A0A077ZJQ0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJQ0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 58 aa.

						>A0A077ZJQ0_TRITR|A0A077ZJQ0
MELDDVKSVTGPKKYLSSATTVVKADILSLRAQNSLMTPRLVFAFAAAQRNTCCKSVS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.8	Very low	47.2	Very low	240 Å²	240	146.5 Å²	146.5	100%	1.182	82%	0.815	S	S	*	*				0	96.2	0	-73.9	179.5	-169.5	0	0	106.4
2	E	37.8	Very low	47.2	Very low	178 Å²	178	141.9 Å²	141.9	83%	0.832	80%	0.797	S	S	*	*			trans	-75.1	137	172.9	-79.1	165.7	140.2	0	0	109
3	L	51	Low	47.5	Very low	177 Å²	177	145.5 Å²	145.5	93%	0.927	80%	0.799	S	S	*	*			trans	-102.6	73.3	172.7	-87.9	129.6	0	0	0	108.5
4	D	40	Very low	47.5	Very low	131 Å²	131	148.1 Å²	148.1	70%	0.701	80%	0.798	S	S	*	*			trans	-87.9	94.8	160.2	-77.4	-64.5	0	0	0	108
5	D	55.2	Low	47.5	Very low	137 Å²	137	150.2 Å²	150.2	73%	0.733	79%	0.792	S	S	*	*			trans	173	62.7	154.2	-97.8	-35.2	0	0	0	113.6
6	V	52.6	Low	47.6	Very low	151 Å²	151	148.8 Å²	148.8	92%	0.915	78%	0.784	S	S	*	*			trans	-108.2	72.6	159.9	-168.9	0	0	0	0	109.2	S8	V6-S8 PolarHBondContact O-N 2.74Å; V6-S8 VanDerWaalsContact O-N 3.1Å
7	K	49.9	Very low	47.6	Very low	175 Å²	175	144.9 Å²	144.9	76%	0.761	77%	0.772	S	S	*	*			trans	-55.8	108.6	165.6	-93.7	175.5	176.7	165.8	0	110.3	V9	K7-V9 PolarHBondContact O-N 3.15Å
8	S	42.7	Very low	47.7	Very low	92 Å²	92	140.4 Å²	140.4	64%	0.643	75%	0.754	S	S	*	*			trans	27.8	89.8	131.8	-176.3	0	0	0	0	116.8	V6 T10	V6-S8 PolarHBondContact O-N 2.74Å; V6-S8 VanDerWaalsContact O-N 3.1Å; S8-T10 PolarHBondContact OG-OG1 3.21Å
9	V	52.1	Low	47.7	Very low	146 Å²	146	135.6 Å²	135.6	89%	0.885	74%	0.735	S	S	*	*			trans	-95.3	90	157	-178.4	0	0	0	0	107.9	K7	K7-V9 PolarHBondContact O-N 3.15Å
10	T	47	Very low	47.9	Very low	122 Å²	122	132.6 Å²	132.6	75%	0.748	72%	0.722	S	S	*	*			trans	-93.4	104.7	175.8	15	0	0	0	0	110.6	S8	S8-T10 PolarHBondContact OG-OG1 3.21Å
11	G	50.9	Low	48.1	Very low	62 Å²	62	130.3 Å²	130.3	64%	0.639	71%	0.712	S	S	*	*			trans	146	146.8	156.3	0	0	0	0	0	115
12	P	47.9	Very low	48.8	Very low	92 Å²	92	123 Å²	123	60%	0.597	68%	0.681	S	S	*	*			cis	-92.4	133.9	-40.9	32.5	-19.7	0	0	0	110.4	K14 Y15	P12-K14 PolarHBondContact O-N 3.41Å; P12-Y15 HydrophobicContact CG-CD2 4.04Å; P12-Y15 HydrophobicContact CG-CE2 4.1Å
13	K	50.1	Low	49.6	Very low	189 Å²	189	118.2 Å²	118.2	82%	0.822	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.5	19.7	-175.2	-65.4	-178.5	176.4	178.5	0	116.5
