A0A077ZJM3_TRITR Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A077ZJM3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 90 aa.

						>A0A077ZJM3_TRITR|A0A077ZJM3
MDDFSHSADMNKMDAKQRDDLVTRVKQQVVLANVQELLQNISDKCLKLCIKKPGKTLDGSEQKCLSYCVDRYIETMNLVAATYRQRLQQG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.8	Very low	58.2	Low	232 Å²	232	130.8 Å²	130.8	100%	1.143	71%	0.711	S	S	*	*				0	70.9	0	-85.4	173.1	169.4	0	0	105.4
2	D	43.4	Very low	60.3	Low	162 Å²	162	133.3 Å²	133.3	87%	0.866	71%	0.71	S	S	*	*			trans	-136.9	72	-161.6	-58.8	-85.3	0	0	0	109.1
3	D	50.9	Low	62.2	Low	125 Å²	125	126 Å²	126	67%	0.668	67%	0.67	S	S	*	*			trans	-150.4	69.1	167.8	-167	-116.1	0	0	0	110	H6	D3-H6 IonicContact OD2-ND1 3.99Å
4	F	54.2	Low	64.1	Low	204 Å²	204	123.2 Å²	123.2	90%	0.895	66%	0.655	S	S	*	*			trans	-139.6	19.6	170.2	-121.9	-85.4	0	0	0	113
5	S	53	Low	65.8	Low	106 Å²	106	120.5 Å²	120.5	74%	0.741	66%	0.657	S	S	*	*			trans	-108.8	34.8	-174.3	-154.9	0	0	0	0	114.2
6	H	61.7	Low	67.4	Low	149 Å²	149	122.4 Å²	122.4	69%	0.69	66%	0.657	S	S	*	*			trans	-102.1	-6	176	-82.7	96.1	0	0	0	114.6	D3	D3-H6 IonicContact OD2-ND1 3.99Å
7	S	60.8	Low	68.9	Low	100 Å²	100	121 Å²	121	70%	0.699	65%	0.645	S	S	*	*	G	3₁₀ helix	trans	-77	-24.5	179.9	-52.8	0	0	0	0	113.7	D9	S7-D9 PolarHBondContact O-N 3.47Å
8	A	59.6	Low	70.1	Confident	73 Å²	73	119.4 Å²	119.4	60%	0.603	63%	0.629	S	S	*	*	G	3₁₀ helix	trans	-77.1	-17.1	-173.3	0	0	0	0	0	114.3
9	D	67.9	Low	71.3	Confident	83 Å²	83	118.3 Å²	118.3	44%	0.444	62%	0.624	S	S	.	*	G	3₁₀ helix	trans	-95.5	-6.9	-173.5	-116.2	-83.1	0	0	0	114.5	S7 N11 K12	S7-D9 PolarHBondContact O-N 3.47Å; D9-N11 PolarHBondContact O-N 3Å; D9-K12 PolarHBondContact O-N 2.91Å; D9-K12 IonicContact OD2-NZ 3.59Å
10	M	71	Confident	72.4	Confident	66 Å²	66	116.4 Å²	116.4	33%	0.325	61%	0.614	S	S	.	*	T	Hydrogen-bonded Turn	trans	-56.1	-30.9	176	-71.6	-61.8	-67.1	0	0	112.9	M13 R18 L21	M10-M13 HydrophobicContact CE-CE 3.72Å; M10-M13 HydrophobicContact SD-CE 3.41Å; M10-M13 WeakPolarHBondContact SD-CE 3.37Å; M10-M13 HydrophobicContact SD-SD 4.49Å; M10-R18 PolarHBondContact O-NE 2.88Å; M10-R18 PolarHBondContact O-NH2 3.19Å; M10-L21 HydrophobicContact CE-CD2 3.98Å; M10-L21 HydrophobicContact SD-CD2 3.23Å; M10-L21 WeakPolarHBondContact SD-CD2 3.34Å
11	N	79.1	Confident	73.4	Confident	139 Å²	139	113 Å²	113	74%	0.743	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-16.4	-179.2	-77.9	-35.1	0	0	0	115.2	D9 R18	D9-N11 PolarHBondContact O-N 3Å; N11-R18 VanDerWaalsContact CA-NH2 3.35Å; N11-R18 PolarHBondContact OD1-NH2 3.49Å
12	K	83.8	Confident	76	Confident	161 Å²	161	104.7 Å²	104.7	70%	0.7	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.9	-9.7	179.8	-62.7	-179.4	-168.6	159.3	0	113.6	D9	D9-K12 PolarHBondContact O-N 2.91Å; D9-K12 IonicContact OD2-NZ 3.59Å
13	M	84	Confident	78.4	Confident	38 Å²	38	99.7 Å²	99.7	19%	0.187	53%	0.533	C	S	.	.	S	Bend	trans	-79.2	142.3	178.8	-64.9	-173.9	-35.4	0	0	111.4	M10 Q17 R18 L21	M10-M13 HydrophobicContact CE-CE 3.72Å; M10-M13 HydrophobicContact SD-CE 3.41Å; M10-M13 WeakPolarHBondContact SD-CE 3.37Å; M10-M13 HydrophobicContact SD-SD 4.49Å; M13-Q17 HydrophobicContact CB-CB 3.88Å; M13-Q17 HydrophobicContact CG-CB 4.34Å; M13-Q17 HydrophobicContact SD-CB 4.47Å; M13-R18 HydrophobicContact CB-CG 3.82Å; M13-R18 HydrophobicContact CE-CB 4.19Å; M13-R18 HydrophobicContact CE-CG 3.48Å; M13-R18 VanDerWaalsContact CE-CG 3.48Å; M13-L21 HydrophobicContact CE-CB 4.42Å; M13-L21 HydrophobicContact CE-CD2 3.75Å; M13-L21 HydrophobicContact SD-CD2 4.16Å
14	D	89.4	Confident	80.3	Confident	87 Å²	87	101.3 Å²	101.3	47%	0.465	53%	0.53	S	S	.	.			trans	-67.9	167.2	169.5	72.4	62.9	0	0	0	111.7	K16 Q17 R18	D14-K16 PolarHBondContact O-N 3.22Å; D14-K16 WeakPolarHBondContact OD1-CA 3.26Å; D14-K16 VanDerWaalsContact OD1-CB 3.26Å; D14-K16 WeakPolarHBondContact OD1-CB 3.31Å; D14-K16 PolarHBondContact OD1-N 2.78Å; D14-Q17 PolarHBondContact O-N 3.13Å; D14-Q17 PolarHBondContact OD1-N 3.26Å; D14-Q17 WeakPolarHBondContact OD2-CG 3.37Å; D14-Q17 PolarHBondContact OD2-OE1 2.87Å; D14-R18 WeakPolarHBondContact O-CG 3.47Å; D14-R18 PolarHBondContact O-N 3.29Å
15	A	89.7	Confident	82.2	Confident	83 Å²	83	95 Å²	95	69%	0.686	51%	0.508	S	S	*	.	H	α-helix	trans	-58.7	-33.7	-175.8	0	0	0	0	0	113.4	D19	A15-D19 PolarHBondContact O-N 3.03Å; A15-D19 VanDerWaalsContact O-N 3.11Å
16	K	91.8	Very high	84.2	Confident	151 Å²	151	96.1 Å²	96.1	66%	0.657	50%	0.5	S	S	*	.	H	α-helix	trans	-73.7	-45.4	179.2	-175.3	-176.8	177.1	-177.3	0	110.9	D14 R18 D19 D20	D14-K16 PolarHBondContact O-N 3.22Å; D14-K16 WeakPolarHBondContact OD1-CA 3.26Å; D14-K16 VanDerWaalsContact OD1-CB 3.26Å; D14-K16 WeakPolarHBondContact OD1-CB 3.31Å; D14-K16 PolarHBondContact OD1-N 2.78Å; K16-R18 PolarHBondContact O-N 3.47Å; K16-D19 PolarHBondContact O-N 2.86Å; K16-D20 PolarHBondContact O-N 3.34Å
17	Q	92.5	Very high	85.8	Confident	98 Å²	98	95.3 Å²	95.3	46%	0.458	50%	0.496	S	S	.	.	H	α-helix	trans	-58.5	-38	174.9	-70.8	179.3	-60.2	0	0	112.2	M13 D14 L21	M13-Q17 HydrophobicContact CB-CB 3.88Å; M13-Q17 HydrophobicContact CG-CB 4.34Å; M13-Q17 HydrophobicContact SD-CB 4.47Å; D14-Q17 PolarHBondContact O-N 3.13Å; D14-Q17 PolarHBondContact OD1-N 3.26Å; D14-Q17 WeakPolarHBondContact OD2-CG 3.37Å; D14-Q17 PolarHBondContact OD2-OE1 2.87Å; Q17-L21 WeakPolarHBondContact O-CB 3.25Å; Q17-L21 PolarHBondContact O-N 2.9Å
