%	0.253	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.4	133.9	168	-23.9	34.7	0	0	0	111.1	P90 S103 Y104 V105	P90-P101 HydrophobicContact CB-CB 4.18Å; P90-P101 HydrophobicContact CG-CB 4.5Å; P101-S103 PolarHBondContact O-N 3.42Å; P101-Y104 WeakPolarHBondContact O-CB 3.2Å; P101-Y104 PolarHBondContact O-N 2.92Å; P101-V105 PolarHBondContact O-N 3.05Å
102	V	86	Confident	85.9	Confident	62 Å²	62	84.7 Å²	84.7	38%	0.376	48%	0.48	S	S	.	.	H	α-helix	trans	-56.5	-35.3	177.2	172.1	0	0	0	0	111.2	V91 T93 L100 Y104 V105 A106	V91-V102 HydrophobicContact CB-CG2 4.18Å; V91-V102 HydrophobicContact CG1-CG2 3.87Å; V91-V102 WeakPolarHBondContact O-CG2 3.06Å; V91-V102 PolarHBondContact O-N 3.24Å; T93-V102 HydrophobicContact CG2-CG2 3.76Å; L100-V102 PolarHBondContact O-N 3.24Å; V102-Y104 VanDerWaalsContact C-N 3.3Å; V102-Y104 PolarHBondContact O-N 3.19Å; V102-V105 PolarHBondContact O-N 3.45Å; V102-A106 WeakPolarHBondContact O-CB 3.48Å; V102-A106 PolarHBondContact O-N 3.07Å
103	S	86.2	Confident	86.1	Confident	84 Å²	84	82.1 Å²	82.1	59%	0.587	48%	0.478	S	S	*	.	H	α-helix	trans	-59	-39.6	174.4	51.1	0	0	0	0	112.9	P101 F107	P101-S103 PolarHBondContact O-N 3.42Å; S103-F107 WeakPolarHBondContact O-CB 3.39Å; S103-F107 PolarHBondContact O-N 2.91Å
104	Y	86.8	Confident	85.9	Confident	126 Å²	126	83 Å²	83	49%	0.494	49%	0.487	S	S	.	.	H	α-helix	trans	-68.3	-44.8	177.1	-176.9	-97.5	0	0	0	111.3	L100 P101 V102 A106 F107 V108	L100-Y104 HydrophobicContact CD1-CD1 4.18Å; L100-Y104 HydrophobicContact CD1-CE1 4.33Å; L100-Y104 HydrophobicContact CD2-CD1 4.43Å; P101-Y104 WeakPolarHBondContact O-CB 3.2Å; P101-Y104 PolarHBondContact O-N 2.92Å; V102-Y104 VanDerWaalsContact C-N 3.3Å; V102-Y104 PolarHBondContact O-N 3.19Å; Y104-A106 VanDerWaalsContact C-N 3.34Å; Y104-A106 PolarHBondContact O-N 2.95Å; Y104-F107 WeakPolarHBondContact O-CB 3.42Å; Y104-F107 PolarHBondContact O-N 3.47Å; Y104-V108 HydrophobicContact CD1-CG2 4.25Å; Y104-V108 HydrophobicContact CE1-CG2 3.88Å; Y104-V108 WeakPolarHBondContact O-CG2 3.42Å; Y104-V108 PolarHBondContact O-N 3.29Å
105	V	88.1	Confident	85.5	Confident	30 Å²	30	85.8 Å²	85.8	18%	0.182	49%	0.493	C	S	.	.	H	α-helix	trans	-60.7	-44.9	177	-179.2	0	0	0	0	110.9	T93 V95 L100 P101 V102 F107 V108 I109	T93-V105 HydrophobicContact CG2-CG2 3.85Å; V95-V105 HydrophobicContact CG2-CG1 4.3Å; V95-V105 HydrophobicContact CG2-CG2 4Å; L100-V105 HydrophobicContact CB-CG2 3.99Å; L100-V105 HydrophobicContact CD1-CG2 4.46Å; P101-V105 PolarHBondContact O-N 3.05Å; V102-V105 PolarHBondContact O-N 3.45Å; V105-F107 PolarHBondContact O-N 3.45Å; V105-V108 PolarHBondContact O-N 3Å; V105-I109 HydrophobicContact CG1-CD1 3.98Å; V105-I109 WeakPolarHBondContact O-CG1 3.39Å; V105-I109 PolarHBondContact O-N 3.25Å