14	K	48.5	Very low	49.9	Very low	182 Å²	182	116.1 Å²	116.1	79%	0.791	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.5	-22.6	179.7	-79.7	-172	175.2	-177.6	0	114.8	P12	P12-K14 PolarHBondContact O-N 3.41Å
15	Y	47.5	Very low	50.8	Low	179 Å²	179	112.4 Å²	112.4	70%	0.702	64%	0.635	S	S	*	*	H	α-helix	trans	-87.2	-21.5	-179.7	-66.4	-79.8	0	0	0	114.1	P12 S18 A19	P12-Y15 HydrophobicContact CG-CD2 4.04Å; P12-Y15 HydrophobicContact CG-CE2 4.1Å; Y15-S18 PolarHBondContact O-OG 3.1Å; Y15-A19 PolarHBondContact O-N 3.48Å
16	L	48.1	Very low	51	Low	128 Å²	128	110.1 Å²	110.1	67%	0.67	62%	0.622	S	S	*	*	H	α-helix	trans	-77.7	-25.7	176.1	-75.7	160.7	0	0	0	112.6	T20	L16-T20 WeakPolarHBondContact O-CB 3.43Å; L16-T20 PolarHBondContact O-N 3.03Å; L16-T20 VanDerWaalsContact O-N 3.15Å; L16-T20 PolarHBondContact O-OG1 3.41Å
17	S	48.6	Very low	51.5	Low	83 Å²	83	107.3 Å²	107.3	58%	0.58	60%	0.601	S	S	*	*	H	α-helix	trans	-73.9	-30.3	-179.7	-168.1	0	0	0	0	112.9	T21	S17-T21 PolarHBondContact O-OG1 3.08Å
18	S	48.1	Very low	52	Low	63 Å²	63	104.6 Å²	104.6	44%	0.441	59%	0.594	S	S	.	*	H	α-helix	trans	-82.8	-36.8	175.8	52.8	0	0	0	0	112.3	Y15 T20 T21 V22	Y15-S18 PolarHBondContact O-OG 3.1Å; S18-T20 VanDerWaalsContact C-N 3.31Å; S18-T20 PolarHBondContact O-N 2.96Å; S18-T21 WeakPolarHBondContact CA-OG1 3.43Å; S18-T21 PolarHBondContact O-N 3.45Å; S18-T21 PolarHBondContact O-OG1 3.42Å; S18-V22 VanDerWaalsContact O-CG2 3.29Å; S18-V22 WeakPolarHBondContact O-CG2 3.26Å; S18-V22 PolarHBondContact O-N 2.64Å; S18-V22 VanDerWaalsContact O-N 3.15Å
19	A	48.6	Very low	52.9	Low	49 Å²	49	103.1 Å²	103.1	41%	0.405	58%	0.584	S	S	.	*	H	α-helix	trans	-63.5	-38.5	175	0	0	0	0	0	111.7	Y15 V22 V23	Y15-A19 PolarHBondContact O-N 3.48Å; A19-V22 PolarHBondContact O-N 3.44Å; A19-V23 VanDerWaalsContact O-CG2 3.26Å; A19-V23 WeakPolarHBondContact O-CG2 3.29Å; A19-V23 PolarHBondContact O-N 3.15Å; A19-V23 VanDerWaalsContact O-N 3.08Å
20	T	52.3	Low	53.3	Low	75 Å²	75	100.8 Å²	100.8	46%	0.46	57%	0.566	S	S	.	*	H	α-helix	trans	-71.6	-31.3	-179.6	-46.4	0	0	0	0	112.7	L16 S18 K24	L16-T20 WeakPolarHBondContact O-CB 3.43Å; L16-T20 PolarHBondContact O-N 3.03Å; L16-T20 VanDerWaalsContact O-N 3.15Å; L16-T20 PolarHBondContact O-OG1 3.41Å; S18-T20 VanDerWaalsContact C-N 3.31Å; S18-T20 PolarHBondContact O-N 2.96Å; T20-K24 WeakPolarHBondContact O-CB 3.33Å; T20-K24 WeakPolarHBondContact O-CG 3.38Å; T20-K24 PolarHBondContact O-N 3.05Å; T20-K24 VanDerWaalsContact O-N 3.1Å