18	R	91.5	Very high	87.3	Confident	92 Å²	92	97.2 Å²	97.2	35%	0.347	49%	0.494	S	S	.	.	H	α-helix	trans	-64	-47	174.6	-73.9	171.2	149.2	-178.3	-14.9	112.5	M10 N11 M13 D14 K16 L21 V22	M10-R18 PolarHBondContact O-NE 2.88Å; M10-R18 PolarHBondContact O-NH2 3.19Å; N11-R18 VanDerWaalsContact CA-NH2 3.35Å; N11-R18 PolarHBondContact OD1-NH2 3.49Å; M13-R18 HydrophobicContact CB-CG 3.82Å; M13-R18 HydrophobicContact CE-CB 4.19Å; M13-R18 HydrophobicContact CE-CG 3.48Å; M13-R18 VanDerWaalsContact CE-CG 3.48Å; D14-R18 WeakPolarHBondContact O-CG 3.47Å; D14-R18 PolarHBondContact O-N 3.29Å; K16-R18 PolarHBondContact O-N 3.47Å; R18-L21 PolarHBondContact O-N 3.47Å; R18-V22 VanDerWaalsContact O-CG2 3.32Å; R18-V22 WeakPolarHBondContact O-CG2 3.31Å; R18-V22 PolarHBondContact O-N 2.86Å
19	D	92.5	Very high	89.1	Confident	99 Å²	99	97.1 Å²	97.1	53%	0.529	49%	0.486	S	S	.	.	H	α-helix	trans	-64.9	-44	179.5	-171.7	61.1	0	0	0	112.1	A15 K16 L21 V22 T23	A15-D19 PolarHBondContact O-N 3.03Å; A15-D19 VanDerWaalsContact O-N 3.11Å; K16-D19 PolarHBondContact O-N 2.86Å; D19-L21 VanDerWaalsContact C-N 3.32Å; D19-L21 PolarHBondContact O-N 3.47Å; D19-V22 PolarHBondContact O-N 3.15Å; D19-T23 WeakPolarHBondContact O-CB 3.02Å; D19-T23 PolarHBondContact O-N 3.39Å; D19-T23 PolarHBondContact O-OG1 3.45Å
20	D	93.1	Very high	90.3	Very high	80 Å²	80	97.6 Å²	97.6	43%	0.428	49%	0.491	S	S	.	.	H	α-helix	trans	-58.5	-44.6	174.9	-75.3	-20.8	0	0	0	110.9	K16 T23 R24	K16-D20 PolarHBondContact O-N 3.34Å; D20-T23 PolarHBondContact O-N 3.33Å; D20-R24 WeakPolarHBondContact O-CG 3.25Å; D20-R24 PolarHBondContact O-N 3.36Å
21	L	92.4	Very high	91.5	Very high	46 Å²	46	100.1 Å²	100.1	24%	0.241	51%	0.506	C	S	.	.	H	α-helix	trans	-65.8	-46.3	177.3	-178.3	66.1	0	0	0	112.2	M10 M13 Q17 R18 D19 T23 R24 V25	M10-L21 HydrophobicContact CE-CD2 3.98Å; M10-L21 HydrophobicContact SD-CD2 3.23Å; M10-L21 WeakPolarHBondContact SD-CD2 3.34Å; M13-L21 HydrophobicContact CE-CB 4.42Å; M13-L21 HydrophobicContact CE-CD2 3.75Å; M13-L21 HydrophobicContact SD-CD2 4.16Å; Q17-L21 WeakPolarHBondContact O-CB 3.25Å; Q17-L21 PolarHBondContact O-N 2.9Å; R18-L21 PolarHBondContact O-N 3.47Å; D19-L21 VanDerWaalsContact C-N 3.32Å; D19-L21 PolarHBondContact O-N 3.47Å; L21-T23 PolarHBondContact O-N 3.38Å; L21-R24 PolarHBondContact O-N 3.19Å; L21-R24 VanDerWaalsContact O-N 3.15Å; L21-V25 HydrophobicContact CD1-CG2 4.28Å; L21-V25 HydrophobicContact CG-CG2 4.31Å; L21-V25 WeakPolarHBondContact O-CG2 3.27Å; L21-V25 PolarHBondContact O-N 2.04Å
22	V	93.3	Very high	92.3	Very high	57 Å²	57	95.9 Å²	95.9	35%	0.345	49%	0.49	S	S	.	.	H	α-helix	trans	-58.2	-40.1	177.2	167.1	0	0	0	0	110.5	R18 D19 V25 K26	R18-V22 VanDerWaalsContact O-CG2 3.32Å; R18-V22 WeakPolarHBondContact O-CG2 3.31Å; R18-V22 PolarHBondContact O-N 2.86Å; D19-V22 PolarHBondContact O-N 3.15Å; V22-V25 PolarHBondContact O-N 3.44Å; V22-K26 HydrophobicContact CG1-CD 4.09Å; V22-K26 HydrophobicContact CG1-CG 4.45Å; V22-K26 WeakPolarHBondContact O-CB 3.07Å; V22-K26 VanDerWaalsContact O-CG 3.29Å; V22-K26 WeakPolarHBondContact O-CG 3.18Å; V22-K26 PolarHBondContact O-N 2.95Å
23	T	94.3	Very high	92.8	Very high	57 Å²	57	92.5 Å²	92.5	35%	0.35	48%	0.48	S	S	.	.	H	α-helix	trans	-63.1	-45.8	176.1	-64.2	0	0	0	0	111.7	D19 D20 L21 V25 K26 Q27	D19-T23 WeakPolarHBondContact O-CB 3.02Å; D19-T23 PolarHBondContact O-N 3.39Å; D19-T23 PolarHBondContact O-OG1 3.45Å; D20-T23 PolarHBondContact O-N 3.33Å; L21-T23 PolarHBondContact O-N 3.38Å; T23-V25 PolarHBondContact O-N 3.42Å; T23-K26 PolarHBondContact O-N 3.22Å; T23-Q27 WeakPolarHBondContact O-CG 3.44Å; T23-Q27 PolarHBondContact O-N 2.82Å; T23-Q27 VanDerWaalsContact O-N 3.08Å
24	R	91.3	Very high	93.4	Very high	159 Å²	159	94.1 Å²	94.1	60%	0.6	49%	0.491	S	S	*	.	H	α-helix	trans	-61.9	-43.6	175.1	-70.3	-159.7	-61.1	-127.9	3.7	112.5	D20 L21 K26 Q27 Q28	D20-R24 WeakPolarHBondContact O-CG 3.25Å; D20-R24 PolarHBondContact O-N 3.36Å; L21-R24 PolarHBondContact O-N 3.19Å; L21-R24 VanDerWaalsContact O-N 3.15Å; R24-K26 PolarHBondContact O-N 3.48Å; R24-Q27 PolarHBondContact O-N 2.71Å; R24-Q28 PolarHBondContact O-N 3.43Å
25	V	94.9	Very high	93.8	Very high	70 Å²	70	95.3 Å²	95.3	42%	0.424	49%	0.494	S	S	.	.	H	α-helix	trans	-61.5	-45.2	177.5	171.1	0	0	0	0	110.5	L21 V22 T23 Q27 Q28 V29	L21-V25 HydrophobicContact CD1-CG2 4.28Å; L21-V25 HydrophobicContact CG-CG2 4.31Å; L21-V25 WeakPolarHBondContact O-CG2 3.27Å; L21-V25 PolarHBondContact O-N 2.04Å; V22-V25 PolarHBondContact O-N 3.44Å; T23-V25 PolarHBondContact O-N 3.42Å; V25-Q27 VanDerWaalsContact C-N 3.33Å; V25-Q27 PolarHBondContact O-N 3.42Å; V25-Q28 PolarHBondContact O-N 3.32Å; V25-V29 HydrophobicContact CG1-CG2 4.24Å; V25-V29 VanDerWaalsContact O-CG2 3.3Å; V25-V29 WeakPolarHBondContact O-CG2 3.26Å; V25-V29 PolarHBondContact O-N 3.39Å
26	K	94.3	Very high	94.1	Very high	131 Å²	131	96.7 Å²	96.7	57%	0.57	49%	0.486	S	S	*	.	H	α-helix	trans	-57.5	-45.2	176.3	-76.5	171.7	178.9	173.2	0	112	V22 T23 R24 V29 V30	V22-K26 HydrophobicContact CG1-CD 4.09Å; V22-K26 HydrophobicContact CG1-CG 4.45Å; V22-K26 WeakPolarHBondContact O-CB 3.07Å; V22-K26 VanDerWaalsContact O-CG 3.29Å; V22-K26 WeakPolarHBondContact O-CG 3.18Å; V22-K26 PolarHBondContact O-N 2.95Å; T23-K26 PolarHBondContact O-N 3.22Å; R24-K26 PolarHBondContact O-N 3.48Å; K26-V29 PolarHBondContact O-N 2.88Å; K26-V30 WeakPolarHBondContact O-CG2 3.07Å; K26-V30 PolarHBondContact O-N 3.5Å
27	Q	94.3	Very high	94.4	Very high	131 Å²	131	92.6 Å²	92.6	61%	0.612	47%	0.471	S	S	*	.	H	α-helix	trans	-62.2	-43.4	177.6	-71.4	174.9	-18.8	0	0	111.9	T23 R24 V25 V30 L31	T23-Q27 WeakPolarHBondContact O-CG 3.44Å; T23-Q27 PolarHBondContact O-N 2.82Å; T23-Q27 VanDerWaalsContact O-N 3.08Å; R24-Q27 PolarHBondContact O-N 2.71Å; V25-Q27 VanDerWaalsContact C-N 3.33Å; V25-Q27 PolarHBondContact O-N 3.42Å; Q27-V30 PolarHBondContact O-N 2.92Å; Q27-L31 PolarHBondContact O-N 3.24Å
