A0A077ZJJ1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJJ1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 79 aa.

						>A0A077ZJJ1_TRITR|A0A077ZJJ1
MVTSTAPSSLGALRSLTDVYIMLRNGALQNRHLFAEENNQRSEDRMTLIPLHDFDSENAVSRTDERIPPEWVHVIDEIQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.9	Low	58.9	Low	238 Å²	238	124.5 Å²	124.5	100%	1.172	80%	0.797	S	S	*	*				0	110.4	0	-73.9	175.8	-171.6	0	0	107.1
2	V	54.2	Low	58.8	Low	150 Å²	150	123.7 Å²	123.7	91%	0.909	81%	0.809	S	S	*	*			trans	-107.2	104.1	174.6	-173.1	0	0	0	0	106.1	S4	V2-S4 PolarHBondContact O-N 3.18Å
3	T	61.6	Low	58.8	Low	125 Å²	125	124.6 Å²	124.6	77%	0.767	80%	0.802	S	S	*	*			trans	-76.9	102.3	178	47	0	0	0	0	108.7	T5	T3-T5 PolarHBondContact O-N 3.28Å
4	S	53.7	Low	59.4	Low	117 Å²	117	132.6 Å²	132.6	82%	0.818	81%	0.808	S	S	*	*			trans	-67.6	108.9	167.7	178.8	0	0	0	0	108.6	V2 A6	V2-S4 PolarHBondContact O-N 3.18Å; S4-A6 PolarHBondContact O-N 3.13Å
5	T	64.3	Low	60.5	Low	125 Å²	125	129 Å²	129	77%	0.767	79%	0.791	S	S	*	*			trans	-80.1	106.3	172.3	57.5	0	0	0	0	108.2	T3	T3-T5 PolarHBondContact O-N 3.28Å
6	A	65.3	Low	62.1	Low	83 Å²	83	128.9 Å²	128.9	69%	0.686	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-65.3	139	174.3	0	0	0	0	0	110.7	S4 S8	S4-A6 PolarHBondContact O-N 3.13Å; A6-S8 PolarHBondContact O-N 2.78Å
7	P	65.8	Low	63.7	Low	129 Å²	129	125.9 Å²	125.9	84%	0.838	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-71.4	117.3	174.1	27.9	-31.3	0	0	0	109.6	S9	P7-S9 PolarHBondContact O-N 3.34Å
8	S	62.9	Low	65	Low	98 Å²	98	125.4 Å²	125.4	69%	0.685	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-58.8	119.6	171.4	29.5	0	0	0	0	110	A6 L10	A6-S8 PolarHBondContact O-N 2.78Å; S8-L10 VanDerWaalsContact C-N 3.33Å; S8-L10 PolarHBondContact O-N 3.46Å
9	S	57.3	Low	66.3	Low	121 Å²	121	122.6 Å²	122.6	85%	0.846	74%	0.741	S	S	*	*			trans	-68.4	85.8	172.5	167.7	0	0	0	0	109.9	P7 G11	P7-S9 PolarHBondContact O-N 3.34Å; S9-G11 PolarHBondContact O-N 2.99Å
10	L	55.4	Low	67.6	Low	122 Å²	122	124 Å²	124	64%	0.639	73%	0.733	S	S	*	*			trans	-69.6	119.6	162.3	-79.5	93.1	0	0	0	108.3	S8	S8-L10 VanDerWaalsContact C-N 3.33Å; S8-L10 PolarHBondContact O-N 3.46Å
11	G	56.7	Low	68.7	Low	62 Å²	62	121.6 Å²	121.6	64%	0.639	72%	0.716	S	S	*	*	S	Bend	trans	-55	143.2	-179	0	0	0	0	0	113.2	S9 L13	S9-G11 PolarHBondContact O-N 2.99Å; G11-L13 PolarHBondContact O-N 3.4Å
12	A	58.2	Low	70.6	Confident	114 Å²	114	116.5 Å²	116.5	94%	0.942	69%	0.691	S	S	*	*	S	Bend	trans	54.9	-14.4	169.6	0	0	0	0	0	119.3	R14	A12-R14 PolarHBondContact O-N 3.02Å
13	L	57.8	Low	72.5	Confident	136 Å²	136	115.1 Å²	115.1	71%	0.712	68%	0.678	S	S	*	*			trans	-87.3	85.9	165.1	-64.4	172.9	0	0	0	107.2	G11 S15	G11-L13 PolarHBondContact O-N 3.4Å; L13-S15 PolarHBondContact O-N 3.31Å
14	R	67.4	Low	73.9	Confident	236 Å²	236	115.3 Å²	115.3	89%	0.891	67%	0.665	S	S	*	*			trans	-57.3	112.1	169.4	-80.2	-159.9	173.4	-156.1	-0.2	107.7	A12 L16	A12-R14 PolarHBondContact O-N 3.02Å; R14-L16 PolarHBondContact O-N 3.13Å
15	S	76.4	Confident	75.7	Confident	79 Å²	79	113 Å²	113	55%	0.552	64%	0.643	S	S	*	*			trans	-56.2	115.1	176.6	179.8	0	0	0	0	109	L13 T17	L13-S15 PolarHBondContact O-N 3.31Å; S15-T17 PolarHBondContact O-N 3.37Å; S15-T17 WeakPolarHBondContact OG-CB 3.3Å; S15-T17 PolarHBondContact OG-N 2.88Å; S15-T17 PolarHBondContact OG-OG1 3.28Å; S15-T17 VanDerWaalsContact OG-OG1 3.12Å
16	L	86.2	Confident	77	Confident	127 Å²	127	108.1 Å²	108.1	67%	0.665	62%	0.618	S	S	*	*			trans	-78.3	0.5	174.3	-70.9	175.5	0	0	0	111.9	R14 D18 V19 Y20	R14-L16 PolarHBondContact O-N 3.13Å; L16-D18 PolarHBondContact O-N 3.38Å; L16-V19 PolarHBondContact O-N 2.73Å; L16-Y20 VanDerWaalsContact O-CB 3.27Å; L16-Y20 WeakPolarHBondContact O-CB 3.32Å; L16-Y20 PolarHBondContact O-N 2.93Å