21	T	52.2	Low	53.9	Low	85 Å²	85	103.5 Å²	103.5	52%	0.521	56%	0.563	S	S	.	*	H	α-helix	trans	-74.2	-37.1	175	29.5	0	0	0	0	112.5	S17 S18 K24 A25	S17-T21 PolarHBondContact O-OG1 3.08Å; S18-T21 WeakPolarHBondContact CA-OG1 3.43Å; S18-T21 PolarHBondContact O-N 3.45Å; S18-T21 PolarHBondContact O-OG1 3.42Å; T21-K24 PolarHBondContact O-N 3.15Å; T21-A25 PolarHBondContact O-N 2.9Å
22	V	54.1	Low	54.4	Low	86 Å²	86	102.9 Å²	102.9	52%	0.521	55%	0.552	S	S	.	*	H	α-helix	trans	-63.9	-47.8	174.7	176.2	0	0	0	0	110.4	S18 A19 K24 A25 D26	S18-V22 VanDerWaalsContact O-CG2 3.29Å; S18-V22 WeakPolarHBondContact O-CG2 3.26Å; S18-V22 PolarHBondContact O-N 2.64Å; S18-V22 VanDerWaalsContact O-N 3.15Å; A19-V22 PolarHBondContact O-N 3.44Å; V22-K24 VanDerWaalsContact C-N 3.3Å; V22-K24 PolarHBondContact O-N 3.01Å; V22-A25 PolarHBondContact O-N 3.32Å; V22-D26 PolarHBondContact O-N 3.1Å
23	V	55.1	Low	54.9	Low	79 Å²	79	105.2 Å²	105.2	48%	0.479	56%	0.555	S	S	.	*	H	α-helix	trans	-62.9	-35.6	177.5	175.2	0	0	0	0	111.9	A19 D26 I27	A19-V23 VanDerWaalsContact O-CG2 3.26Å; A19-V23 WeakPolarHBondContact O-CG2 3.29Å; A19-V23 PolarHBondContact O-N 3.15Å; A19-V23 VanDerWaalsContact O-N 3.08Å; V23-D26 PolarHBondContact O-N 2.77Å; V23-I27 HydrophobicContact CG1-CD1 3.64Å; V23-I27 HydrophobicContact CG1-CG1 4.26Å; V23-I27 WeakPolarHBondContact O-CB 3.2Å; V23-I27 WeakPolarHBondContact O-CD1 3.49Å; V23-I27 WeakPolarHBondContact O-CG1 3.46Å; V23-I27 PolarHBondContact O-N 3.17Å
24	K	56.5	Low	55.2	Low	133 Å²	133	101 Å²	101	58%	0.578	54%	0.541	S	S	*	.	H	α-helix	trans	-66.2	-41.4	174.9	-83.4	-179.4	179.2	-178	0	112.8	T20 T21 V22 D26 I27 L28	T20-K24 WeakPolarHBondContact O-CB 3.33Å; T20-K24 WeakPolarHBondContact O-CG 3.38Å; T20-K24 PolarHBondContact O-N 3.05Å; T20-K24 VanDerWaalsContact O-N 3.1Å; T21-K24 PolarHBondContact O-N 3.15Å; V22-K24 VanDerWaalsContact C-N 3.3Å; V22-K24 PolarHBondContact O-N 3.01Å; K24-D26 VanDerWaalsContact C-N 3.32Å; K24-I27 PolarHBondContact O-N 3.38Å; K24-L28 WeakPolarHBondContact O-CB 3.36Å; K24-L28 WeakPolarHBondContact O-CG 3.43Å; K24-L28 PolarHBondContact O-N 2.74Å
25	A	58.8	Low	55.6	Low	53 Å²	53	96.6 Å²	96.6	44%	0.438	53%	0.533	S	S	.	.	H	α-helix	trans	-64.7	-39	176.4	0	0	0	0	0	111.3	T21 V22 L28 S29	T21-A25 PolarHBondContact O-N 2.9Å; V22-A25 PolarHBondContact O-N 3.32Å; A25-L28 PolarHBondContact O-N 2.93Å; A25-S29 WeakPolarHBondContact O-CB 3.38Å; A25-S29 PolarHBondContact O-N 3.47Å; A25-S29 PolarHBondContact O-OG 3.48Å