28	Q	94	Very high	94.6	Very high	140 Å²	140	92.8 Å²	92.8	65%	0.654	48%	0.475	S	S	*	.	H	α-helix	trans	-65.6	-41.1	178.7	-171.6	176.1	3	0	0	112.2	R24 V25 L31 A32	R24-Q28 PolarHBondContact O-N 3.43Å; V25-Q28 PolarHBondContact O-N 3.32Å; Q28-L31 PolarHBondContact O-N 2.84Å; Q28-A32 WeakPolarHBondContact O-CB 3.12Å; Q28-A32 PolarHBondContact O-N 3.21Å
29	V	95.6	Very high	94.9	Very high	71 Å²	71	94 Å²	94	43%	0.43	48%	0.484	S	S	.	.	H	α-helix	trans	-61.8	-43.7	175.7	169.8	0	0	0	0	110.8	V25 K26 L31 A32 N33	V25-V29 HydrophobicContact CG1-CG2 4.24Å; V25-V29 VanDerWaalsContact O-CG2 3.3Å; V25-V29 WeakPolarHBondContact O-CG2 3.26Å; V25-V29 PolarHBondContact O-N 3.39Å; K26-V29 PolarHBondContact O-N 2.88Å; V29-L31 PolarHBondContact O-N 2.04Å; V29-A32 PolarHBondContact O-N 3.46Å; V29-N33 WeakPolarHBondContact O-CB 3.4Å; V29-N33 PolarHBondContact O-N 3.05Å; V29-N33 PolarHBondContact O-OD1 2.92Å
30	V	93.6	Very high	95.2	Very high	93 Å²	93	92 Å²	92	56%	0.564	47%	0.474	S	S	*	.	H	α-helix	trans	-60.3	-47	176.4	171.8	0	0	0	0	110.9	K26 Q27 A32 N33 V34	K26-V30 WeakPolarHBondContact O-CG2 3.07Å; K26-V30 PolarHBondContact O-N 3.5Å; Q27-V30 PolarHBondContact O-N 2.92Å; V30-A32 PolarHBondContact O-N 2.83Å; V30-N33 PolarHBondContact O-N 3.5Å; V30-V34 WeakPolarHBondContact O-CG2 3.07Å; V30-V34 PolarHBondContact O-N 2.99Å
31	L	95.6	Very high	95.4	Very high	120 Å²	120	89 Å²	89	63%	0.628	46%	0.458	S	S	*	.	H	α-helix	trans	-61.8	-45	179	-178.2	62.9	0	0	0	112	Q27 Q28 V29 V34 Q35	Q27-L31 PolarHBondContact O-N 3.24Å; Q28-L31 PolarHBondContact O-N 2.84Å; V29-L31 PolarHBondContact O-N 2.04Å; L31-V34 PolarHBondContact O-N 3.47Å; L31-Q35 WeakPolarHBondContact O-CB 3.28Å; L31-Q35 PolarHBondContact O-N 3.01Å
32	A	96.3	Very high	95.7	Very high	50 Å²	50	89.7 Å²	89.7	41%	0.413	47%	0.466	S	S	.	.	H	α-helix	trans	-61.5	-44.2	177.8	0	0	0	0	0	111.7	Q28 V29 V30 V34 Q35 E36	Q28-A32 WeakPolarHBondContact O-CB 3.12Å; Q28-A32 PolarHBondContact O-N 3.21Å; V29-A32 PolarHBondContact O-N 3.46Å; V30-A32 PolarHBondContact O-N 2.83Å; A32-V34 VanDerWaalsContact C-N 3.35Å; A32-V34 PolarHBondContact O-N 2.92Å; A32-Q35 WeakPolarHBondContact O-CB 3.15Å; A32-Q35 PolarHBondContact O-N 2.94Å; A32-E36 PolarHBondContact O-N 3.35Å
33	N	95.1	Very high	95.9	Very high	90 Å²	90	90.6 Å²	90.6	48%	0.481	47%	0.469	S	S	.	.	H	α-helix	trans	-64.1	-39.1	178.1	-69.4	-1.5	0	0	0	112	V29 V30 L37	V29-N33 WeakPolarHBondContact O-CB 3.4Å; V29-N33 PolarHBondContact O-N 3.05Å; V29-N33 PolarHBondContact O-OD1 2.92Å; V30-N33 PolarHBondContact O-N 3.5Å; N33-L37 WeakPolarHBondContact O-CB 3.34Å; N33-L37 PolarHBondContact O-N 3.32Å
34	V	96.1	Very high	96.1	Very high	72 Å²	72	92.7 Å²	92.7	44%	0.436	47%	0.473	S	S	.	.	H	α-helix	trans	-65.3	-42.4	174.9	171.8	0	0	0	0	110.7	V30 L31 A32 L37 L38	V30-V34 WeakPolarHBondContact O-CG2 3.07Å; V30-V34 PolarHBondContact O-N 2.99Å; L31-V34 PolarHBondContact O-N 3.47Å; A32-V34 VanDerWaalsContact C-N 3.35Å; A32-V34 PolarHBondContact O-N 2.92Å; V34-L37 PolarHBondContact O-N 2.69Å; V34-L38 HydrophobicContact CG1-CD1 4.14Å; V34-L38 HydrophobicContact CG1-CG 4.48Å; V34-L38 WeakPolarHBondContact O-CG 3.46Å; V34-L38 PolarHBondContact O-N 2.89Å
35	Q	97.6	Very high	96.4	Very high	112 Å²	112	85.2 Å²	85.2	52%	0.523	45%	0.446	S	S	.	.	H	α-helix	trans	-62.3	-44.7	176.9	-176.7	175.1	-4.6	0	0	111.8	L31 A32 L37 L38 Q39	L31-Q35 WeakPolarHBondContact O-CB 3.28Å; L31-Q35 PolarHBondContact O-N 3.01Å; A32-Q35 WeakPolarHBondContact O-CB 3.15Å; A32-Q35 PolarHBondContact O-N 2.94Å; Q35-L37 VanDerWaalsContact C-N 3.35Å; Q35-L38 PolarHBondContact O-N 3.48Å; Q35-Q39 WeakPolarHBondContact O-CG 3.05Å; Q35-Q39 PolarHBondContact O-N 2.71Å
36	E	97.3	Very high	96.6	Very high	111 Å²	111	85.9 Å²	85.9	52%	0.519	45%	0.446	S	S	.	.	H	α-helix	trans	-62.6	-41.5	175.5	-179.7	177.1	-150.7	0	0	111.7	A32 L38 Q39 N40	A32-E36 PolarHBondContact O-N 3.35Å; E36-L38 PolarHBondContact O-N 3.32Å; E36-Q39 PolarHBondContact O-N 3.06Å; E36-N40 WeakPolarHBondContact CG-ND2 3.3Å; E36-N40 WeakPolarHBondContact O-CB 3.32Å; E36-N40 PolarHBondContact O-N 3.32Å; E36-N40 PolarHBondContact O-ND2 3.33Å
37	L	96.6	Very high	96.7	Very high	65 Å²	65	86.8 Å²	86.8	34%	0.34	45%	0.45	S	S	.	.	H	α-helix	trans	-59.7	-47.7	175.4	178.8	63.9	0	0	0	111.2	N33 V34 Q35 Q39 N40 I41 Y72	N33-L37 WeakPolarHBondContact O-CB 3.34Å; N33-L37 PolarHBondContact O-N 3.32Å; V34-L37 PolarHBondContact O-N 2.69Å; Q35-L37 VanDerWaalsContact C-N 3.35Å; L37-Q39 PolarHBondContact O-N 3.45Å; L37-N40 PolarHBondContact O-N 3.22Å; L37-I41 HydrophobicContact CD1-CD1 3.97Å; L37-I41 HydrophobicContact CD1-CG1 4.33Å; L37-I41 HydrophobicContact CG-CD1 3.87Å; L37-I41 WeakPolarHBondContact O-CB 3.4Å; L37-I41 VanDerWaalsContact O-CG1 3.31Å; L37-I41 WeakPolarHBondContact O-CG1 3.19Å; L37-I41 PolarHBondContact O-N 2.93Å; L37-Y72 HydrophobicContact CD1-CD1 4.44Å; L37-Y72 HydrophobicContact CD1-CE1 3.9Å
38	L	97.7	Very high	96.9	Very high	102 Å²	102	86 Å²	86	53%	0.534	45%	0.449	S	S	.	.	H	α-helix	trans	-62.6	-40.6	178.1	-71.9	172.6	0	0	0	112.2	V34 Q35 E36 S42	V34-L38 HydrophobicContact CG1-CD1 4.14Å; V34-L38 HydrophobicContact CG1-CG 4.48Å; V34-L38 WeakPolarHBondContact O-CG 3.46Å; V34-L38 PolarHBondContact O-N 2.89Å; Q35-L38 PolarHBondContact O-N 3.48Å; E36-L38 PolarHBondContact O-N 3.32Å; L38-S42 VanDerWaalsContact O-CB 3.28Å; L38-S42 WeakPolarHBondContact O-CB 3.34Å; L38-S42 PolarHBondContact O-N 2.78Å; L38-S42 PolarHBondContact O-OG 3.5Å
39	Q	98.1	Very high	97.1	Very high	117 Å²	117	79.7 Å²	79.7	55%	0.547	42%	0.421	S	S	.	.	H	α-helix	trans	-62.4	-46.7	175.4	-75.6	176.6	-5.9	0	0	111.5	Q35 E36 L37 S42 D43	Q35-Q39 WeakPolarHBondContact O-CG 3.05Å; Q35-Q39 PolarHBondContact O-N 2.71Å; E36-Q39 PolarHBondContact O-N 3.06Å; L37-Q39 PolarHBondContact O-N 3.45Å; Q39-S42 PolarHBondContact O-N 2.96Å; Q39-D43 WeakPolarHBondContact O-CB 3.28Å; Q39-D43 PolarHBondContact O-N 2.92Å