106	A	88.1	Confident	85.1	Confident	53 Å²	53	92 Å²	92	44%	0.438	51%	0.509	S	S	.	.	H	α-helix	trans	-61	-43.2	176.4	0	0	0	0	0	112.2	V102 Y104 V108 I109 A110	V102-A106 WeakPolarHBondContact O-CB 3.48Å; V102-A106 PolarHBondContact O-N 3.07Å; Y104-A106 VanDerWaalsContact C-N 3.34Å; Y104-A106 PolarHBondContact O-N 2.95Å; A106-V108 PolarHBondContact O-N 3.32Å; A106-I109 PolarHBondContact O-N 3.45Å; A106-A110 WeakPolarHBondContact O-CB 3.37Å; A106-A110 PolarHBondContact O-N 3Å
107	F	89.6	Confident	84.2	Confident	130 Å²	130	89.8 Å²	89.8	57%	0.57	50%	0.501	S	S	*	.	H	α-helix	trans	-60	-43.2	176	175.9	-98.8	0	0	0	112.4	S103 Y104 V105 A110 N111	S103-F107 WeakPolarHBondContact O-CB 3.39Å; S103-F107 PolarHBondContact O-N 2.91Å; Y104-F107 WeakPolarHBondContact O-CB 3.42Å; Y104-F107 PolarHBondContact O-N 3.47Å; V105-F107 PolarHBondContact O-N 3.45Å; F107-A110 PolarHBondContact O-N 3.44Å; F107-N111 WeakPolarHBondContact CE1-ND2 3.34Å; F107-N111 VanDerWaalsContact CE2-ND2 3.25Å; F107-N111 WeakPolarHBondContact CE2-ND2 3.31Å; F107-N111 WeakPolarHBondContact CZ-ND2 3.3Å; F107-N111 PolarHBondContact O-N 2.91Å; F107-N111 VanDerWaalsContact O-N 3.07Å; F107-N111 PolarHBondContact O-ND2 3.29Å
108	V	89.3	Confident	82.6	Confident	66 Å²	66	95 Å²	95	40%	0.4	52%	0.517	S	S	.	.	H	α-helix	trans	-64.4	-43.9	177.5	173.1	0	0	0	0	111.2	Y104 V105 A106 R112	Y104-V108 HydrophobicContact CD1-CG2 4.25Å; Y104-V108 HydrophobicContact CE1-CG2 3.88Å; Y104-V108 WeakPolarHBondContact O-CG2 3.42Å; Y104-V108 PolarHBondContact O-N 3.29Å; V105-V108 PolarHBondContact O-N 3Å; A106-V108 PolarHBondContact O-N 3.32Å; V108-R112 WeakPolarHBondContact O-CB 3.34Å; V108-R112 PolarHBondContact O-N 3.19Å
109	I	89.1	Confident	82.6	Confident	94 Å²	94	95.6 Å²	95.6	48%	0.482	52%	0.518	S	S	.	.	H	α-helix	trans	-62.7	-46.6	177.5	-66.8	168.3	0	0	0	110.6	V105 A106 N111 R112 L113	V105-I109 HydrophobicContact CG1-CD1 3.98Å; V105-I109 WeakPolarHBondContact O-CG1 3.39Å; V105-I109 PolarHBondContact O-N 3.25Å; A106-I109 PolarHBondContact O-N 3.45Å; I109-N111 PolarHBondContact O-N 2.94Å; I109-R112 PolarHBondContact O-N 3.34Å; I109-L113 HydrophobicContact CG2-CD1 3.94Å; I109-L113 HydrophobicContact CG2-CG 4.31Å; I109-L113 WeakPolarHBondContact O-CG 3.39Å; I109-L113 PolarHBondContact O-N 3.17Å
110	A	89.9	Confident	82.3	Confident	51 Å²	51	96.3 Å²	96.3	42%	0.421	52%	0.519	S	S	.	.	H	α-helix	trans	-61.1	-43.5	-179	0	0	0	0	0	112.6	A106 F107 L113 S114	A106-A110 WeakPolarHBondContact O-CB 3.37Å; A106-A110 PolarHBondContact O-N 3Å; F107-A110 PolarHBondContact O-N 3.44Å; A110-L113 PolarHBondContact O-N 3.03Å; A110-S114 WeakPolarHBondContact O-CB 3.4Å; A110-S114 PolarHBondContact O-N 3.47Å; A110-S114 PolarHBondContact O-OG 3.42Å
111	N	89.4	Confident	82.2	Confident	64 Å²	64	98.8 Å²	98.8	34%	0.342	53%	0.533	S	S	.	.	H	α-helix	trans	-64.4	-41.1	174.9	-78.9	-59.3	0	0	0	111.9	F107 I109 L113 S114 H115	F107-N111 WeakPolarHBondContact CE1-ND2 3.34Å; F107-N111 VanDerWaalsContact CE2-ND2 3.25Å; F107-N111 WeakPolarHBondContact CE2-ND2 3.31Å; F107-N111 WeakPolarHBondContact CZ-ND2 3.3Å; F107-N111 PolarHBondContact O-N 2.91Å; F107-N111 VanDerWaalsContact O-N 3.07Å; F107-N111 PolarHBondContact O-ND2 3.29Å; I109-N111 PolarHBondContact O-N 2.94Å; N111-L113 VanDerWaalsContact C-N 3.33Å; N111-L113 PolarHBondContact O-N 3.4Å; N111-S114 PolarHBondContact O-N 3.17Å; N111-H115 PolarHBondContact O-CD2 2.97Å; N111-H115 VanDerWaalsContact O-CD2 3.24Å; N111-H115 PolarHBondContact O-N 2.85Å