26	D	60.3	Low	56	Low	88 Å²	88	93.8 Å²	93.8	47%	0.471	53%	0.53	S	S	.	.	H	α-helix	trans	-68.5	-43.9	176.6	-72.6	-24.6	0	0	0	111.7	V22 V23 K24 L28 S29 L30	V22-D26 PolarHBondContact O-N 3.1Å; V23-D26 PolarHBondContact O-N 2.77Å; K24-D26 VanDerWaalsContact C-N 3.32Å; D26-L28 VanDerWaalsContact C-N 3.32Å; D26-L28 PolarHBondContact O-N 3.18Å; D26-S29 PolarHBondContact O-N 2.98Å; D26-L30 WeakPolarHBondContact O-CB 3.33Å; D26-L30 WeakPolarHBondContact O-CD1 3.31Å; D26-L30 PolarHBondContact O-N 3.49Å
27	I	61.7	Low	56.6	Low	92 Å²	92	93 Å²	93	47%	0.472	52%	0.524	S	S	.	.	H	α-helix	trans	-64	-37.8	176.6	-67.6	165.7	0	0	0	111.3	V23 K24 R31	V23-I27 HydrophobicContact CG1-CD1 3.64Å; V23-I27 HydrophobicContact CG1-CG1 4.26Å; V23-I27 WeakPolarHBondContact O-CB 3.2Å; V23-I27 WeakPolarHBondContact O-CD1 3.49Å; V23-I27 WeakPolarHBondContact O-CG1 3.46Å; V23-I27 PolarHBondContact O-N 3.17Å; K24-I27 PolarHBondContact O-N 3.38Å; I27-R31 WeakPolarHBondContact O-CB 3.42Å; I27-R31 PolarHBondContact O-N 2.88Å
28	L	61.6	Low	57.2	Low	118 Å²	118	92 Å²	92	62%	0.618	52%	0.515	S	S	*	.	H	α-helix	trans	-67	-39.1	174.5	-77.3	167	0	0	0	111.5	K24 A25 D26 R31 A32	K24-L28 WeakPolarHBondContact O-CB 3.36Å; K24-L28 WeakPolarHBondContact O-CG 3.43Å; K24-L28 PolarHBondContact O-N 2.74Å; A25-L28 PolarHBondContact O-N 2.93Å; D26-L28 VanDerWaalsContact C-N 3.32Å; D26-L28 PolarHBondContact O-N 3.18Å; L28-R31 PolarHBondContact O-N 2.89Å; L28-A32 VanDerWaalsContact O-CB 3.23Å; L28-A32 WeakPolarHBondContact O-CB 3.23Å; L28-A32 PolarHBondContact O-N 3.34Å
29	S	61.6	Low	57.9	Low	62 Å²	62	94.3 Å²	94.3	43%	0.434	53%	0.528	S	S	.	.	H	α-helix	trans	-66.2	-44.4	175.1	-57.1	0	0	0	0	111.7	A25 D26 A32 Q33	A25-S29 WeakPolarHBondContact O-CB 3.38Å; A25-S29 PolarHBondContact O-N 3.47Å; A25-S29 PolarHBondContact O-OG 3.48Å; D26-S29 PolarHBondContact O-N 2.98Å; S29-A32 PolarHBondContact O-N 3.41Å; S29-Q33 WeakPolarHBondContact O-CB 3.46Å; S29-Q33 WeakPolarHBondContact O-CG 3.06Å; S29-Q33 PolarHBondContact O-N 3.4Å
30	L	60	Low	58.6	Low	97 Å²	97	102.2 Å²	102.2	51%	0.508	55%	0.547	S	S	.	.	H	α-helix	trans	-63	-41.1	173.1	-90.2	140.3	0	0	0	111.5	D26 N34	D26-L30 WeakPolarHBondContact O-CB 3.33Å; D26-L30 WeakPolarHBondContact O-CD1 3.31Å; D26-L30 PolarHBondContact O-N 3.49Å; L30-N34 VanDerWaalsContact O-CB 3.25Å; L30-N34 WeakPolarHBondContact O-CB 3.18Å; L30-N34 VanDerWaalsContact O-CG 3.29Å; L30-N34 PolarHBondContact O-N 3.31Å; L30-N34 PolarHBondContact O-ND2 2.82Å