40	N	98	Very high	97.2	Very high	58 Å²	58	78 Å²	78	31%	0.31	41%	0.409	S	S	.	.	H	α-helix	trans	-64.3	-43.1	179	-80.6	-51.5	0	0	0	112.9	E36 L37 S42 K44 Y72	E36-N40 WeakPolarHBondContact CG-ND2 3.3Å; E36-N40 WeakPolarHBondContact O-CB 3.32Å; E36-N40 PolarHBondContact O-N 3.32Å; E36-N40 PolarHBondContact O-ND2 3.33Å; L37-N40 PolarHBondContact O-N 3.22Å; N40-S42 VanDerWaalsContact C-N 3.35Å; N40-K44 WeakPolarHBondContact O-CB 3.29Å; N40-K44 WeakPolarHBondContact O-CG 3.32Å; N40-K44 PolarHBondContact O-N 3.02Å; N40-Y72 WeakPolarHBondContact CB-OH 3Å
41	I	98.1	Very high	97.3	Very high	17 Å²	17	82.8 Å²	82.8	9%	0.087	42%	0.422	C	S	.	.	H	α-helix	trans	-59.9	-48.9	174.4	-74.1	169.8	0	0	0	109.8	L37 D43 K44 C45 V69 Y72 I73	L37-I41 HydrophobicContact CD1-CD1 3.97Å; L37-I41 HydrophobicContact CD1-CG1 4.33Å; L37-I41 HydrophobicContact CG-CD1 3.87Å; L37-I41 WeakPolarHBondContact O-CB 3.4Å; L37-I41 VanDerWaalsContact O-CG1 3.31Å; L37-I41 WeakPolarHBondContact O-CG1 3.19Å; L37-I41 PolarHBondContact O-N 2.93Å; I41-D43 PolarHBondContact O-N 2.93Å; I41-K44 PolarHBondContact O-N 3.32Å; I41-C45 WeakPolarHBondContact O-CB 3.17Å; I41-C45 PolarHBondContact O-N 2.95Å; I41-C45 PolarHBondContact O-SG 3.31Å; I41-V69 HydrophobicContact CG2-CB 4.47Å; I41-V69 HydrophobicContact CG2-CG1 4.44Å; I41-V69 HydrophobicContact CG2-CG2 3.69Å; I41-Y72 HydrophobicContact CB-CD1 4.5Å; I41-Y72 HydrophobicContact CD1-CD1 3.96Å; I41-Y72 HydrophobicContact CD1-CE1 4.4Å; I41-Y72 HydrophobicContact CG1-CD1 3.25Å; I41-Y72 HydrophobicContact CG1-CE1 3.56Å; I41-Y72 HydrophobicContact CG1-CG 4Å; I41-I73 HydrophobicContact CD1-CD1 4.42Å; I41-I73 HydrophobicContact CD1-CG1 4.12Å
42	S	97.7	Very high	97.2	Very high	60 Å²	60	85.2 Å²	85.2	42%	0.42	43%	0.428	S	S	.	.	H	α-helix	trans	-59.6	-50.7	-179.4	-59.6	0	0	0	0	110.8	L38 Q39 N40 K44 L46	L38-S42 VanDerWaalsContact O-CB 3.28Å; L38-S42 WeakPolarHBondContact O-CB 3.34Å; L38-S42 PolarHBondContact O-N 2.78Å; L38-S42 PolarHBondContact O-OG 3.5Å; Q39-S42 PolarHBondContact O-N 2.96Å; N40-S42 VanDerWaalsContact C-N 3.35Å; S42-K44 PolarHBondContact O-N 3.45Å; S42-L46 WeakPolarHBondContact O-CB 3.46Å; S42-L46 WeakPolarHBondContact O-CD1 3.33Å; S42-L46 WeakPolarHBondContact O-CG 3.24Å; S42-L46 PolarHBondContact O-N 3.01Å
43	D	97.8	Very high	97.1	Very high	76 Å²	76	88.2 Å²	88.2	41%	0.406	44%	0.443	S	S	.	.	H	α-helix	trans	-58.9	-48.5	-179	-174.1	53.2	0	0	0	111.9	Q39 I41 K47	Q39-D43 WeakPolarHBondContact O-CB 3.28Å; Q39-D43 PolarHBondContact O-N 2.92Å; I41-D43 PolarHBondContact O-N 2.93Å; D43-K47 VanDerWaalsContact O-CB 3.3Å; D43-K47 WeakPolarHBondContact O-CB 2.95Å; D43-K47 VanDerWaalsContact O-CD 3.32Å; D43-K47 WeakPolarHBondContact O-CD 3.5Å; D43-K47 WeakPolarHBondContact O-CG 3.42Å; D43-K47 PolarHBondContact O-N 3.25Å; D43-K47 WeakPolarHBondContact OD1-CE 3.34Å; D43-K47 IonicContact OD1-NZ 2.78Å; D43-K47 PolarHBondContact OD1-NZ 3.41Å; D43-K47 IonicContact OD2-NZ 2.69Å; D43-K47 PolarHBondContact OD2-NZ 2.99Å
44	K	98.1	Very high	97	Very high	102 Å²	102	86.8 Å²	86.8	44%	0.443	45%	0.45	S	S	.	.	H	α-helix	trans	-72.8	-46.5	-176.3	-68.1	172.4	-170.6	-61.9	0	112.4	N40 I41 S42 L48 Y72	N40-K44 WeakPolarHBondContact O-CB 3.29Å; N40-K44 WeakPolarHBondContact O-CG 3.32Å; N40-K44 PolarHBondContact O-N 3.02Å; I41-K44 PolarHBondContact O-N 3.32Å; S42-K44 PolarHBondContact O-N 3.45Å; K44-L48 WeakPolarHBondContact O-CB 3.5Å; K44-L48 PolarHBondContact O-N 3Å; K44-Y72 HydrophobicContact CD-CD2 3.96Å; K44-Y72 HydrophobicContact CD-CE2 3.21Å
45	C	98.6	Very high	97	Very high	2 Å²	2	93.8 Å²	93.8	1%	0.014	47%	0.474	C	S	.	.	H	α-helix	trans	-73.9	-35.1	-175.9	-67.3	0	0	0	0	112.4	I41 L48 C49 L65 C68	I41-C45 WeakPolarHBondContact O-CB 3.17Å; I41-C45 PolarHBondContact O-N 2.95Å; I41-C45 PolarHBondContact O-SG 3.31Å; C45-L48 PolarHBondContact O-N 3.38Å; C45-C49 WeakPolarHBondContact O-CB 3.42Å; C45-C49 PolarHBondContact O-N 2.94Å; C45-C49 PolarHBondContact O-SG 3.34Å; C45-L65 HydrophobicContact CB-CD2 3.87Å; C45-C68 WeakPolarHBondContact CA-SG 3.33Å; C45-C68 HydrophobicContact CB-CB 3.75Å; C45-C68 WeakPolarHBondContact CB-SG 3.44Å; C45-C68 WeakPolarHBondContact SG-CB 3.31Å; C45-C68 CovalentContact SG-SG 2.04Å; C45-C68 PolarHBondContact SG-SG 2.85Å
46	L	97.8	Very high	96.9	Very high	84 Å²	84	93.9 Å²	93.9	44%	0.44	48%	0.483	S	S	.	.	H	α-helix	trans	-67.4	-44.9	174.7	-65.2	171.9	0	0	0	111.2	S42 L48 C49 I50 L65	S42-L46 WeakPolarHBondContact O-CB 3.46Å; S42-L46 WeakPolarHBondContact O-CD1 3.33Å; S42-L46 WeakPolarHBondContact O-CG 3.24Å; S42-L46 PolarHBondContact O-N 3.01Å; L46-L48 PolarHBondContact O-N 3.3Å; L46-C49 PolarHBondContact O-N 3.35Å; L46-I50 HydrophobicContact CB-CG1 4.37Å; L46-I50 HydrophobicContact CD2-CG1 3.76Å; L46-I50 WeakPolarHBondContact O-CB 3.38Å; L46-I50 PolarHBondContact O-N 3.08Å; L46-L65 HydrophobicContact CD2-CD2 4.14Å
47	K	97.7	Very high	96.9	Very high	149 Å²	149	92.3 Å²	92.3	65%	0.648	48%	0.477	S	S	*	.	H	α-helix	trans	-59	-36.6	174.9	-76.1	172.4	179.4	163	0	112.7	D43	D43-K47 VanDerWaalsContact O-CB 3.3Å; D43-K47 WeakPolarHBondContact O-CB 2.95Å; D43-K47 VanDerWaalsContact O-CD 3.32Å; D43-K47 WeakPolarHBondContact O-CD 3.5Å; D43-K47 WeakPolarHBondContact O-CG 3.42Å; D43-K47 PolarHBondContact O-N 3.25Å; D43-K47 WeakPolarHBondContact OD1-CE 3.34Å; D43-K47 IonicContact OD1-NZ 2.78Å; D43-K47 PolarHBondContact OD1-NZ 3.41Å; D43-K47 IonicContact OD2-NZ 2.69Å; D43-K47 PolarHBondContact OD2-NZ 2.99Å
48	L	98.1	Very high	96.8	Very high	114 Å²	114	93 Å²	93	60%	0.597	48%	0.482	S	S	*	.	H	α-helix	trans	-76.9	-43.6	-179.6	-176.4	66	0	0	0	112.6	K44 C45 L46	K44-L48 WeakPolarHBondContact O-CB 3.5Å; K44-L48 PolarHBondContact O-N 3Å; C45-L48 PolarHBondContact O-N 3.38Å; L46-L48 PolarHBondContact O-N 3.3Å