17	T	89.6	Confident	78	Confident	79 Å²	79	107.2 Å²	107.2	49%	0.485	61%	0.61	S	S	.	*	H	α-helix	trans	-58.4	-46.7	-177.3	-57.8	0	0	0	0	111.8	S15 V19 Y20 I21	S15-T17 PolarHBondContact O-N 3.37Å; S15-T17 WeakPolarHBondContact OG-CB 3.3Å; S15-T17 PolarHBondContact OG-N 2.88Å; S15-T17 PolarHBondContact OG-OG1 3.28Å; S15-T17 VanDerWaalsContact OG-OG1 3.12Å; T17-V19 PolarHBondContact O-N 3.41Å; T17-Y20 PolarHBondContact O-N 3.44Å; T17-I21 HydrophobicContact CG2-CD1 3.76Å; T17-I21 HydrophobicContact CG2-CG1 4.41Å; T17-I21 WeakPolarHBondContact O-CB 3.49Å; T17-I21 VanDerWaalsContact O-CG1 3.24Å; T17-I21 WeakPolarHBondContact O-CG1 3.39Å; T17-I21 PolarHBondContact O-N 3.18Å
18	D	86.7	Confident	78.9	Confident	116 Å²	116	105.4 Å²	105.4	62%	0.62	59%	0.593	S	S	*	*	H	α-helix	trans	-66.6	-39.5	-179.1	-64.9	-25.5	0	0	0	111.9	L16 I21 M22	L16-D18 PolarHBondContact O-N 3.38Å; D18-I21 PolarHBondContact O-N 3.17Å; D18-M22 WeakPolarHBondContact O-CB 3.4Å; D18-M22 PolarHBondContact O-N 3.22Å
19	V	90.2	Very high	80.1	Confident	72 Å²	72	107.3 Å²	107.3	44%	0.436	59%	0.591	S	S	.	*	H	α-helix	trans	-63.8	-46.2	175.4	-180	0	0	0	0	110.3	L16 T17 M22 L23	L16-V19 PolarHBondContact O-N 2.73Å; T17-V19 PolarHBondContact O-N 3.41Å; V19-M22 PolarHBondContact O-N 3.42Å; V19-L23 HydrophobicContact CG1-CD1 3.93Å; V19-L23 HydrophobicContact CG1-CG 4.39Å; V19-L23 WeakPolarHBondContact O-CB 3.45Å; V19-L23 VanDerWaalsContact O-CG 3.29Å; V19-L23 WeakPolarHBondContact O-CG 3.31Å; V19-L23 PolarHBondContact O-N 2.85Å
20	Y	92	Very high	81.4	Confident	151 Å²	151	105.2 Å²	105.2	59%	0.592	57%	0.57	S	S	*	*	H	α-helix	trans	-59.4	-46.7	176.4	170.7	-96.7	0	0	0	111.6	L16 T17 M22 L23 R24	L16-Y20 VanDerWaalsContact O-CB 3.27Å; L16-Y20 WeakPolarHBondContact O-CB 3.32Å; L16-Y20 PolarHBondContact O-N 2.93Å; T17-Y20 PolarHBondContact O-N 3.44Å; Y20-M22 PolarHBondContact O-N 3.31Å; Y20-L23 PolarHBondContact O-N 3.13Å; Y20-R24 WeakPolarHBondContact O-CB 3.37Å; Y20-R24 PolarHBondContact O-N 3.34Å
21	I	90.7	Very high	82.6	Confident	73 Å²	73	106.5 Å²	106.5	37%	0.374	57%	0.567	S	S	.	*	H	α-helix	trans	-62.4	-44.5	178.5	-70	167.8	0	0	0	110.6	T17 D18 R24 N25	T17-I21 HydrophobicContact CG2-CD1 3.76Å; T17-I21 HydrophobicContact CG2-CG1 4.41Å; T17-I21 WeakPolarHBondContact O-CB 3.49Å; T17-I21 VanDerWaalsContact O-CG1 3.24Å; T17-I21 WeakPolarHBondContact O-CG1 3.39Å; T17-I21 PolarHBondContact O-N 3.18Å; D18-I21 PolarHBondContact O-N 3.17Å; I21-R24 PolarHBondContact O-N 3.31Å; I21-N25 WeakPolarHBondContact CG2-ND2 3.35Å; I21-N25 VanDerWaalsContact O-CB 3.31Å; I21-N25 WeakPolarHBondContact O-CB 3.37Å; I21-N25 PolarHBondContact O-N 3.47Å; I21-N25 PolarHBondContact O-ND2 3.37Å
22	M	91.4	Very high	83.7	Confident	132 Å²	132	109.6 Å²	109.6	65%	0.65	56%	0.564	S	S	*	*	H	α-helix	trans	-61.4	-48.6	178.1	-170.7	-168.1	-41.1	0	0	111.7	D18 V19 Y20 N25 G26	D18-M22 WeakPolarHBondContact O-CB 3.4Å; D18-M22 PolarHBondContact O-N 3.22Å; V19-M22 PolarHBondContact O-N 3.42Å; Y20-M22 PolarHBondContact O-N 3.31Å; M22-N25 PolarHBondContact O-N 3.38Å; M22-G26 PolarHBondContact O-N 3.08Å