31	R	58.9	Low	59.1	Low	178 Å²	178	103.1 Å²	103.1	67%	0.672	55%	0.549	S	S	*	.	H	α-helix	trans	-70.3	-36.2	176	-174.3	178.9	-75.5	-162.8	-3.2	111.3	I27 L28 N34 S35	I27-R31 WeakPolarHBondContact O-CB 3.42Å; I27-R31 PolarHBondContact O-N 2.88Å; L28-R31 PolarHBondContact O-N 2.89Å; R31-N34 PolarHBondContact O-N 2.77Å; R31-S35 WeakPolarHBondContact O-CA 3.33Å; R31-S35 WeakPolarHBondContact O-CB 3.47Å; R31-S35 PolarHBondContact O-N 2.85Å
32	A	61.3	Low	59.7	Low	50 Å²	50	102.5 Å²	102.5	41%	0.413	55%	0.545	S	S	.	.	H	α-helix	trans	-65.5	-45.7	174.8	0	0	0	0	0	110.7	L28 S29 S35 L36	L28-A32 VanDerWaalsContact O-CB 3.23Å; L28-A32 WeakPolarHBondContact O-CB 3.23Å; L28-A32 PolarHBondContact O-N 3.34Å; S29-A32 PolarHBondContact O-N 3.41Å; A32-S35 PolarHBondContact O-N 2.73Å; A32-L36 WeakPolarHBondContact O-CB 3.25Å; A32-L36 VanDerWaalsContact O-CD1 3.31Å; A32-L36 WeakPolarHBondContact O-CD1 3.1Å; A32-L36 PolarHBondContact O-N 2.78Å
33	Q	58.3	Low	60.2	Low	140 Å²	140	106 Å²	106	65%	0.654	55%	0.554	S	S	*	*	H	α-helix	trans	-62.8	-43.2	174.8	-72.3	177.5	-5.6	0	0	112.2	S29 L36 M37	S29-Q33 WeakPolarHBondContact O-CB 3.46Å; S29-Q33 WeakPolarHBondContact O-CG 3.06Å; S29-Q33 PolarHBondContact O-N 3.4Å; Q33-L36 PolarHBondContact O-N 2.77Å; Q33-M37 PolarHBondContact O-N 3.21Å
34	N	56.3	Low	60.6	Low	100 Å²	100	104.9 Å²	104.9	54%	0.535	55%	0.553	S	S	.	*	H	α-helix	trans	-71.2	-31.7	176.5	-76.2	-53.3	0	0	0	113	L30 R31 M37	L30-N34 VanDerWaalsContact O-CB 3.25Å; L30-N34 WeakPolarHBondContact O-CB 3.18Å; L30-N34 VanDerWaalsContact O-CG 3.29Å; L30-N34 PolarHBondContact O-N 3.31Å; L30-N34 PolarHBondContact O-ND2 2.82Å; R31-N34 PolarHBondContact O-N 2.77Å; N34-M37 WeakPolarHBondContact O-CB 3.37Å; N34-M37 PolarHBondContact O-N 3.42Å
35	S	57.8	Low	61.1	Low	90 Å²	90	104.9 Å²	104.9	63%	0.629	55%	0.553	S	S	*	*	H	α-helix	trans	-75.4	-28.5	175	-174.1	0	0	0	0	112	R31 A32	R31-S35 WeakPolarHBondContact O-CA 3.33Å; R31-S35 WeakPolarHBondContact O-CB 3.47Å; R31-S35 PolarHBondContact O-N 2.85Å; A32-S35 PolarHBondContact O-N 2.73Å
36	L	56.4	Low	61.4	Low	121 Å²	121	104.7 Å²	104.7	63%	0.634	55%	0.552	S	S	*	*	H	α-helix	trans	-69.2	-25.8	169.8	-101.8	123.2	0	0	0	111.5	A32 Q33 T38 L41	A32-L36 WeakPolarHBondContact O-CB 3.25Å; A32-L36 VanDerWaalsContact O-CD1 3.31Å; A32-L36 WeakPolarHBondContact O-CD1 3.1Å; A32-L36 PolarHBondContact O-N 2.78Å; Q33-L36 PolarHBondContact O-N 2.77Å; L36-T38 PolarHBondContact O-N 3.29Å; L36-L41 WeakPolarHBondContact O-CD1 3.44Å
37	M	60.1	Low	61.7	Low	110 Å²	110	102.4 Å²	102.4	54%	0.542	55%	0.545	S	S	.	.			trans	-73	68.3	170	-164.2	142.8	83.7	0	0	110.7	Q33 N34 V42	Q33-M37 PolarHBondContact O-N 3.21Å; N34-M37 WeakPolarHBondContact O-CB 3.37Å; N34-M37 PolarHBondContact O-N 3.42Å; M37-V42 HydrophobicContact CE-CG2 4.4Å; M37-V42 HydrophobicContact CG-CG2 3.37Å; M37-V42 HydrophobicContact SD-CG2 4.04Å