49	C	98.5	Very high	96.8	Very high	8 Å²	8	90.7 Å²	90.7	5%	0.054	48%	0.482	C	S	.	.	H	α-helix	trans	-97.5	-31.4	-166.7	-66	0	0	0	0	114.1	C45 L46 K51 C64 L65	C45-C49 WeakPolarHBondContact O-CB 3.42Å; C45-C49 PolarHBondContact O-N 2.94Å; C45-C49 PolarHBondContact O-SG 3.34Å; L46-C49 PolarHBondContact O-N 3.35Å; C49-K51 PolarHBondContact O-N 2.99Å; C49-C64 WeakPolarHBondContact CA-SG 3.39Å; C49-C64 HydrophobicContact CB-CB 3.61Å; C49-C64 WeakPolarHBondContact CB-SG 3.46Å; C49-C64 WeakPolarHBondContact SG-CB 3.27Å; C49-C64 PolarHBondContact SG-O 2.66Å; C49-C64 VanDerWaalsContact SG-O 3.38Å; C49-C64 CovalentContact SG-SG 2.04Å; C49-C64 PolarHBondContact SG-SG 3.35Å; C49-L65 HydrophobicContact CB-CD2 3.83Å; C49-L65 HydrophobicContact CB-CG 3.97Å; C49-L65 PolarHBondContact SG-N 3.5Å
50	I	97.9	Very high	96.8	Very high	37 Å²	37	89.4 Å²	89.4	19%	0.19	49%	0.486	C	S	.	.			trans	-93.4	93.2	-175.7	-50.7	-53.3	0	0	0	109.6	L46 P53 L57 E61 L65	L46-I50 HydrophobicContact CB-CG1 4.37Å; L46-I50 HydrophobicContact CD2-CG1 3.76Å; L46-I50 WeakPolarHBondContact O-CB 3.38Å; L46-I50 PolarHBondContact O-N 3.08Å; I50-P53 HydrophobicContact CG2-CG 4.39Å; I50-L57 HydrophobicContact CD1-CD2 3.4Å; I50-L57 HydrophobicContact CG1-CD2 4.5Å; I50-E61 HydrophobicContact CD1-CB 3.86Å; I50-E61 HydrophobicContact CD1-CG 3.97Å; I50-L65 HydrophobicContact CD1-CD1 4.2Å
51	K	94.9	Very high	96.8	Very high	192 Å²	192	87.3 Å²	87.3	84%	0.835	48%	0.475	S	S	*	.	S	Bend	trans	-85.8	-29.1	178.8	-63.1	-178.7	-178	178	0	112.5	C49	C49-K51 PolarHBondContact O-N 2.99Å
52	K	93.1	Very high	96.8	Very high	172 Å²	172	92 Å²	92	75%	0.748	50%	0.496	S	S	*	.	S	Bend	trans	-131	96.2	178.3	-177	-175.9	175	-177.8	0	109.1	G54	K52-G54 PolarHBondContact O-N 3.21Å
53	P	94.5	Very high	96.8	Very high	112 Å²	112	95.4 Å²	95.4	73%	0.727	50%	0.503	S	S	*	.			trans	-53.5	129.5	175.5	-26	34.8	0	0	0	111.5	I50	I50-P53 HydrophobicContact CG2-CG 4.39Å
54	G	93.5	Very high	96.8	Very high	61 Å²	61	93.8 Å²	93.8	63%	0.629	50%	0.498	S	S	*	.			trans	-142.9	178.6	-178	0	0	0	0	0	111.7	K52 T56	K52-G54 PolarHBondContact O-N 3.21Å; G54-T56 PolarHBondContact O-N 3.05Å
55	K	95.5	Very high	96.9	Very high	219 Å²	219	90.4 Å²	90.4	95%	0.952	48%	0.484	S	S	*	.	S	Bend	trans	-74.1	-18.2	175.9	-64.6	-177.3	179.2	-178.6	0	112.8
56	T	96.1	Very high	96.9	Very high	114 Å²	114	93.6 Å²	93.6	70%	0.699	51%	0.507	S	S	*	.	S	Bend	trans	-141	149.3	-175.6	55.5	0	0	0	0	108.8	G54	G54-T56 PolarHBondContact O-N 3.05Å
57	L	96.3	Very high	96.9	Very high	77 Å²	77	96.2 Å²	96.2	40%	0.403	51%	0.511	S	S	.	.			trans	-78.2	129	168.9	-60.1	174.1	0	0	0	109.1	I50 E61 Q62 L65	I50-L57 HydrophobicContact CD1-CD2 3.4Å; I50-L57 HydrophobicContact CG1-CD2 4.5Å; L57-E61 WeakPolarHBondContact CA-OE2 3.34Å; L57-E61 HydrophobicContact CB-CB 4.36Å; L57-E61 HydrophobicContact CD2-CB 4.34Å; L57-Q62 HydrophobicContact CB-CG 3.65Å; L57-Q62 HydrophobicContact CD1-CG 4.33Å; L57-L65 HydrophobicContact CD1-CD1 3.7Å; L57-L65 HydrophobicContact CD2-CD1 4.16Å
58	D	95.9	Very high	97	Very high	81 Å²	81	90 Å²	90	43%	0.433	49%	0.486	S	S	.	.			trans	-75.3	168.2	170	77.4	41.2	0	0	0	111.7	S60 E61 Q62	D58-S60 PolarHBondContact O-N 3.29Å; D58-S60 VanDerWaalsContact OD1-CA 3.31Å; D58-S60 WeakPolarHBondContact OD1-CA 3.44Å; D58-S60 VanDerWaalsContact OD1-CB 3.26Å; D58-S60 WeakPolarHBondContact OD1-CB 3.24Å; D58-S60 PolarHBondContact OD1-N 3.49Å; D58-E61 PolarHBondContact N-OE2 3.36Å; D58-E61 PolarHBondContact O-N 3.39Å; D58-E61 PolarHBondContact OD1-N 3.41Å; D58-Q62 WeakPolarHBondContact O-CG 3.5Å; D58-Q62 PolarHBondContact O-N 3.04Å
59	G	97.1	Very high	97	Very high	53 Å²	53	86.7 Å²	86.7	55%	0.546	47%	0.471	S	S	.	.	H	α-helix	trans	-61.9	-27.9	-177.1	0	0	0	0	0	114.1	K63	G59-K63 VanDerWaalsContact O-CB 3.25Å; G59-K63 WeakPolarHBondContact O-CB 3.37Å; G59-K63 PolarHBondContact O-N 3.49Å; G59-K63 VanDerWaalsContact O-N 3.13Å
60	S	97.3	Very high	97	Very high	90 Å²	90	90.3 Å²	90.3	63%	0.629	49%	0.49	S	S	*	.	H	α-helix	trans	-75.9	-41.1	176.5	-55.3	0	0	0	0	111	D58 K63 C64	D58-S60 PolarHBondContact O-N 3.29Å; D58-S60 VanDerWaalsContact OD1-CA 3.31Å; D58-S60 WeakPolarHBondContact OD1-CA 3.44Å; D58-S60 VanDerWaalsContact OD1-CB 3.26Å; D58-S60 WeakPolarHBondContact OD1-CB 3.24Å; D58-S60 PolarHBondContact OD1-N 3.49Å; S60-K63 PolarHBondContact O-N 3.39Å; S60-C64 VanDerWaalsContact O-CB 3.27Å; S60-C64 WeakPolarHBondContact O-CB 3.43Å; S60-C64 PolarHBondContact O-N 2.9Å
61	E	98	Very high	97	Very high	14 Å²	14	95.6 Å²	95.6	7%	0.065	51%	0.507	C	S	.	.	H	α-helix	trans	-62.9	-47	174.7	-68.3	179	143.7	0	0	111.2	I50 L57 D58 K63 C64 L65	I50-E61 HydrophobicContact CD1-CB 3.86Å; I50-E61 HydrophobicContact CD1-CG 3.97Å; L57-E61 WeakPolarHBondContact CA-OE2 3.34Å; L57-E61 HydrophobicContact CB-CB 4.36Å; L57-E61 HydrophobicContact CD2-CB 4.34Å; D58-E61 PolarHBondContact N-OE2 3.36Å; D58-E61 PolarHBondContact O-N 3.39Å; D58-E61 PolarHBondContact OD1-N 3.41Å; E61-K63 PolarHBondContact O-N 3.47Å; E61-C64 PolarHBondContact O-N 3.32Å; E61-L65 WeakPolarHBondContact O-CB 3.42Å; E61-L65 VanDerWaalsContact O-CG 3.31Å; E61-L65 WeakPolarHBondContact O-CG 3.35Å; E61-L65 PolarHBondContact O-N 3.36Å
62	Q	98	Very high	97.2	Very high	114 Å²	114	88.2 Å²	88.2	53%	0.533	48%	0.475	S	S	.	.	H	α-helix	trans	-58.4	-48.2	176.1	-71.4	179.6	-30.8	0	0	111.9	L57 D58 L65 S66	L57-Q62 HydrophobicContact CB-CG 3.65Å; L57-Q62 HydrophobicContact CD1-CG 4.33Å; D58-Q62 WeakPolarHBondContact O-CG 3.5Å; D58-Q62 PolarHBondContact O-N 3.04Å; Q62-L65 PolarHBondContact O-N 3.26Å; Q62-S66 PolarHBondContact O-N 2.92Å