23	L	93.1	Very high	84.6	Confident	121 Å²	121	109.3 Å²	109.3	63%	0.634	55%	0.546	S	S	*	.	H	α-helix	trans	-62.6	-44.2	177.5	-71.2	173.4	0	0	0	111.6	V19 Y20 G26 A27	V19-L23 HydrophobicContact CG1-CD1 3.93Å; V19-L23 HydrophobicContact CG1-CG 4.39Å; V19-L23 WeakPolarHBondContact O-CB 3.45Å; V19-L23 VanDerWaalsContact O-CG 3.29Å; V19-L23 WeakPolarHBondContact O-CG 3.31Å; V19-L23 PolarHBondContact O-N 2.85Å; Y20-L23 PolarHBondContact O-N 3.13Å; L23-G26 PolarHBondContact O-N 3.37Å; L23-A27 VanDerWaalsContact O-CB 3.29Å; L23-A27 WeakPolarHBondContact O-CB 3.48Å; L23-A27 PolarHBondContact O-N 3.48Å
24	R	91.6	Very high	85.1	Confident	129 Å²	129	108.6 Å²	108.6	49%	0.487	54%	0.538	S	S	.	.	H	α-helix	trans	-58.7	-49.1	175.6	179	-175.7	175	-80.3	-1.7	111	Y20 I21 A27 L28	Y20-R24 WeakPolarHBondContact O-CB 3.37Å; Y20-R24 PolarHBondContact O-N 3.34Å; I21-R24 PolarHBondContact O-N 3.31Å; R24-A27 PolarHBondContact O-N 3.04Å; R24-L28 HydrophobicContact CG-CD1 4.2Å; R24-L28 VanDerWaalsContact O-CG 3.29Å; R24-L28 WeakPolarHBondContact O-CG 3.3Å; R24-L28 PolarHBondContact O-N 2.9Å
25	N	90.7	Very high	85.1	Confident	67 Å²	67	99.8 Å²	99.8	36%	0.358	52%	0.515	S	S	.	.	H	α-helix	trans	-67.3	-41.8	-178	-69.1	-11.6	0	0	0	111.6	I21 M22 L28 Q29	I21-N25 WeakPolarHBondContact CG2-ND2 3.35Å; I21-N25 VanDerWaalsContact O-CB 3.31Å; I21-N25 WeakPolarHBondContact O-CB 3.37Å; I21-N25 PolarHBondContact O-N 3.47Å; I21-N25 PolarHBondContact O-ND2 3.37Å; M22-N25 PolarHBondContact O-N 3.38Å; N25-L28 PolarHBondContact O-N 2.98Å; N25-Q29 VanDerWaalsContact O-CG 3.3Å; N25-Q29 WeakPolarHBondContact O-CG 3.34Å; N25-Q29 PolarHBondContact O-N 3.36Å
26	G	91.4	Very high	84.6	Confident	23 Å²	23	103.9 Å²	103.9	24%	0.237	53%	0.526	C	S	.	.	H	α-helix	trans	-63.5	-42.8	175.9	0	0	0	0	0	112.7	M22 L23 L28 Q29 N30	M22-G26 PolarHBondContact O-N 3.08Å; L23-G26 PolarHBondContact O-N 3.37Å; G26-L28 PolarHBondContact O-N 3.48Å; G26-Q29 PolarHBondContact O-N 3.1Å; G26-N30 WeakPolarHBondContact O-CB 3.29Å; G26-N30 VanDerWaalsContact O-CG 3.23Å; G26-N30 PolarHBondContact O-N 2.65Å; G26-N30 PolarHBondContact O-ND2 3.11Å
27	A	87.8	Confident	83.6	Confident	64 Å²	64	104.3 Å²	104.3	53%	0.529	52%	0.524	S	S	.	.	H	α-helix	trans	-62.5	-41.4	175.4	0	0	0	0	0	112.2	L23 R24 N30 R31	L23-A27 VanDerWaalsContact O-CB 3.29Å; L23-A27 WeakPolarHBondContact O-CB 3.48Å; L23-A27 PolarHBondContact O-N 3.48Å; R24-A27 PolarHBondContact O-N 3.04Å; A27-N30 PolarHBondContact O-N 3.47Å; A27-R31 PolarHBondContact O-N 3.1Å; A27-R31 VanDerWaalsContact O-N 3.1Å
28	L	84.5	Confident	82.2	Confident	92 Å²	92	105.2 Å²	105.2	48%	0.482	53%	0.526	S	S	.	.	H	α-helix	trans	-64.8	-42.5	176.5	-73.2	172.4	0	0	0	112.3	R24 N25 G26 N30 R31	R24-L28 HydrophobicContact CG-CD1 4.2Å; R24-L28 VanDerWaalsContact O-CG 3.29Å; R24-L28 WeakPolarHBondContact O-CG 3.3Å; R24-L28 PolarHBondContact O-N 2.9Å; N25-L28 PolarHBondContact O-N 2.98Å; G26-L28 PolarHBondContact O-N 3.48Å; L28-N30 VanDerWaalsContact C-N 3.3Å; L28-N30 PolarHBondContact O-N 3.41Å; L28-R31 VanDerWaalsContact O-CB 3.3Å; L28-R31 WeakPolarHBondContact O-CB 3.29Å; L28-R31 PolarHBondContact O-N 2.91Å
29	Q	86.9	Confident	81	Confident	138 Å²	138	105.6 Å²	105.6	65%	0.645	53%	0.528	S	S	*	.	H	α-helix	trans	-61.4	-40.7	175.3	-73.4	171.3	-5.3	0	0	111.3	N25 G26 R31 H32	N25-Q29 VanDerWaalsContact O-CG 3.3Å; N25-Q29 WeakPolarHBondContact O-CG 3.34Å; N25-Q29 PolarHBondContact O-N 3.36Å; G26-Q29 PolarHBondContact O-N 3.1Å; Q29-R31 VanDerWaalsContact C-N 3.29Å; Q29-R31 PolarHBondContact O-N 3.34Å; Q29-H32 PolarHBondContact O-CE1 3.36Å; Q29-H32 PolarHBondContact O-ND1 3.42Å