38	T	61.5	Low	61.7	Low	63 Å²	63	100.6 Å²	100.6	39%	0.387	54%	0.543	S	S	.	.			trans	-60.6	152.1	169.5	58.1	0	0	0	0	109.4	L36 R40 L41 V42	L36-T38 PolarHBondContact O-N 3.29Å; T38-R40 PolarHBondContact O-N 3.41Å; T38-L41 PolarHBondContact O-N 3.08Å; T38-V42 PolarHBondContact O-N 2.89Å
39	P	61.7	Low	61.6	Low	111 Å²	111	100.1 Å²	100.1	72%	0.721	54%	0.538	S	S	*	.	H	α-helix	trans	-49.4	-27.3	173.5	-28.5	34.5	0	0	0	113.2	F43	P39-F43 VanDerWaalsContact O-CB 3.28Å; P39-F43 WeakPolarHBondContact O-CB 3.42Å; P39-F43 PolarHBondContact O-N 3.21Å
40	R	63.3	Low	61.4	Low	215 Å²	215	106.8 Å²	106.8	81%	0.811	55%	0.554	S	S	*	*	H	α-helix	trans	-64.9	-43.1	173	-70.9	-170.6	167.9	158.7	-1.6	113.7	T38 F43 A44	T38-R40 PolarHBondContact O-N 3.41Å; R40-F43 PolarHBondContact O-N 3.45Å; R40-A44 VanDerWaalsContact O-CB 3.3Å; R40-A44 WeakPolarHBondContact O-CB 3.28Å; R40-A44 PolarHBondContact O-N 3.5Å
41	L	64.2	Low	61.1	Low	94 Å²	94	108.1 Å²	108.1	49%	0.492	56%	0.561	S	S	.	*	H	α-helix	trans	-71	-37.7	176.6	-68.7	-172.6	0	0	0	111.8	L36 T38 F43 A44 F45	L36-L41 WeakPolarHBondContact O-CD1 3.44Å; T38-L41 PolarHBondContact O-N 3.08Å; L41-F43 VanDerWaalsContact C-N 3.34Å; L41-F43 PolarHBondContact O-N 3.04Å; L41-A44 PolarHBondContact O-N 3.29Å; L41-F45 WeakPolarHBondContact O-CB 3.45Å; L41-F45 PolarHBondContact O-N 3.24Å
42	V	63.9	Low	60.7	Low	73 Å²	73	104.1 Å²	104.1	44%	0.442	56%	0.557	S	S	.	*	H	α-helix	trans	-61.2	-44.7	173.1	-179.4	0	0	0	0	110.6	M37 T38 F45 A46	M37-V42 HydrophobicContact CE-CG2 4.4Å; M37-V42 HydrophobicContact CG-CG2 3.37Å; M37-V42 HydrophobicContact SD-CG2 4.04Å; T38-V42 PolarHBondContact O-N 2.89Å; V42-F45 PolarHBondContact O-N 2.88Å; V42-A46 WeakPolarHBondContact O-CB 3.3Å; V42-A46 PolarHBondContact O-N 2.91Å
43	F	65.6	Low	60.2	Low	160 Å²	160	106.1 Å²	106.1	70%	0.702	57%	0.567	S	S	*	*	H	α-helix	trans	-66.6	-40.6	177.5	-162.9	-91.8	0	0	0	112.2	P39 R40 L41 A46 A47	P39-F43 VanDerWaalsContact O-CB 3.28Å; P39-F43 WeakPolarHBondContact O-CB 3.42Å; P39-F43 PolarHBondContact O-N 3.21Å; R40-F43 PolarHBondContact O-N 3.45Å; L41-F43 VanDerWaalsContact C-N 3.34Å; L41-F43 PolarHBondContact O-N 3.04Å; F43-A46 PolarHBondContact O-N 3.44Å; F43-A47 WeakPolarHBondContact O-CB 3.34Å; F43-A47 PolarHBondContact O-N 3.41Å