63	K	98.5	Very high	97.4	Very high	132 Å²	132	83.3 Å²	83.3	57%	0.574	46%	0.456	S	S	*	.	H	α-helix	trans	-61.9	-44.6	177.9	-177.1	171.4	-178.7	177.2	0	111.4	G59 S60 E61 S66 Y67	G59-K63 VanDerWaalsContact O-CB 3.25Å; G59-K63 WeakPolarHBondContact O-CB 3.37Å; G59-K63 PolarHBondContact O-N 3.49Å; G59-K63 VanDerWaalsContact O-N 3.13Å; S60-K63 PolarHBondContact O-N 3.39Å; E61-K63 PolarHBondContact O-N 3.47Å; K63-S66 PolarHBondContact O-N 3.47Å; K63-Y67 HydrophobicContact CD-CE2 4.11Å; K63-Y67 HydrophobicContact CG-CD2 3.87Å; K63-Y67 HydrophobicContact CG-CE2 3.44Å; K63-Y67 VanDerWaalsContact CG-CE2 3.44Å; K63-Y67 WeakPolarHBondContact O-CD2 3.37Å; K63-Y67 PolarHBondContact O-N 3.44Å
64	C	98.7	Very high	97.6	Very high	43 Å²	43	82.8 Å²	82.8	29%	0.291	44%	0.443	S	S	.	.	H	α-helix	trans	-60.3	-46.5	176.4	-178.5	0	0	0	0	111.7	C49 S60 E61 S66 Y67 C68	C49-C64 WeakPolarHBondContact CA-SG 3.39Å; C49-C64 HydrophobicContact CB-CB 3.61Å; C49-C64 WeakPolarHBondContact CB-SG 3.46Å; C49-C64 WeakPolarHBondContact SG-CB 3.27Å; C49-C64 PolarHBondContact SG-O 2.66Å; C49-C64 VanDerWaalsContact SG-O 3.38Å; C49-C64 CovalentContact SG-SG 2.04Å; C49-C64 PolarHBondContact SG-SG 3.35Å; S60-C64 VanDerWaalsContact O-CB 3.27Å; S60-C64 WeakPolarHBondContact O-CB 3.43Å; S60-C64 PolarHBondContact O-N 2.9Å; E61-C64 PolarHBondContact O-N 3.32Å; C64-S66 PolarHBondContact O-N 2.89Å; C64-Y67 PolarHBondContact O-N 2.89Å; C64-C68 VanDerWaalsContact O-CB 3.26Å; C64-C68 WeakPolarHBondContact O-CB 3.47Å; C64-C68 PolarHBondContact O-N 3.36Å
65	L	98.5	Very high	97.8	Very high	31 Å²	31	83 Å²	83	16%	0.162	43%	0.433	C	S	.	.	H	α-helix	trans	-60.9	-45.3	179.5	-73.7	172.4	0	0	0	111.6	C45 L46 C49 I50 L57 E61 Q62 Y67 C68 V69	C45-L65 HydrophobicContact CB-CD2 3.87Å; L46-L65 HydrophobicContact CD2-CD2 4.14Å; C49-L65 HydrophobicContact CB-CD2 3.83Å; C49-L65 HydrophobicContact CB-CG 3.97Å; C49-L65 PolarHBondContact SG-N 3.5Å; I50-L65 HydrophobicContact CD1-CD1 4.2Å; L57-L65 HydrophobicContact CD1-CD1 3.7Å; L57-L65 HydrophobicContact CD2-CD1 4.16Å; E61-L65 WeakPolarHBondContact O-CB 3.42Å; E61-L65 VanDerWaalsContact O-CG 3.31Å; E61-L65 WeakPolarHBondContact O-CG 3.35Å; E61-L65 PolarHBondContact O-N 3.36Å; Q62-L65 PolarHBondContact O-N 3.26Å; L65-Y67 PolarHBondContact O-N 3.03Å; L65-C68 PolarHBondContact O-N 3.4Å; L65-V69 VanDerWaalsContact O-CG2 3.25Å; L65-V69 WeakPolarHBondContact O-CG2 3.22Å; L65-V69 PolarHBondContact O-N 2.88Å
66	S	98.5	Very high	97.9	Very high	69 Å²	69	76.4 Å²	76.4	48%	0.483	41%	0.406	S	S	.	.	H	α-helix	trans	-54.7	-53.4	176.4	-169.8	0	0	0	0	111.3	Q62 K63 C64 C68 V69 D70	Q62-S66 PolarHBondContact O-N 2.92Å; K63-S66 PolarHBondContact O-N 3.47Å; C64-S66 PolarHBondContact O-N 2.89Å; S66-C68 VanDerWaalsContact C-N 3.34Å; S66-C68 PolarHBondContact O-N 3.29Å; S66-V69 PolarHBondContact O-N 3.48Å; S66-D70 PolarHBondContact O-N 2.95Å; S66-D70 VanDerWaalsContact O-N 3.15Å
67	Y	98.6	Very high	98	Very high	138 Å²	138	76 Å²	76	54%	0.541	40%	0.4	S	S	.	.	H	α-helix	trans	-64.8	-37.9	178.7	-71.2	-60	0	0	0	113.1	K63 C64 L65 D70 R71	K63-Y67 HydrophobicContact CD-CE2 4.11Å; K63-Y67 HydrophobicContact CG-CD2 3.87Å; K63-Y67 HydrophobicContact CG-CE2 3.44Å; K63-Y67 VanDerWaalsContact CG-CE2 3.44Å; K63-Y67 WeakPolarHBondContact O-CD2 3.37Å; K63-Y67 PolarHBondContact O-N 3.44Å; C64-Y67 PolarHBondContact O-N 2.89Å; L65-Y67 PolarHBondContact O-N 3.03Å; Y67-D70 PolarHBondContact O-N 2.86Å; Y67-R71 VanDerWaalsContact O-CB 3.28Å; Y67-R71 WeakPolarHBondContact O-CB 3.3Å; Y67-R71 VanDerWaalsContact O-CG 3.24Å; Y67-R71 WeakPolarHBondContact O-CG 3.29Å; Y67-R71 PolarHBondContact O-N 2.9Å
68	C	98.8	Very high	98.1	Very high	18 Å²	18	77.8 Å²	77.8	12%	0.122	41%	0.409	C	S	.	.	H	α-helix	trans	-62.7	-44.6	179.8	-179.8	0	0	0	0	111.1	C45 C64 L65 S66 Y72	C45-C68 WeakPolarHBondContact CA-SG 3.33Å; C45-C68 HydrophobicContact CB-CB 3.75Å; C45-C68 WeakPolarHBondContact CB-SG 3.44Å; C45-C68 WeakPolarHBondContact SG-CB 3.31Å; C45-C68 CovalentContact SG-SG 2.04Å; C45-C68 PolarHBondContact SG-SG 2.85Å; C64-C68 VanDerWaalsContact O-CB 3.26Å; C64-C68 WeakPolarHBondContact O-CB 3.47Å; C64-C68 PolarHBondContact O-N 3.36Å; L65-C68 PolarHBondContact O-N 3.4Å; S66-C68 VanDerWaalsContact C-N 3.34Å; S66-C68 PolarHBondContact O-N 3.29Å; C68-Y72 WeakPolarHBondContact O-CB 3.47Å; C68-Y72 PolarHBondContact O-N 2.94Å
69	V	98.5	Very high	98.2	Very high	46 Å²	46	78 Å²	78	28%	0.279	41%	0.414	S	S	.	.	H	α-helix	trans	-61.9	-49.7	177.7	174.6	0	0	0	0	110.6	I41 L65 S66 R71 Y72 I73	I41-V69 HydrophobicContact CG2-CB 4.47Å; I41-V69 HydrophobicContact CG2-CG1 4.44Å; I41-V69 HydrophobicContact CG2-CG2 3.69Å; L65-V69 VanDerWaalsContact O-CG2 3.25Å; L65-V69 WeakPolarHBondContact O-CG2 3.22Å; L65-V69 PolarHBondContact O-N 2.88Å; S66-V69 PolarHBondContact O-N 3.48Å; V69-R71 PolarHBondContact O-N 3.15Å; V69-Y72 PolarHBondContact O-N 3.01Å; V69-I73 HydrophobicContact CG1-CD1 3.84Å; V69-I73 WeakPolarHBondContact O-CG1 3.29Å; V69-I73 PolarHBondContact O-N 3.33Å
70	D	98.6	Very high	98.1	Very high	83 Å²	83	77.3 Å²	77.3	44%	0.444	40%	0.402	S	S	.	.	H	α-helix	trans	-57.2	-51.8	179	-66.7	-26	0	0	0	110.9	S66 Y67 Y72 I73 E74	S66-D70 PolarHBondContact O-N 2.95Å; S66-D70 VanDerWaalsContact O-N 3.15Å; Y67-D70 PolarHBondContact O-N 2.86Å; D70-Y72 VanDerWaalsContact C-N 3.3Å; D70-Y72 PolarHBondContact O-N 3.4Å; D70-I73 PolarHBondContact O-N 3.45Å; D70-E74 WeakPolarHBondContact O-CG 3.33Å; D70-E74 PolarHBondContact O-N 3.41Å