30	N	85.5	Confident	79.4	Confident	76 Å²	76	108.9 Å²	108.9	41%	0.406	54%	0.539	S	S	.	.	G	3₁₀ helix	trans	-81.6	-1.4	-178.3	-67.1	-14.9	0	0	0	114.1	G26 A27 L28 H32 L33 F34	G26-N30 WeakPolarHBondContact O-CB 3.29Å; G26-N30 VanDerWaalsContact O-CG 3.23Å; G26-N30 PolarHBondContact O-N 2.65Å; G26-N30 PolarHBondContact O-ND2 3.11Å; A27-N30 PolarHBondContact O-N 3.47Å; L28-N30 VanDerWaalsContact C-N 3.3Å; L28-N30 PolarHBondContact O-N 3.41Å; N30-H32 PolarHBondContact O-N 2.93Å; N30-H32 VanDerWaalsContact O-N 3.13Å; N30-L33 HydrophobicContact CB-CD1 3.95Å; N30-L33 WeakPolarHBondContact O-CB 3.29Å; N30-L33 PolarHBondContact O-N 2.7Å; N30-F34 WeakPolarHBondContact O-CD2 3.44Å
31	R	79.9	Confident	77.8	Confident	149 Å²	149	109.9 Å²	109.9	56%	0.562	54%	0.542	S	S	*	.	G	3₁₀ helix	trans	-54.4	-35.6	-178.1	-170.4	177.2	74.8	152.9	6	112.7	A27 L28 Q29 A35 E57	A27-R31 PolarHBondContact O-N 3.1Å; A27-R31 VanDerWaalsContact O-N 3.1Å; L28-R31 VanDerWaalsContact O-CB 3.3Å; L28-R31 WeakPolarHBondContact O-CB 3.29Å; L28-R31 PolarHBondContact O-N 2.91Å; Q29-R31 VanDerWaalsContact C-N 3.29Å; Q29-R31 PolarHBondContact O-N 3.34Å; R31-A35 PolarHBondContact O-N 3.49Å; R31-E57 IonicContact CZ-OE1 2.85Å; R31-E57 IonicContact NH1-OE1 2.85Å; R31-E57 IonicContact NH2-OE1 2.68Å; R31-E57 PolarHBondContact NH2-OE1 2.85Å
32	H	78.9	Confident	76.3	Confident	128 Å²	128	109 Å²	109	59%	0.593	54%	0.541	S	S	*	.	G	3₁₀ helix	trans	-70.6	-28.8	-179.7	71.3	-81.4	0	0	0	113.6	Q29 N30 F34 A35	Q29-H32 PolarHBondContact O-CE1 3.36Å; Q29-H32 PolarHBondContact O-ND1 3.42Å; N30-H32 PolarHBondContact O-N 2.93Å; N30-H32 VanDerWaalsContact O-N 3.13Å; H32-F34 PolarHBondContact O-N 3.02Å; H32-A35 WeakPolarHBondContact O-CB 3.21Å; H32-A35 PolarHBondContact O-N 2.93Å; H32-A35 VanDerWaalsContact O-N 3.13Å
33	L	78.1	Confident	74.7	Confident	108 Å²	108	109.8 Å²	109.8	57%	0.565	54%	0.544	S	S	*	.	G	3₁₀ helix	trans	-64.5	-28.7	-179.3	-66.4	167.9	0	0	0	112.1	N30	N30-L33 HydrophobicContact CB-CD1 3.95Å; N30-L33 WeakPolarHBondContact O-CB 3.29Å; N30-L33 PolarHBondContact O-N 2.7Å
34	F	68.9	Low	73.3	Confident	121 Å²	121	111.3 Å²	111.3	53%	0.531	55%	0.553	S	S	.	*	G	3₁₀ helix	trans	-105	4.9	178.5	-53.1	-76	0	0	0	112.3	N30 H32 E36 E37 N38	N30-F34 WeakPolarHBondContact O-CD2 3.44Å; H32-F34 PolarHBondContact O-N 3.02Å; F34-E36 VanDerWaalsContact C-N 3.27Å; F34-E36 PolarHBondContact O-N 2.88Å; F34-E37 PolarHBondContact O-N 3.35Å; F34-N38 WeakPolarHBondContact O-CB 3.48Å; F34-N38 PolarHBondContact O-N 2.94Å
35	A	67.8	Low	71.9	Confident	50 Å²	50	114 Å²	114	41%	0.413	56%	0.563	S	S	.	*	H	α-helix	trans	-63.1	-37	-177.6	0	0	0	0	0	111.4	R31 H32 N39	R31-A35 PolarHBondContact O-N 3.49Å; H32-A35 WeakPolarHBondContact O-CB 3.21Å; H32-A35 PolarHBondContact O-N 2.93Å; H32-A35 VanDerWaalsContact O-N 3.13Å; A35-N39 WeakPolarHBondContact O-CB 3.24Å; A35-N39 PolarHBondContact O-N 3.19Å
36	E	65.5	Low	70.4	Confident	165 Å²	165	119.3 Å²	119.3	77%	0.771	59%	0.588	S	S	*	*	H	α-helix	trans	-67	-43.1	176.4	-62.1	-174.4	169	0	0	111.9	F34 N39 Q40	F34-E36 VanDerWaalsContact C-N 3.27Å; F34-E36 PolarHBondContact O-N 2.88Å; E36-N39 PolarHBondContact O-N 2.84Å; E36-Q40 PolarHBondContact O-N 3.41Å
37	E	65	Low	69.2	Low	137 Å²	137	122.2 Å²	122.2	64%	0.64	60%	0.6	S	S	*	*	H	α-helix	trans	-66.3	-39.2	176.9	-172.3	-178.4	-178.6	0	0	111.9	F34 Q40 R41	F34-E37 PolarHBondContact O-N 3.35Å; E37-Q40 PolarHBondContact O-N 2.87Å; E37-R41 PolarHBondContact O-N 3.42Å
38	N	60.3	Low	68.2	Low	98 Å²	98	127.7 Å²	127.7	52%	0.524	62%	0.62	S	S	.	*	H	α-helix	trans	-71	-36.6	178.2	-157.6	5.3	0	0	0	111.4	F34 Q40 R41 S42	F34-N38 WeakPolarHBondContact O-CB 3.48Å; F34-N38 PolarHBondContact O-N 2.94Å; N38-Q40 VanDerWaalsContact C-N 3.31Å; N38-Q40 PolarHBondContact O-N 3.37Å; N38-R41 PolarHBondContact O-N 2.84Å; N38-R41 VanDerWaalsContact O-N 3.13Å; N38-S42 WeakPolarHBondContact O-CB 3.3Å; N38-S42 PolarHBondContact O-N 3.35Å; N38-S42 PolarHBondContact O-OG 3.04Å; N38-S42 VanDerWaalsContact O-OG 3.08Å