112	R	89.3	Confident	82.1	Confident	174 Å²	174	102.3 Å²	102.3	66%	0.657	55%	0.549	S	S	*	.	H	α-helix	trans	-65.6	-36.6	178.7	-163.8	176.7	-168.8	-176.3	3.9	112.6	V108 I109 R116	V108-R112 WeakPolarHBondContact O-CB 3.34Å; V108-R112 PolarHBondContact O-N 3.19Å; I109-R112 PolarHBondContact O-N 3.34Å; R112-R116 PolarHBondContact O-N 3.36Å
113	L	86.1	Confident	81.9	Confident	112 Å²	112	104.8 Å²	104.8	59%	0.586	56%	0.56	S	S	*	*	H	α-helix	trans	-67.8	-41.1	173.4	-69.7	174.5	0	0	0	111.3	I109 A110 N111 H115 R116 A117	I109-L113 HydrophobicContact CG2-CD1 3.94Å; I109-L113 HydrophobicContact CG2-CG 4.31Å; I109-L113 WeakPolarHBondContact O-CG 3.39Å; I109-L113 PolarHBondContact O-N 3.17Å; A110-L113 PolarHBondContact O-N 3.03Å; N111-L113 VanDerWaalsContact C-N 3.33Å; N111-L113 PolarHBondContact O-N 3.4Å; L113-H115 PolarHBondContact O-N 2.81Å; L113-R116 PolarHBondContact O-N 2.87Å; L113-R116 VanDerWaalsContact O-N 3.15Å; L113-A117 PolarHBondContact O-N 2.97Å
114	S	81.5	Confident	81.6	Confident	74 Å²	74	106.2 Å²	106.2	52%	0.517	56%	0.558	S	S	.	*	H	α-helix	trans	-63.5	-40.5	178.2	-57.1	0	0	0	0	112.3	A110 N111 R116 A117	A110-S114 WeakPolarHBondContact O-CB 3.4Å; A110-S114 PolarHBondContact O-N 3.47Å; A110-S114 PolarHBondContact O-OG 3.42Å; N111-S114 PolarHBondContact O-N 3.17Å; S114-R116 VanDerWaalsContact C-N 3.26Å; S114-R116 PolarHBondContact O-N 3.35Å; S114-A117 PolarHBondContact O-N 3.18Å
115	H	73.2	Confident	81.2	Confident	154 Å²	154	104.8 Å²	104.8	71%	0.713	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.3	-13.3	175.4	-79.6	-68.9	0	0	0	114.8	N111 L113	N111-H115 PolarHBondContact O-CD2 2.97Å; N111-H115 VanDerWaalsContact O-CD2 3.24Å; N111-H115 PolarHBondContact O-N 2.85Å; L113-H115 PolarHBondContact O-N 2.81Å
116	R	72.2	Confident	80.7	Confident	194 Å²	194	110.5 Å²	110.5	73%	0.732	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	-12.3	173.1	-87.3	-176.2	170.1	-173	-4	113.3	R112 L113 S114	R112-R116 PolarHBondContact O-N 3.36Å; L113-R116 PolarHBondContact O-N 2.87Å; L113-R116 VanDerWaalsContact O-N 3.15Å; S114-R116 VanDerWaalsContact C-N 3.26Å; S114-R116 PolarHBondContact O-N 3.35Å
117	A	59.5	Low	80.1	Confident	87 Å²	87	115.3 Å²	115.3	72%	0.719	61%	0.605	S	S	*	*			trans	-94.7	1.5	-178.8	0	0	0	0	0	113.4	L113 S114	L113-A117 PolarHBondContact O-N 2.97Å; S114-A117 PolarHBondContact O-N 3.18Å
118	V	51.8	Low	79.2	Confident	184 Å²	184	114 Å²	114	100%	1.115	61%	0.608	S	S	*	*			trans	-112.2	0	171.5	-175.2	0	0	0	0	108.1

Retrieved 118 of 118 residues in 96.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).