71	R	98.3	Very high	98.2	Very high	149 Å²	149	75 Å²	75	56%	0.562	39%	0.388	S	S	*	.	H	α-helix	trans	-63.8	-34.5	179	-70.8	-58.9	-57.3	170.9	-5.6	112.7	Y67 V69 E74 T75	Y67-R71 VanDerWaalsContact O-CB 3.28Å; Y67-R71 WeakPolarHBondContact O-CB 3.3Å; Y67-R71 VanDerWaalsContact O-CG 3.24Å; Y67-R71 WeakPolarHBondContact O-CG 3.29Å; Y67-R71 PolarHBondContact O-N 2.9Å; V69-R71 PolarHBondContact O-N 3.15Å; R71-E74 WeakPolarHBondContact CD-OE2 3.47Å; R71-E74 IonicContact CZ-OE2 2.71Å; R71-E74 IonicContact NE-OE2 3.78Å; R71-E74 IonicContact NH1-OE2 3.51Å; R71-E74 PolarHBondContact NH1-OE2 3.46Å; R71-T75 VanDerWaalsContact O-CB 3.24Å; R71-T75 WeakPolarHBondContact O-CB 3.37Å; R71-T75 PolarHBondContact O-N 2.89Å; R71-T75 PolarHBondContact O-OG1 3.19Å
72	Y	98.5	Very high	98.2	Very high	37 Å²	37	76.2 Å²	76.2	15%	0.145	40%	0.397	C	S	.	.	H	α-helix	trans	-65.9	-48.3	177.8	-172.5	-92.5	0	0	0	111	L37 N40 I41 K44 C68 V69 D70 T75 M76	L37-Y72 HydrophobicContact CD1-CD1 4.44Å; L37-Y72 HydrophobicContact CD1-CE1 3.9Å; N40-Y72 WeakPolarHBondContact CB-OH 3Å; I41-Y72 HydrophobicContact CB-CD1 4.5Å; I41-Y72 HydrophobicContact CD1-CD1 3.96Å; I41-Y72 HydrophobicContact CD1-CE1 4.4Å; I41-Y72 HydrophobicContact CG1-CD1 3.25Å; I41-Y72 HydrophobicContact CG1-CE1 3.56Å; I41-Y72 HydrophobicContact CG1-CG 4Å; K44-Y72 HydrophobicContact CD-CD2 3.96Å; K44-Y72 HydrophobicContact CD-CE2 3.21Å; C68-Y72 WeakPolarHBondContact O-CB 3.47Å; C68-Y72 PolarHBondContact O-N 2.94Å; V69-Y72 PolarHBondContact O-N 3.01Å; D70-Y72 VanDerWaalsContact C-N 3.3Å; D70-Y72 PolarHBondContact O-N 3.4Å; Y72-T75 PolarHBondContact O-N 3Å; Y72-M76 HydrophobicContact CD1-CG 3.8Å; Y72-M76 HydrophobicContact CE1-CG 3.44Å; Y72-M76 VanDerWaalsContact CE1-CG 3.44Å; Y72-M76 HydrophobicContact CE1-SD 4.16Å; Y72-M76 HydrophobicContact CE2-CG 4.37Å; Y72-M76 HydrophobicContact CG-CG 4.48Å; Y72-M76 WeakPolarHBondContact O-CB 3.42Å; Y72-M76 VanDerWaalsContact O-CG 3.27Å; Y72-M76 WeakPolarHBondContact O-CG 3.37Å; Y72-M76 PolarHBondContact O-N 2.89Å
73	I	98	Very high	98.1	Very high	68 Å²	68	77.4 Å²	77.4	35%	0.349	40%	0.398	S	S	.	.	H	α-helix	trans	-63.9	-46	179.7	-66.3	168.3	0	0	0	110.6	I41 V69 D70 T75 M76 N77	I41-I73 HydrophobicContact CD1-CD1 4.42Å; I41-I73 HydrophobicContact CD1-CG1 4.12Å; V69-I73 HydrophobicContact CG1-CD1 3.84Å; V69-I73 WeakPolarHBondContact O-CG1 3.29Å; V69-I73 PolarHBondContact O-N 3.33Å; D70-I73 PolarHBondContact O-N 3.45Å; I73-T75 VanDerWaalsContact C-N 3.32Å; I73-T75 PolarHBondContact O-N 2.98Å; I73-M76 PolarHBondContact O-N 3.02Å; I73-N77 WeakPolarHBondContact O-CB 3.25Å; I73-N77 VanDerWaalsContact O-CG 3.29Å; I73-N77 PolarHBondContact O-N 3.4Å; I73-N77 PolarHBondContact O-ND2 2.82Å
74	E	98.2	Very high	98.1	Very high	101 Å²	101	77.9 Å²	77.9	47%	0.472	40%	0.396	S	S	.	.	H	α-helix	trans	-55.5	-47.8	174.4	-74.5	177.2	174.2	0	0	111.8	D70 R71 N77 L78	D70-E74 WeakPolarHBondContact O-CG 3.33Å; D70-E74 PolarHBondContact O-N 3.41Å; R71-E74 WeakPolarHBondContact CD-OE2 3.47Å; R71-E74 IonicContact CZ-OE2 2.71Å; R71-E74 IonicContact NE-OE2 3.78Å; R71-E74 IonicContact NH1-OE2 3.51Å; R71-E74 PolarHBondContact NH1-OE2 3.46Å; E74-N77 PolarHBondContact O-N 2.83Å; E74-L78 WeakPolarHBondContact O-CB 3.23Å; E74-L78 PolarHBondContact O-N 3.38Å
75	T	98.1	Very high	98	Very high	65 Å²	65	81.1 Å²	81.1	40%	0.399	41%	0.407	S	S	.	.	H	α-helix	trans	-65	-45.1	-179.4	-57.8	0	0	0	0	111.3	R71 Y72 I73 N77 L78 V79	R71-T75 VanDerWaalsContact O-CB 3.24Å; R71-T75 WeakPolarHBondContact O-CB 3.37Å; R71-T75 PolarHBondContact O-N 2.89Å; R71-T75 PolarHBondContact O-OG1 3.19Å; Y72-T75 PolarHBondContact O-N 3Å; I73-T75 VanDerWaalsContact C-N 3.32Å; I73-T75 PolarHBondContact O-N 2.98Å; T75-N77 VanDerWaalsContact C-N 3.33Å; T75-N77 PolarHBondContact O-N 3.03Å; T75-L78 PolarHBondContact O-N 3.31Å; T75-V79 HydrophobicContact CG2-CG2 4.27Å; T75-V79 WeakPolarHBondContact O-CB 3.26Å; T75-V79 VanDerWaalsContact O-CG2 3.29Å; T75-V79 WeakPolarHBondContact O-CG2 3.37Å; T75-V79 PolarHBondContact O-N 3.19Å
76	M	97.2	Very high	97.9	Very high	82 Å²	82	87.6 Å²	87.6	40%	0.404	43%	0.429	S	S	.	.	H	α-helix	trans	-59.5	-43.6	176.9	-77	-63.6	-64.5	0	0	111.7	Y72 I73 V79 A80	Y72-M76 HydrophobicContact CD1-CG 3.8Å; Y72-M76 HydrophobicContact CE1-CG 3.44Å; Y72-M76 VanDerWaalsContact CE1-CG 3.44Å; Y72-M76 HydrophobicContact CE1-SD 4.16Å; Y72-M76 HydrophobicContact CE2-CG 4.37Å; Y72-M76 HydrophobicContact CG-CG 4.48Å; Y72-M76 WeakPolarHBondContact O-CB 3.42Å; Y72-M76 VanDerWaalsContact O-CG 3.27Å; Y72-M76 WeakPolarHBondContact O-CG 3.37Å; Y72-M76 PolarHBondContact O-N 2.89Å; I73-M76 PolarHBondContact O-N 3.02Å; M76-V79 PolarHBondContact O-N 2.9Å; M76-A80 VanDerWaalsContact O-CB 3.22Å; M76-A80 WeakPolarHBondContact O-CB 3.38Å; M76-A80 PolarHBondContact O-N 3.06Å
77	N	97.6	Very high	97.8	Very high	104 Å²	104	89.2 Å²	89.2	56%	0.556	43%	0.432	S	S	*	.	H	α-helix	trans	-62.7	-44.5	177.2	-74.6	-28.5	0	0	0	112	I73 E74 T75 A80 A81	I73-N77 WeakPolarHBondContact O-CB 3.25Å; I73-N77 VanDerWaalsContact O-CG 3.29Å; I73-N77 PolarHBondContact O-N 3.4Å; I73-N77 PolarHBondContact O-ND2 2.82Å; E74-N77 PolarHBondContact O-N 2.83Å; T75-N77 VanDerWaalsContact C-N 3.33Å; T75-N77 PolarHBondContact O-N 3.03Å; N77-A80 PolarHBondContact O-N 2.97Å; N77-A81 WeakPolarHBondContact O-CB 3.32Å; N77-A81 PolarHBondContact O-N 3.27Å
78	L	98.4	Very high	97.6	Very high	115 Å²	115	90.4 Å²	90.4	60%	0.602	44%	0.442	S	S	*	.	H	α-helix	trans	-61.2	-51.7	176.6	177.5	61.6	0	0	0	111.3	E74 T75 A80 A81 T82	E74-L78 WeakPolarHBondContact O-CB 3.23Å; E74-L78 PolarHBondContact O-N 3.38Å; T75-L78 PolarHBondContact O-N 3.31Å; L78-A80 VanDerWaalsContact C-N 3.32Å; L78-A80 PolarHBondContact O-N 3.08Å; L78-A81 PolarHBondContact O-N 3.39Å; L78-T82 PolarHBondContact O-N 3.29Å; L78-T82 PolarHBondContact O-OG1 3.02Å; L78-T82 VanDerWaalsContact O-OG1 3.06Å