39	N	60	Low	67.4	Low	124 Å²	124	129 Å²	129	66%	0.663	63%	0.627	S	S	*	*	H	α-helix	trans	-60.6	-42.2	173.9	-122.8	6	0	0	0	111.6	A35 E36 R41 S42 E43	A35-N39 WeakPolarHBondContact O-CB 3.24Å; A35-N39 PolarHBondContact O-N 3.19Å; E36-N39 PolarHBondContact O-N 2.84Å; N39-R41 VanDerWaalsContact C-N 3.27Å; N39-R41 PolarHBondContact O-N 2.93Å; N39-S42 PolarHBondContact O-N 3.21Å; N39-E43 PolarHBondContact O-N 3.42Å
40	Q	58.1	Low	66.1	Low	140 Å²	140	128.2 Å²	128.2	65%	0.654	63%	0.633	S	S	*	*	H	α-helix	trans	-63.4	-33.7	176.4	-143	82.7	66.2	0	0	112.3	E36 E37 N38	E36-Q40 PolarHBondContact O-N 3.41Å; E37-Q40 PolarHBondContact O-N 2.87Å; N38-Q40 VanDerWaalsContact C-N 3.31Å; N38-Q40 PolarHBondContact O-N 3.37Å
41	R	58.7	Low	64.7	Low	173 Å²	173	130.5 Å²	130.5	65%	0.653	65%	0.645	S	S	*	*	H	α-helix	trans	-81.1	-27.2	178.5	-167	176.6	175.5	113.1	0.4	113.2	E37 N38 N39	E37-R41 PolarHBondContact O-N 3.42Å; N38-R41 PolarHBondContact O-N 2.84Å; N38-R41 VanDerWaalsContact O-N 3.13Å; N39-R41 VanDerWaalsContact C-N 3.27Å; N39-R41 PolarHBondContact O-N 2.93Å
42	S	58.1	Low	63.4	Low	53 Å²	53	131.2 Å²	131.2	37%	0.371	65%	0.654	S	S	.	*	H	α-helix	trans	-72.9	-32.5	176.1	-69.3	0	0	0	0	112.2	N38 N39 D44 R45	N38-S42 WeakPolarHBondContact O-CB 3.3Å; N38-S42 PolarHBondContact O-N 3.35Å; N38-S42 PolarHBondContact O-OG 3.04Å; N38-S42 VanDerWaalsContact O-OG 3.08Å; N39-S42 PolarHBondContact O-N 3.21Å; S42-D44 PolarHBondContact O-N 2.85Å; S42-R45 PolarHBondContact O-N 3.27Å; S42-R45 VanDerWaalsContact O-N 3.11Å
43	E	58.9	Low	62	Low	150 Å²	150	132 Å²	132	70%	0.701	66%	0.662	S	S	*	*	H	α-helix	trans	-62.6	-32.4	176	-155.7	168.7	-159.4	0	0	112.2	N39 R45	N39-E43 PolarHBondContact O-N 3.42Å; E43-R45 PolarHBondContact O-N 3.43Å
44	D	62.4	Low	60.6	Low	153 Å²	153	136.2 Å²	136.2	82%	0.818	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-7.8	176.8	-112.3	15.8	0	0	0	114	S42	S42-D44 PolarHBondContact O-N 2.85Å
45	R	62.4	Low	59.4	Low	185 Å²	185	137.1 Å²	137.1	70%	0.698	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.6	38.8	-179.1	-75.9	-168.8	163	-178.7	-4.4	113.4	S42 E43 T47	S42-R45 PolarHBondContact O-N 3.27Å; S42-R45 VanDerWaalsContact O-N 3.11Å; E43-R45 PolarHBondContact O-N 3.43Å; R45-T47 PolarHBondContact O-N 3.3Å
46	M	60.5	Low	58.6	Low	179 Å²	179	137.9 Å²	137.9	88%	0.882	69%	0.689	S	S	*	*			trans	-59.3	84.7	168.7	-167.6	91	-175	0	0	110.7
47	T	65.7	Low	57.9	Low	83 Å²	83	137 Å²	137	51%	0.509	69%	0.685	S	S	.	*			trans	-82.7	129.7	176.6	52.4	0	0	0	0	109.4	R45 I49	R45-T47 PolarHBondContact O-N 3.3Å; T47-I49 PolarHBondContact O-N 2.81Å; T47-I49 PolarHBondContact OG1-O 3.46Å
48	L	66.9	Low	57	Low	179 Å²	179	136.8 Å²	136.8	94%	0.937	69%	0.689	S	S	*	*	S	Bend	trans	-66.7	-2.1	174.8	-62.2	177.5	0	0	0	113.7
49	I	67	Low	56.3	Low	121 Å²	121	135.9 Å²	135.9	62%	0.621	69%	0.694	S	S	*	*	S	Bend	trans	-106.2	124.6	172	-58.1	171	0	0	0	105.6	T47 L51	T47-I49 PolarHBondContact O-N 2.81Å; T47-I49 PolarHBondContact OG1-O 3.46Å; I49-L51 VanDerWaalsContact C-N 3.3Å; I49-L51 PolarHBondContact O-N 3.29Å
50	P	58.7	Low	55.4	Low	121 Å²	121	134.2 Å²	134.2	79%	0.786	69%	0.688	S	S	*	*			trans	-60	99.5	164.4	-12.6	26	0	0	0	107.1	H52	P50-H52 PolarHBondContact O-N 3.46Å