44	A	63.4	Low	60	Low	55 Å²	55	104.4 Å²	104.4	46%	0.455	57%	0.569	S	S	.	*	H	α-helix	trans	-63.8	-40.1	175.4	0	0	0	0	0	112.2	R40 L41 A48	R40-A44 VanDerWaalsContact O-CB 3.3Å; R40-A44 WeakPolarHBondContact O-CB 3.28Å; R40-A44 PolarHBondContact O-N 3.5Å; L41-A44 PolarHBondContact O-N 3.29Å; A44-A48 VanDerWaalsContact O-CB 3.28Å; A44-A48 WeakPolarHBondContact O-CB 3.43Å; A44-A48 PolarHBondContact O-N 3.19Å
45	F	66	Low	59.8	Low	132 Å²	132	108.8 Å²	108.8	58%	0.579	58%	0.583	S	S	*	*	H	α-helix	trans	-69	-44.6	176.4	-169.3	-99.9	0	0	0	111.9	L41 V42 A47 A48 Q49	L41-F45 WeakPolarHBondContact O-CB 3.45Å; L41-F45 PolarHBondContact O-N 3.24Å; V42-F45 PolarHBondContact O-N 2.88Å; F45-A47 VanDerWaalsContact C-N 3.32Å; F45-A47 PolarHBondContact O-N 3.48Å; F45-A48 PolarHBondContact O-N 3.36Å; F45-Q49 HydrophobicContact CD1-CG 4.27Å; F45-Q49 VanDerWaalsContact CE1-CD 3.48Å; F45-Q49 HydrophobicContact CE1-CG 4.02Å; F45-Q49 HydrophobicContact CZ-CG 4.36Å; F45-Q49 WeakPolarHBondContact O-CG 3.38Å; F45-Q49 PolarHBondContact O-N 2.89Å
46	A	65.4	Low	59.5	Low	50 Å²	50	109.2 Å²	109.2	41%	0.413	59%	0.586	S	S	.	*	H	α-helix	trans	-62.6	-38.7	175.4	0	0	0	0	0	112.1	V42 F43 R50	V42-A46 WeakPolarHBondContact O-CB 3.3Å; V42-A46 PolarHBondContact O-N 2.91Å; F43-A46 PolarHBondContact O-N 3.44Å; A46-R50 PolarHBondContact O-N 3.48Å; A46-R50 VanDerWaalsContact O-N 3.1Å
47	A	65.7	Low	59	Low	40 Å²	40	109.7 Å²	109.7	33%	0.331	59%	0.594	S	S	.	*	H	α-helix	trans	-67.8	-41	174	0	0	0	0	0	112	F43 F45 R50 N51	F43-A47 WeakPolarHBondContact O-CB 3.34Å; F43-A47 PolarHBondContact O-N 3.41Å; F45-A47 VanDerWaalsContact C-N 3.32Å; F45-A47 PolarHBondContact O-N 3.48Å; A47-R50 PolarHBondContact O-N 2.88Å; A47-N51 PolarHBondContact O-N 2.82Å; A47-N51 VanDerWaalsContact O-N 3.14Å
48	A	63.1	Low	58.1	Low	53 Å²	53	113.2 Å²	113.2	44%	0.438	63%	0.63	S	S	.	*	H	α-helix	trans	-63.2	-40.8	175.5	0	0	0	0	0	111.9	A44 F45 N51 T52	A44-A48 VanDerWaalsContact O-CB 3.28Å; A44-A48 WeakPolarHBondContact O-CB 3.43Å; A44-A48 PolarHBondContact O-N 3.19Å; F45-A48 PolarHBondContact O-N 3.36Å; A48-N51 PolarHBondContact O-N 3.5Å; A48-T52 PolarHBondContact O-N 2.91Å; A48-T52 VanDerWaalsContact O-N 3.08Å; A48-T52 PolarHBondContact O-OG1 3.33Å; A48-T52 VanDerWaalsContact O-OG1 3.04Å
49	Q	59.9	Low	57.9	Low	108 Å²	108	115.8 Å²	115.8	51%	0.505	64%	0.642	S	S	.	*	H	α-helix	trans	-67.6	-33.4	176.2	-73.9	-162	-21.6	0	0	113.3	F45 N51 T52 C53	F45-Q49 HydrophobicContact CD1-CG 4.27Å; F45-Q49 VanDerWaalsContact CE1-CD 3.48Å; F45-Q49 HydrophobicContact CE1-CG 4.02Å; F45-Q49 HydrophobicContact CZ-CG 4.36Å; F45-Q49 WeakPolarHBondContact O-CG 3.38Å; F45-Q49 PolarHBondContact O-N 2.89Å; Q49-N51 VanDerWaalsContact C-N 3.32Å; Q49-T52 WeakPolarHBondContact CA-OG1 3.2Å; Q49-T52 PolarHBondContact O-N 3.1Å; Q49-T52 PolarHBondContact O-OG1 2.87Å; Q49-C53 WeakPolarHBondContact O-CB 3.28Å; Q49-C53 PolarHBondContact O-N 2.93Å; Q49-C53 VanDerWaalsContact O-N 3.1Å