79	V	97.9	Very high	97.2	Very high	87 Å²	87	96.5 Å²	96.5	53%	0.527	47%	0.469	S	S	.	.	H	α-helix	trans	-59.4	-44.9	179.4	171.3	0	0	0	0	110.7	T75 M76 A81 T82 Y83	T75-V79 HydrophobicContact CG2-CG2 4.27Å; T75-V79 WeakPolarHBondContact O-CB 3.26Å; T75-V79 VanDerWaalsContact O-CG2 3.29Å; T75-V79 WeakPolarHBondContact O-CG2 3.37Å; T75-V79 PolarHBondContact O-N 3.19Å; M76-V79 PolarHBondContact O-N 2.9Å; V79-A81 VanDerWaalsContact C-N 3.35Å; V79-A81 PolarHBondContact O-N 3.28Å; V79-T82 PolarHBondContact O-N 3.11Å; V79-Y83 VanDerWaalsContact O-CB 3.25Å; V79-Y83 WeakPolarHBondContact O-CB 3.46Å; V79-Y83 PolarHBondContact O-N 3.32Å
80	A	96.6	Very high	96.2	Very high	37 Å²	37	100.2 Å²	100.2	31%	0.306	52%	0.516	S	S	.	.	H	α-helix	trans	-62.1	-41.6	177.9	0	0	0	0	0	112	M76 N77 L78 R84	M76-A80 VanDerWaalsContact O-CB 3.22Å; M76-A80 WeakPolarHBondContact O-CB 3.38Å; M76-A80 PolarHBondContact O-N 3.06Å; N77-A80 PolarHBondContact O-N 2.97Å; L78-A80 VanDerWaalsContact C-N 3.32Å; L78-A80 PolarHBondContact O-N 3.08Å; A80-R84 WeakPolarHBondContact O-CG 3.44Å; A80-R84 PolarHBondContact O-N 3.21Å; A80-R84 PolarHBondContact O-NH1 3.23Å
81	A	97.7	Very high	96.1	Very high	41 Å²	41	101.1 Å²	101.1	34%	0.339	52%	0.52	S	S	.	.	H	α-helix	trans	-65	-47.4	176.1	0	0	0	0	0	112.1	N77 L78 V79 Y83 R84 Q85	N77-A81 WeakPolarHBondContact O-CB 3.32Å; N77-A81 PolarHBondContact O-N 3.27Å; L78-A81 PolarHBondContact O-N 3.39Å; V79-A81 VanDerWaalsContact C-N 3.35Å; V79-A81 PolarHBondContact O-N 3.28Å; A81-Y83 VanDerWaalsContact C-N 3.31Å; A81-Y83 PolarHBondContact O-N 3.33Å; A81-R84 PolarHBondContact O-N 3.46Å; A81-Q85 PolarHBondContact O-N 3.42Å
82	T	98.2	Very high	96	Very high	41 Å²	41	98.5 Å²	98.5	25%	0.252	52%	0.518	S	S	.	.	H	α-helix	trans	-61.3	-40.6	176.7	-56.9	0	0	0	0	111.7	L78 V79 Q85 R86	L78-T82 PolarHBondContact O-N 3.29Å; L78-T82 PolarHBondContact O-OG1 3.02Å; L78-T82 VanDerWaalsContact O-OG1 3.06Å; V79-T82 PolarHBondContact O-N 3.11Å; T82-Q85 PolarHBondContact O-N 2.85Å; T82-R86 WeakPolarHBondContact O-CG 3.41Å; T82-R86 PolarHBondContact O-N 3.32Å
83	Y	97.5	Very high	95.8	Very high	138 Å²	138	101.9 Å²	101.9	54%	0.541	54%	0.538	S	S	.	.	H	α-helix	trans	-63.5	-46.7	177.4	-176.8	-109	0	0	0	111.5	V79 A81 Q85 R86 L87	V79-Y83 VanDerWaalsContact O-CB 3.25Å; V79-Y83 WeakPolarHBondContact O-CB 3.46Å; V79-Y83 PolarHBondContact O-N 3.32Å; A81-Y83 VanDerWaalsContact C-N 3.31Å; A81-Y83 PolarHBondContact O-N 3.33Å; Y83-Q85 VanDerWaalsContact C-N 3.31Å; Y83-Q85 PolarHBondContact O-N 3.46Å; Y83-R86 PolarHBondContact O-N 3.06Å; Y83-L87 HydrophobicContact CD1-CD1 4Å; Y83-L87 HydrophobicContact CD1-CG 4.49Å; Y83-L87 HydrophobicContact CE1-CD1 3.49Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.49Å; Y83-L87 HydrophobicContact CE1-CG 4.13Å; Y83-L87 PolarHBondContact O-N 3.35Å; Y83-L87 VanDerWaalsContact O-N 3.08Å
84	R	97.1	Very high	95.7	Very high	142 Å²	142	103.9 Å²	103.9	54%	0.536	55%	0.55	S	S	.	.	H	α-helix	trans	-57.9	-42.7	174.1	-74.2	-171.3	-59.1	-90.2	3.6	112.3	A80 A81 R86 L87 Q88	A80-R84 WeakPolarHBondContact O-CG 3.44Å; A80-R84 PolarHBondContact O-N 3.21Å; A80-R84 PolarHBondContact O-NH1 3.23Å; A81-R84 PolarHBondContact O-N 3.46Å; R84-R86 VanDerWaalsContact C-N 3.34Å; R84-R86 PolarHBondContact O-N 3.05Å; R84-L87 PolarHBondContact O-N 3.06Å; R84-Q88 WeakPolarHBondContact O-CG 3.37Å; R84-Q88 PolarHBondContact O-N 2.73Å
85	Q	97.3	Very high	95.5	Very high	111 Å²	111	104.1 Å²	104.1	52%	0.519	55%	0.554	S	S	.	*	H	α-helix	trans	-61.3	-42.1	178.1	-177.4	-178	-16.3	0	0	111.8	A81 T82 Y83 Q88 Q89	A81-Q85 PolarHBondContact O-N 3.42Å; T82-Q85 PolarHBondContact O-N 2.85Å; Y83-Q85 VanDerWaalsContact C-N 3.31Å; Y83-Q85 PolarHBondContact O-N 3.46Å; Q85-Q88 PolarHBondContact O-N 3.33Å; Q85-Q89 WeakPolarHBondContact O-CG 3.43Å
86	R	97.1	Very high	95.4	Very high	168 Å²	168	106.7 Å²	106.7	63%	0.634	57%	0.565	S	S	*	*	H	α-helix	trans	-66	-39	177.7	-71.8	177.3	-178	145.6	1.1	112.6	T82 Y83 R84 Q88 Q89	T82-R86 WeakPolarHBondContact O-CG 3.41Å; T82-R86 PolarHBondContact O-N 3.32Å; Y83-R86 PolarHBondContact O-N 3.06Å; R84-R86 VanDerWaalsContact C-N 3.34Å; R84-R86 PolarHBondContact O-N 3.05Å; R86-Q88 PolarHBondContact O-N 3.15Å; R86-Q89 PolarHBondContact O-N 2.98Å; R86-Q89 VanDerWaalsContact O-N 3.15Å
87	L	96.4	Very high	95.2	Very high	102 Å²	102	108.5 Å²	108.5	53%	0.534	58%	0.576	S	S	.	*	H	α-helix	trans	-63.9	-26.2	177.1	-71.9	-179.8	0	0	0	113.3	Y83 R84 Q89	Y83-L87 HydrophobicContact CD1-CD1 4Å; Y83-L87 HydrophobicContact CD1-CG 4.49Å; Y83-L87 HydrophobicContact CE1-CD1 3.49Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.49Å; Y83-L87 HydrophobicContact CE1-CG 4.13Å; Y83-L87 PolarHBondContact O-N 3.35Å; Y83-L87 VanDerWaalsContact O-N 3.08Å; R84-L87 PolarHBondContact O-N 3.06Å; L87-Q89 VanDerWaalsContact C-N 3.34Å
88	Q	94.1	Very high	95.1	Very high	164 Å²	164	108.8 Å²	108.8	77%	0.766	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-11.7	177.2	-68.4	174.1	-9.7	0	0	113.4	R84 Q85 R86	R84-Q88 WeakPolarHBondContact O-CG 3.37Å; R84-Q88 PolarHBondContact O-N 2.73Å; Q85-Q88 PolarHBondContact O-N 3.33Å; R86-Q88 PolarHBondContact O-N 3.15Å
89	Q	89.2	Confident	94.8	Very high	145 Å²	145	108.3 Å²	108.3	68%	0.678	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	-11.6	-178.4	-70.6	178	-13.3	0	0	113.5	Q85 R86 L87	Q85-Q89 WeakPolarHBondContact O-CG 3.43Å; R86-Q89 PolarHBondContact O-N 2.98Å; R86-Q89 VanDerWaalsContact O-N 3.15Å; L87-Q89 VanDerWaalsContact C-N 3.34Å
90	G	78.2	Confident	94.5	Very high	124 Å²	124	110.3 Å²	110.3	100%	1.278	58%	0.58	S	S	*	*			trans	-103.8	0	173.9	0	0	0	0	0	111

Retrieved 90 of 90 residues in 204.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).