51	L	57.1	Low	54.6	Low	124 Å²	124	132.6 Å²	132.6	65%	0.649	69%	0.693	S	S	*	*			trans	-67.5	112.6	156.9	-106.5	77.2	0	0	0	103.9	I49 D53	I49-L51 VanDerWaalsContact C-N 3.3Å; I49-L51 PolarHBondContact O-N 3.29Å; L51-D53 PolarHBondContact O-N 3.39Å
52	H	52	Low	54.1	Low	164 Å²	164	132.4 Å²	132.4	76%	0.759	69%	0.692	S	S	*	*			trans	-37.4	109.6	170.7	-179.8	73.4	0	0	0	109.3	P50 F54	P50-H52 PolarHBondContact O-N 3.46Å; H52-F54 PolarHBondContact O-N 3.47Å
53	D	49.8	Very low	53.7	Low	143 Å²	143	133.2 Å²	133.2	77%	0.765	70%	0.695	S	S	*	*			trans	-53.9	107	-168.2	-64.9	-53	0	0	0	109.8	L51 D55	L51-D53 PolarHBondContact O-N 3.39Å; D53-D55 PolarHBondContact O-N 3.42Å
54	F	50	Low	53.4	Low	198 Å²	198	132.3 Å²	132.3	87%	0.868	70%	0.695	S	S	*	*			trans	-81.1	6.6	169.3	-113.2	-87.9	0	0	0	111.8	H52 S56	H52-F54 PolarHBondContact O-N 3.47Å; F54-S56 PolarHBondContact O-N 3.37Å
55	D	42.4	Very low	53.1	Low	140 Å²	140	131.3 Å²	131.3	75%	0.749	69%	0.685	S	S	*	*			trans	-94.9	86.2	173.5	-90.1	-29.9	0	0	0	110.5	D53	D53-D55 PolarHBondContact O-N 3.42Å
56	S	52.3	Low	53.2	Low	65 Å²	65	132.2 Å²	132.2	46%	0.455	69%	0.689	S	S	.	*	S	Bend	trans	-166.3	133.3	140.3	-162.2	0	0	0	0	106.9	F54 N58 A59	F54-S56 PolarHBondContact O-N 3.37Å; S56-N58 CarbonylContact O-C 3.25Å; S56-N58 VanDerWaalsContact O-C 3.25Å; S56-N58 WeakPolarHBondContact O-CA 3.41Å; S56-N58 PolarHBondContact O-N 3.26Å; S56-A59 PolarHBondContact O-N 3.28Å
57	E	48.9	Very low	53.8	Low	146 Å²	146	128.4 Å²	128.4	68%	0.682	67%	0.671	S	S	*	*	S	Bend	trans	-9.4	-17.5	134.7	11.9	-110.9	64.6	0	0	119.1	R31 A59	R31-E57 IonicContact CZ-OE1 2.85Å; R31-E57 IonicContact NH1-OE1 2.85Å; R31-E57 IonicContact NH2-OE1 2.68Å; R31-E57 PolarHBondContact NH2-OE1 2.85Å; E57-A59 PolarHBondContact O-N 2.85Å; E57-A59 VanDerWaalsContact O-N 3.1Å
58	N	46.6	Very low	54.4	Low	134 Å²	134	127.7 Å²	127.7	72%	0.717	67%	0.667	S	S	*	*			trans	-73.7	51.3	155.5	-67.5	12.4	0	0	0	114.5	S56 V60	S56-N58 CarbonylContact O-C 3.25Å; S56-N58 VanDerWaalsContact O-C 3.25Å; S56-N58 WeakPolarHBondContact O-CA 3.41Å; S56-N58 PolarHBondContact O-N 3.26Å; N58-V60 PolarHBondContact O-N 2.94Å
59	A	46.4	Very low	55.1	Low	78 Å²	78	122.4 Å²	122.4	65%	0.645	64%	0.644	S	S	*	*			trans	-40.5	135.9	134.3	0	0	0	0	0	108.5	S56 E57	S56-A59 PolarHBondContact O-N 3.28Å; E57-A59 PolarHBondContact O-N 2.85Å; E57-A59 VanDerWaalsContact O-N 3.1Å
60	V	40.9	Very low	55.6	Low	89 Å²	89	124.6 Å²	124.6	54%	0.539	65%	0.652	S	S	.	*			trans	87.8	89.7	173.4	-161.6	0	0	0	0	113.2	N58 T63	N58-V60 PolarHBondContact O-N 2.94Å; V60-T63 HydrophobicContact CG1-CG2 3.33Å
61	S	41.6	Very low	56.8	Low	106 Å²	106	126.5 Å²	126.5	74%	0.741	64%	0.643	S	S	*	*				-130.5	47.2	87	-56.4	0	0	0	0	114.4	T63	S61-T63 PolarHBondContact O-N 2.68Å
62	R	48	Very low	58.1	Low	169 Å²	169	122.4 Å²	122.4	64%	0.638	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.4	25.2	150	-118.1	179.4	167.1	-166.9	-15.7	111.8	D64 E65 R66	R62-D64 PolarHBondContact O-N 3.46Å; R62-E65 HydrophobicContact CG-CB 4.19Å; R62-E65 HydrophobicContact CG-CG 4.08Å; R62-E65 WeakPolarHBondContact CG-OE1 3.37Å; R62-E65 IonicContact CZ-OE1 3.72Å; R62-E65 IonicContact CZ-OE2 3.86Å; R62-E65 IonicContact NE-OE1 3.46Å; R62-E65 PolarHBondContact NE-OE1 2.92Å; R62-E65 IonicContact NE-OE2 2.73Å; R62-E65 PolarHBondContact NE-OE2 3.38Å; R62-E65 IonicContact NH2-OE1 3.6Å; R62-E65 PolarHBondContact NH2-OE1 3.12Å; R62-E65 IonicContact NH2-OE2 3.06Å; R62-E65 PolarHBondContact NH2-OE2 3.44Å; R62-E65 PolarHBondContact O-N 3.38Å; R62-R66 PolarHBondContact O-N 3.06Å