50	R	56	Low	57.7	Low	203 Å²	203	116 Å²	116	77%	0.766	64%	0.638	S	S	*	*	H	α-helix	trans	-66.5	-33.9	171.3	-78	-167.9	-179.8	167.1	1.3	112.5	A46 A47	A46-R50 PolarHBondContact O-N 3.48Å; A46-R50 VanDerWaalsContact O-N 3.1Å; A47-R50 PolarHBondContact O-N 2.88Å
51	N	53.4	Low	57.4	Low	125 Å²	125	110.5 Å²	110.5	67%	0.668	63%	0.628	S	S	*	*	H	α-helix	trans	-78.8	-23.1	178	-77.9	-20	0	0	0	114	A47 A48 Q49	A47-N51 PolarHBondContact O-N 2.82Å; A47-N51 VanDerWaalsContact O-N 3.14Å; A48-N51 PolarHBondContact O-N 3.5Å; Q49-N51 VanDerWaalsContact C-N 3.32Å
52	T	52.5	Low	57	Low	93 Å²	93	111.5 Å²	111.5	57%	0.571	64%	0.636	S	S	*	*	H	α-helix	trans	-85.4	-23.9	172	37.2	0	0	0	0	113.5	A48 Q49 C54 S56	A48-T52 PolarHBondContact O-N 2.91Å; A48-T52 VanDerWaalsContact O-N 3.08Å; A48-T52 PolarHBondContact O-OG1 3.33Å; A48-T52 VanDerWaalsContact O-OG1 3.04Å; Q49-T52 WeakPolarHBondContact CA-OG1 3.2Å; Q49-T52 PolarHBondContact O-N 3.1Å; Q49-T52 PolarHBondContact O-OG1 2.87Å; T52-C54 VanDerWaalsContact C-N 3.27Å; T52-C54 PolarHBondContact O-N 3.1Å; T52-S56 PolarHBondContact O-OG 3.14Å
53	C	50.7	Low	56.6	Low	93 Å²	93	113.9 Å²	113.9	63%	0.628	65%	0.648	S	S	*	*	H	α-helix	trans	-68.8	-24.7	175.5	-165.2	0	0	0	0	113	Q49	Q49-C53 WeakPolarHBondContact O-CB 3.28Å; Q49-C53 PolarHBondContact O-N 2.93Å; Q49-C53 VanDerWaalsContact O-N 3.1Å
54	C	52.2	Low	56	Low	103 Å²	103	110.8 Å²	110.8	70%	0.696	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.3	-1.9	-178.5	-63.5	0	0	0	0	115	T52	T52-C54 VanDerWaalsContact C-N 3.27Å; T52-C54 PolarHBondContact O-N 3.1Å
55	K	52.3	Low	55.5	Low	192 Å²	192	114.8 Å²	114.8	84%	0.835	66%	0.658	S	S	*	*	S	Bend	trans	-92.4	-0.3	175.1	-90.4	-170.8	174.6	-178.6	0	114.4
56	S	51.6	Low	54.7	Low	100 Å²	100	113.5 Å²	113.5	70%	0.699	66%	0.664	S	S	*	*	S	Bend	trans	-110.7	7.3	-176.5	-37.7	0	0	0	0	113.8	T52	T52-S56 PolarHBondContact O-OG 3.14Å
57	V	45.7	Very low	53.8	Low	130 Å²	130	118.8 Å²	118.8	79%	0.788	69%	0.685	S	S	*	*			trans	-125.2	73.9	177	-166	0	0	0	0	107.7
58	S	42.3	Very low	52.7	Low	185 Å²	185	125.9 Å²	125.9	100%	1.294	72%	0.717	S	S	*	*			trans	-102.2	0	157.4	-178.9	0	0	0	0	108.9

Retrieved 58 of 58 residues in 49.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).