63	T	49.5	Very low	59.2	Low	71 Å²	71	119.5 Å²	119.5	44%	0.436	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.3	-23.8	176.5	48.4	0	0	0	0	111.3	V60 S61 I67	V60-T63 HydrophobicContact CG1-CG2 3.33Å; S61-T63 PolarHBondContact O-N 2.68Å; T63-I67 VanDerWaalsContact O-CD1 3.3Å; T63-I67 WeakPolarHBondContact O-CD1 3.27Å
64	D	51.6	Low	60.5	Low	131 Å²	131	116.4 Å²	116.4	70%	0.701	60%	0.596	S	S	*	*	S	Bend	trans	-76.3	-34.5	178	-152	18.9	0	0	0	112.5	R62 R66 I67	R62-D64 PolarHBondContact O-N 3.46Å; D64-R66 VanDerWaalsContact C-N 3.28Å; D64-R66 PolarHBondContact O-N 3.3Å; D64-I67 PolarHBondContact O-N 3.01Å
65	E	56.8	Low	61.7	Low	131 Å²	131	111.7 Å²	111.7	61%	0.612	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.7	-9.6	175.7	-63.3	-174.6	-139.5	0	0	114	R62	R62-E65 HydrophobicContact CG-CB 4.19Å; R62-E65 HydrophobicContact CG-CG 4.08Å; R62-E65 WeakPolarHBondContact CG-OE1 3.37Å; R62-E65 IonicContact CZ-OE1 3.72Å; R62-E65 IonicContact CZ-OE2 3.86Å; R62-E65 IonicContact NE-OE1 3.46Å; R62-E65 PolarHBondContact NE-OE1 2.92Å; R62-E65 IonicContact NE-OE2 2.73Å; R62-E65 PolarHBondContact NE-OE2 3.38Å; R62-E65 IonicContact NH2-OE1 3.6Å; R62-E65 PolarHBondContact NH2-OE1 3.12Å; R62-E65 IonicContact NH2-OE2 3.06Å; R62-E65 PolarHBondContact NH2-OE2 3.44Å; R62-E65 PolarHBondContact O-N 3.38Å
66	R	63.7	Low	63.3	Low	204 Å²	204	110.6 Å²	110.6	77%	0.77	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-17.5	174.8	-78.2	-171.4	178.8	177	2.1	113	R62 D64 P68	R62-R66 PolarHBondContact O-N 3.06Å; D64-R66 VanDerWaalsContact C-N 3.28Å; D64-R66 PolarHBondContact O-N 3.3Å; R66-P68 WeakPolarHBondContact O-CD 3.48Å
67	I	73.4	Confident	64.3	Low	99 Å²	99	115.4 Å²	115.4	51%	0.508	59%	0.588	S	S	.	*	S	Bend	trans	-76.4	123.2	172.9	-65.8	143.2	0	0	0	105.6	T63 D64	T63-I67 VanDerWaalsContact O-CD1 3.3Å; T63-I67 WeakPolarHBondContact O-CD1 3.27Å; D64-I67 PolarHBondContact O-N 3.01Å
68	P	79.2	Confident	65.7	Low	68 Å²	68	115 Å²	115	44%	0.442	59%	0.589	S	S	.	*	P	Polyproline II helix	trans	-50.3	129.8	171.6	-24.1	33.5	0	0	0	108.2	R66 V72	R66-P68 WeakPolarHBondContact O-CD 3.48Å; P68-V72 HydrophobicContact CB-CB 3.8Å; P68-V72 HydrophobicContact CB-CG1 3.87Å; P68-V72 HydrophobicContact CB-CG2 3.86Å
69	P	80.5	Confident	66.5	Low	68 Å²	68	119.8 Å²	119.8	44%	0.442	61%	0.607	S	S	.	*	P	Polyproline II helix	trans	-51.7	150.7	176.7	-28.5	35	0	0	0	111.2	W71 V72	P69-W71 VanDerWaalsContact CB-CD1 3.44Å; P69-W71 HydrophobicContact CB-CD2 4.39Å; P69-W71 HydrophobicContact CB-CG 4.19Å; P69-W71 HydrophobicContact CB-CZ2 4.39Å; P69-W71 HydrophobicContact CG-CZ2 4.17Å; P69-W71 PolarHBondContact O-N 3.13Å; P69-V72 VanDerWaalsContact O-CB 3.24Å; P69-V72 WeakPolarHBondContact O-CB 3.33Å; P69-V72 WeakPolarHBondContact O-CG2 3.24Å; P69-V72 PolarHBondContact O-N 2.82Å
70	E	79.3	Confident	67.5	Low	168 Å²	168	121.9 Å²	121.9	79%	0.785	61%	0.606	S	S	*	*	H	α-helix	trans	-50	-36.4	-176.4	-171.8	-167.1	179.7	0	0	113.6	V72 H73	E70-V72 PolarHBondContact O-N 3.48Å; E70-V72 VanDerWaalsContact O-N 3.13Å; E70-H73 WeakPolarHBondContact O-CB 3.39Å; E70-H73 PolarHBondContact O-N 2.72Å
71	W	83.5	Confident	68.9	Low	161 Å²	161	123.6 Å²	123.6	61%	0.61	61%	0.609	S	S	*	*	H	α-helix	trans	-61.4	-20.9	177.7	63.9	-105.1	0	0	0	114	P69 H73 V74 I75	P69-W71 VanDerWaalsContact CB-CD1 3.44Å; P69-W71 HydrophobicContact CB-CD2 4.39Å; P69-W71 HydrophobicContact CB-CG 4.19Å; P69-W71 HydrophobicContact CB-CZ2 4.39Å; P69-W71 HydrophobicContact CG-CZ2 4.17Å; P69-W71 PolarHBondContact O-N 3.13Å; W71-H73 VanDerWaalsContact C-N 3.27Å; W71-H73 PolarHBondContact O-N 3.22Å; W71-V74 WeakPolarHBondContact O-CB 3.46Å; W71-V74 PolarHBondContact O-N 3.42Å; W71-I75 HydrophobicContact CE3-CD1 3.9Å; W71-I75 HydrophobicContact CZ3-CD1 3.67Å
72	V	83	Confident	70.4	Confident	37 Å²	37	124.6 Å²	124.6	22%	0.224	60%	0.602	C	S	.	*	H	α-helix	trans	-64.7	-35.7	174.5	179.1	0	0	0	0	110.2	P68 P69 E70 V74 I75 D76	P68-V72 HydrophobicContact CB-CB 3.8Å; P68-V72 HydrophobicContact CB-CG1 3.87Å; P68-V72 HydrophobicContact CB-CG2 3.86Å; P69-V72 VanDerWaalsContact O-CB 3.24Å; P69-V72 WeakPolarHBondContact O-CB 3.33Å; P69-V72 WeakPolarHBondContact O-CG2 3.24Å; P69-V72 PolarHBondContact O-N 2.82Å; E70-V72 PolarHBondContact O-N 3.48Å; E70-V72 VanDerWaalsContact O-N 3.13Å; V72-V74 VanDerWaalsContact C-N 3.29Å; V72-V74 PolarHBondContact O-N 3.01Å; V72-I75 WeakPolarHBondContact O-CB 3.41Å; V72-I75 PolarHBondContact O-N 3.49Å; V72-I75 VanDerWaalsContact O-N 3.15Å; V72-D76 PolarHBondContact O-N 3.28Å
73	H	76.6	Confident	71.7	Confident	103 Å²	103	122 Å²	122	48%	0.477	60%	0.6	S	S	.	*	H	α-helix	trans	-66.6	-30.6	176.1	-62.7	-53.5	0	0	0	112.8	E70 W71 I75 D76 E77	E70-H73 WeakPolarHBondContact O-CB 3.39Å; E70-H73 PolarHBondContact O-N 2.72Å; W71-H73 VanDerWaalsContact C-N 3.27Å; W71-H73 PolarHBondContact O-N 3.22Å; H73-I75 PolarHBondContact O-N 3.45Å; H73-D76 PolarHBondContact O-N 3.15Å; H73-E77 PolarHBondContact O-N 3.41Å
74	V	76.4	Confident	73.1	Confident	78 Å²	78	125.2 Å²	125.2	47%	0.473	61%	0.61	S	S	.	*	H	α-helix	trans	-63.6	-30.7	174.7	-177.5	0	0	0	0	111.2	W71 V72 I78	W71-V74 WeakPolarHBondContact O-CB 3.46Å; W71-V74 PolarHBondContact O-N 3.42Å; V72-V74 VanDerWaalsContact C-N 3.29Å; V72-V74 PolarHBondContact O-N 3.01Å; V74-I78 HydrophobicContact CG1-CD1 4.03Å; V74-I78 WeakPolarHBondContact O-CD1 3.26Å; V74-I78 VanDerWaalsContact O-CG1 3.26Å; V74-I78 WeakPolarHBondContact O-CG1 3.21Å
75	I	74.4	Confident	74.6	Confident	100 Å²	100	124.8 Å²	124.8	51%	0.513	60%	0.604	S	S	.	*	H	α-helix	trans	-71.3	-39.1	176.5	-59.5	177.9	0	0	0	110.8	W71 V72 H73 E77 I78	W71-I75 HydrophobicContact CE3-CD1 3.9Å; W71-I75 HydrophobicContact CZ3-CD1 3.67Å; V72-I75 WeakPolarHBondContact O-CB 3.41Å; V72-I75 PolarHBondContact O-N 3.49Å; V72-I75 VanDerWaalsContact O-N 3.15Å; H73-I75 PolarHBondContact O-N 3.45Å; I75-E77 VanDerWaalsContact C-N 3.29Å; I75-E77 PolarHBondContact O-N 3.25Å; I75-I78 PolarHBondContact O-N 3.2Å
76	D	76.6	Confident	75.8	Confident	116 Å²	116	124.4 Å²	124.4	62%	0.62	60%	0.603	S	S	*	*	H	α-helix	trans	-66.4	-29.1	178.1	-78.9	-19.1	0	0	0	112.6	V72 H73 I78	V72-D76 PolarHBondContact O-N 3.28Å; H73-D76 PolarHBondContact O-N 3.15Å; D76-I78 VanDerWaalsContact C-N 3.32Å; D76-I78 PolarHBondContact O-N 3.34Å
77	E	74.2	Confident	76.8	Confident	167 Å²	167	118.2 Å²	118.2	78%	0.78	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-16.3	177.2	-72.3	-177	175.5	0	0	114.1	H73 I75	H73-E77 PolarHBondContact O-N 3.41Å; I75-E77 VanDerWaalsContact C-N 3.29Å; I75-E77 PolarHBondContact O-N 3.25Å
78	I	77.4	Confident	77	Confident	137 Å²	137	119.8 Å²	119.8	70%	0.703	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	-6.2	-173.2	-62.4	166.6	0	0	0	112.6	V74 I75 D76	V74-I78 HydrophobicContact CG1-CD1 4.03Å; V74-I78 WeakPolarHBondContact O-CD1 3.26Å; V74-I78 VanDerWaalsContact O-CG1 3.26Å; V74-I78 WeakPolarHBondContact O-CG1 3.21Å; I75-I78 PolarHBondContact O-N 3.2Å; D76-I78 VanDerWaalsContact C-N 3.32Å; D76-I78 PolarHBondContact O-N 3.34Å
79	Q	63.5	Low	76.8	Confident	235 Å²	235	124.5 Å²	124.5	100%	1.098	61%	0.611	S	S	*	*			trans	-94.2	0	-177.4	-163	-175.2	-89.9	0	0	113.4

Retrieved 79 of 79 residues in 31.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).